BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023K20

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352716.1|  PREDICTED: uncharacterized protein LOC102578...    146   2e-36   Solanum tuberosum [potatoes]
ref|XP_006352719.1|  PREDICTED: uncharacterized protein LOC102578...    146   2e-36   Solanum tuberosum [potatoes]
ref|XP_006352718.1|  PREDICTED: uncharacterized protein LOC102578...    146   2e-36   
ref|XP_006352717.1|  PREDICTED: uncharacterized protein LOC102578...    146   2e-36   Solanum tuberosum [potatoes]
ref|XP_009592673.1|  PREDICTED: uncharacterized protein LOC104089...    145   3e-36   Nicotiana tomentosiformis
ref|XP_009592672.1|  PREDICTED: uncharacterized protein LOC104089...    145   3e-36   Nicotiana tomentosiformis
ref|XP_009770284.1|  PREDICTED: uncharacterized protein LOC104221...    145   5e-36   Nicotiana sylvestris
ref|XP_009770277.1|  PREDICTED: uncharacterized protein LOC104221...    145   5e-36   Nicotiana sylvestris
ref|XP_006352720.1|  PREDICTED: uncharacterized protein LOC102578...    144   7e-36   
ref|XP_010323074.1|  PREDICTED: uncharacterized protein LOC101266...    144   9e-36   
ref|XP_010323073.1|  PREDICTED: uncharacterized protein LOC101266...    144   9e-36   
ref|XP_010323075.1|  PREDICTED: uncharacterized protein LOC101266...    144   9e-36   
ref|XP_010323076.1|  PREDICTED: uncharacterized protein LOC101266...    144   1e-35   
ref|XP_006350289.1|  PREDICTED: uncharacterized protein LOC102583747    143   2e-35   Solanum tuberosum [potatoes]
ref|XP_009589098.1|  PREDICTED: uncharacterized protein LOC104086...    141   1e-34   Nicotiana tomentosiformis
ref|XP_010323077.1|  PREDICTED: uncharacterized protein LOC101266...    140   1e-34   Solanum lycopersicum
ref|XP_004247114.1|  PREDICTED: uncharacterized protein LOC101266...    139   7e-34   Solanum lycopersicum
ref|XP_009589097.1|  PREDICTED: uncharacterized protein LOC104086...    137   4e-33   Nicotiana tomentosiformis
ref|XP_009589093.1|  PREDICTED: uncharacterized protein LOC104086...    137   4e-33   Nicotiana tomentosiformis
ref|XP_009780627.1|  PREDICTED: uncharacterized protein LOC104229...    134   2e-32   Nicotiana sylvestris
ref|XP_009780624.1|  PREDICTED: uncharacterized protein LOC104229...    134   2e-32   Nicotiana sylvestris
ref|XP_010091854.1|  hypothetical protein L484_015923                   134   4e-32   Morus notabilis
emb|CAN81514.1|  hypothetical protein VITISV_012030                     132   1e-31   Vitis vinifera
emb|CBI37234.3|  unnamed protein product                                132   2e-31   Vitis vinifera
ref|XP_011024525.1|  PREDICTED: uncharacterized protein LOC105125...    132   2e-31   Populus euphratica
ref|XP_002267519.1|  PREDICTED: uncharacterized protein LOC100241...    131   4e-31   Vitis vinifera
gb|KDP26434.1|  hypothetical protein JCGZ_17592                         130   9e-31   Jatropha curcas
ref|XP_007050069.1|  Uncharacterized protein isoform 1                  129   1e-30   
ref|XP_007050070.1|  Uncharacterized protein isoform 2                  129   1e-30   
ref|XP_002303096.2|  hypothetical protein POPTR_0002s25490g             128   3e-30   
ref|XP_006386899.1|  hypothetical protein POPTR_0002s25490g             128   3e-30   
gb|EYU17961.1|  hypothetical protein MIMGU_mgv1a0013543mg               125   4e-30   Erythranthe guttata [common monkey flower]
gb|KDO65803.1|  hypothetical protein CISIN_1g001807mg                   126   2e-29   Citrus sinensis [apfelsine]
ref|XP_004292261.1|  PREDICTED: uncharacterized protein LOC101294433    125   3e-29   Fragaria vesca subsp. vesca
gb|KDO65805.1|  hypothetical protein CISIN_1g001807mg                   124   9e-29   Citrus sinensis [apfelsine]
gb|KDO65804.1|  hypothetical protein CISIN_1g001807mg                   124   9e-29   Citrus sinensis [apfelsine]
ref|XP_006443684.1|  hypothetical protein CICLE_v10018694mg             123   3e-28   Citrus clementina [clementine]
gb|KHG22481.1|  Viral inhibitor of RIP activation                       121   8e-28   Gossypium arboreum [tree cotton]
gb|KJB10997.1|  hypothetical protein B456_001G235600                    120   1e-27   Gossypium raimondii
ref|XP_011080145.1|  PREDICTED: uncharacterized protein LOC105163485    120   3e-27   Sesamum indicum [beniseed]
ref|XP_011024528.1|  PREDICTED: uncharacterized protein LOC105125...    120   3e-27   Populus euphratica
gb|KJB10994.1|  hypothetical protein B456_001G235600                    119   3e-27   Gossypium raimondii
ref|XP_010684822.1|  PREDICTED: uncharacterized protein LOC104899...    119   3e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010684824.1|  PREDICTED: uncharacterized protein LOC104899...    119   4e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009371010.1|  PREDICTED: uncharacterized protein LOC103960...    119   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_007162644.1|  hypothetical protein PHAVU_001G168100g             119   4e-27   Phaseolus vulgaris [French bean]
emb|CDP03827.1|  unnamed protein product                                119   4e-27   Coffea canephora [robusta coffee]
ref|XP_008372424.1|  PREDICTED: uncharacterized protein LOC103435...    119   4e-27   
gb|KJB10995.1|  hypothetical protein B456_001G235600                    119   6e-27   Gossypium raimondii
gb|KJB10996.1|  hypothetical protein B456_001G235600                    119   7e-27   Gossypium raimondii
ref|XP_010652446.1|  PREDICTED: uncharacterized protein LOC100241...    118   9e-27   Vitis vinifera
ref|XP_006576977.1|  PREDICTED: uncharacterized protein LOC100793360    118   1e-26   Glycine max [soybeans]
gb|KHN09408.1|  hypothetical protein glysoja_016507                     118   1e-26   Glycine soja [wild soybean]
ref|XP_006604525.1|  PREDICTED: uncharacterized protein LOC100816...    117   3e-26   Glycine max [soybeans]
ref|XP_008382666.1|  PREDICTED: uncharacterized protein LOC103445438    116   6e-26   
ref|XP_009371001.1|  PREDICTED: uncharacterized protein LOC103960...    115   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_008372423.1|  PREDICTED: uncharacterized protein LOC103435...    115   8e-26   
ref|XP_002521158.1|  conserved hypothetical protein                     112   1e-24   
ref|XP_008235543.1|  PREDICTED: uncharacterized protein LOC103334363    112   1e-24   Prunus mume [ume]
ref|XP_007199004.1|  hypothetical protein PRUPE_ppa000852mg             111   3e-24   Prunus persica
gb|KJB26066.1|  hypothetical protein B456_004G223300                    105   1e-22   Gossypium raimondii
gb|KJB26068.1|  hypothetical protein B456_004G223300                    106   2e-22   Gossypium raimondii
gb|KJB26065.1|  hypothetical protein B456_004G223300                    105   2e-22   Gossypium raimondii
gb|KJB26067.1|  hypothetical protein B456_004G223300                    103   9e-22   Gossypium raimondii
ref|XP_010243642.1|  PREDICTED: uncharacterized protein LOC104587...    103   9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010243641.1|  PREDICTED: uncharacterized protein LOC104587...    103   9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_004493852.1|  PREDICTED: uro-adherence factor A-like isofo...    103   9e-22   Cicer arietinum [garbanzo]
gb|EYU46370.1|  hypothetical protein MIMGU_mgv1a000965mg                103   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_010243643.1|  PREDICTED: uncharacterized protein LOC104587...    102   3e-21   Nelumbo nucifera [Indian lotus]
emb|CDY35217.1|  BnaA01g08140D                                          102   4e-21   Brassica napus [oilseed rape]
ref|XP_009129280.1|  PREDICTED: uncharacterized protein LOC103854122    101   4e-21   Brassica rapa
ref|XP_006284953.1|  hypothetical protein CARUB_v10006255mg             101   7e-21   Capsella rubella
ref|XP_010540945.1|  PREDICTED: uncharacterized protein LOC104814...    100   9e-21   Tarenaya hassleriana [spider flower]
ref|XP_010540953.1|  PREDICTED: uncharacterized protein LOC104814...    100   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_006412913.1|  hypothetical protein EUTSA_v10024350mg             100   1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_003625464.1|  hypothetical protein MTR_7g099410                  100   1e-20   Medicago truncatula
emb|CDY06873.1|  BnaC01g09720D                                          100   2e-20   
ref|XP_010447916.1|  PREDICTED: uncharacterized protein LOC104730...  98.6    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008447347.1|  PREDICTED: uncharacterized protein LOC103489819  97.1    2e-19   Cucumis melo [Oriental melon]
ref|XP_010433164.1|  PREDICTED: uncharacterized protein LOC104717...  97.1    2e-19   Camelina sativa [gold-of-pleasure]
gb|KGN58324.1|  hypothetical protein Csa_3G622430                     97.1    2e-19   Cucumis sativus [cucumbers]
ref|XP_010438384.1|  PREDICTED: uncharacterized protein LOC104721...  96.7    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010038329.1|  PREDICTED: uncharacterized protein LOC104426860  96.3    4e-19   Eucalyptus grandis [rose gum]
ref|XP_002869475.1|  hypothetical protein ARALYDRAFT_491881           95.5    7e-19   
ref|XP_010263991.1|  PREDICTED: uncharacterized protein LOC104602...  95.5    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010263989.1|  PREDICTED: uncharacterized protein LOC104602...  95.5    8e-19   
ref|XP_010263990.1|  PREDICTED: uncharacterized protein LOC104602...  95.5    8e-19   Nelumbo nucifera [Indian lotus]
gb|KHG04276.1|  Methyl-coenzyme M reductase II subunit gamma          95.1    9e-19   Gossypium arboreum [tree cotton]
ref|NP_567819.1|  uncharacterized protein                             94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083092.1|  PREDICTED: uncharacterized protein LOC105165697  94.0    2e-18   Sesamum indicum [beniseed]
dbj|BAH19995.1|  AT4G28760                                            94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069683.1|  PREDICTED: uncharacterized protein LOC104456566  93.2    4e-18   Eucalyptus grandis [rose gum]
ref|XP_010556872.1|  PREDICTED: uncharacterized protein LOC104826058  91.3    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_010940679.1|  PREDICTED: uncharacterized protein LOC105059...  90.9    2e-17   Elaeis guineensis
ref|XP_010940678.1|  PREDICTED: uncharacterized protein LOC105059...  90.9    2e-17   Elaeis guineensis
ref|XP_010526471.1|  PREDICTED: uncharacterized protein LOC104804...  88.6    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_008809662.1|  PREDICTED: uncharacterized protein LOC103721...  88.6    2e-16   Phoenix dactylifera
ref|XP_008809664.1|  PREDICTED: uncharacterized protein LOC103721...  88.2    2e-16   
ref|XP_004139729.1|  PREDICTED: uncharacterized protein LOC101207165  87.4    4e-16   Cucumis sativus [cucumbers]
ref|XP_008461986.1|  PREDICTED: uncharacterized protein LOC103500466  87.4    4e-16   Cucumis melo [Oriental melon]
ref|XP_008789491.1|  PREDICTED: uncharacterized protein LOC103706...  87.0    5e-16   Phoenix dactylifera
ref|XP_008789490.1|  PREDICTED: uncharacterized protein LOC103706...  86.7    6e-16   Phoenix dactylifera
ref|XP_008789489.1|  PREDICTED: uncharacterized protein LOC103706...  86.7    6e-16   Phoenix dactylifera
ref|XP_008809661.1|  PREDICTED: uncharacterized protein LOC103721...  82.8    1e-14   Phoenix dactylifera
ref|XP_008809663.1|  PREDICTED: uncharacterized protein LOC103721...  82.4    2e-14   Phoenix dactylifera
ref|XP_010918845.1|  PREDICTED: uncharacterized protein LOC105043126  81.6    3e-14   Elaeis guineensis
ref|XP_006375643.1|  hypothetical protein POPTR_0014s18540g           81.3    4e-14   
ref|XP_006854321.1|  hypothetical protein AMTR_s00039p00119340        79.7    2e-13   Amborella trichopoda
ref|XP_009411376.1|  PREDICTED: uncharacterized protein LOC103993144  79.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008367440.1|  PREDICTED: homeobox-leucine zipper protein H...  73.6    7e-12   
ref|XP_004954364.1|  PREDICTED: uncharacterized protein LOC101771...  73.6    1e-11   Setaria italica
ref|XP_003570390.1|  PREDICTED: uncharacterized protein LOC100830114  70.1    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_006403169.1|  hypothetical protein EUTSA_v10003146mg           69.7    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010441970.1|  PREDICTED: uncharacterized protein LOC104725...  68.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010441972.1|  PREDICTED: uncharacterized protein LOC104725...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006648110.1|  PREDICTED: uncharacterized protein LOC102717592  67.8    9e-10   Oryza brachyantha
ref|XP_008679171.1|  PREDICTED: uncharacterized protein LOC103654...  67.4    1e-09   
ref|XP_008679173.1|  PREDICTED: uncharacterized protein LOC103654...  67.4    1e-09   Zea mays [maize]
ref|XP_009382176.1|  PREDICTED: uncharacterized protein LOC103970...  66.6    2e-09   
ref|XP_009407163.1|  PREDICTED: uncharacterized protein LOC103989929  66.6    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410914.1|  PREDICTED: uncharacterized protein LOC103992...  66.2    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410963.1|  PREDICTED: uncharacterized protein LOC103992...  66.2    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO65806.1|  hypothetical protein CISIN_1g001807mg                 65.9    4e-09   Citrus sinensis [apfelsine]
ref|XP_008679165.1|  PREDICTED: uncharacterized protein LOC103654...  65.5    5e-09   Zea mays [maize]
ref|XP_008679172.1|  PREDICTED: uncharacterized protein LOC103654...  65.5    5e-09   
emb|CDX94731.1|  BnaC07g17400D                                        64.7    8e-09   
ref|XP_008646431.1|  PREDICTED: uncharacterized protein LOC103627...  64.3    1e-08   Zea mays [maize]
gb|EMT03099.1|  hypothetical protein F775_52439                       63.9    2e-08   
gb|EMS54382.1|  hypothetical protein TRIUR3_15055                     63.5    2e-08   Triticum urartu
gb|EPS67990.1|  hypothetical protein M569_06787                       58.9    5e-08   Genlisea aurea
gb|EEC74239.1|  hypothetical protein OsI_09439                        62.0    6e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001048512.1|  Os02g0816400                                     62.0    6e-08   
ref|XP_008646424.1|  PREDICTED: uncharacterized protein LOC103627...  61.6    9e-08   Zea mays [maize]
ref|XP_008646430.1|  PREDICTED: uncharacterized protein LOC103627...  61.6    9e-08   Zea mays [maize]
ref|XP_010481809.1|  PREDICTED: uncharacterized protein LOC104760...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006279984.1|  hypothetical protein CARUB_v10025855mg           60.5    2e-07   
ref|XP_006279983.1|  hypothetical protein CARUB_v10025855mg           60.5    2e-07   Capsella rubella
ref|XP_010494373.1|  PREDICTED: uncharacterized protein LOC104771...  60.1    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010494375.1|  PREDICTED: uncharacterized protein LOC104771...  60.1    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002863627.1|  hypothetical protein ARALYDRAFT_494617           58.5    8e-07   
emb|CDY32928.1|  BnaA09g16650D                                        58.5    8e-07   Brassica napus [oilseed rape]
ref|XP_009113974.1|  PREDICTED: uncharacterized protein LOC103839223  58.5    9e-07   Brassica rapa
gb|EAY88009.1|  hypothetical protein OsI_09433                        57.8    9e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010933202.1|  PREDICTED: uncharacterized protein LOC105053...  58.5    9e-07   
ref|XP_010933203.1|  PREDICTED: uncharacterized protein LOC105053...  58.5    1e-06   Elaeis guineensis
gb|ACN40217.1|  unknown                                               58.2    1e-06   Picea sitchensis
ref|XP_009418765.1|  PREDICTED: uncharacterized protein LOC103998...  57.8    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418989.1|  PREDICTED: uncharacterized protein LOC103998...  57.8    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199201.1|  uncharacterized protein                             57.0    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382188.1|  PREDICTED: uncharacterized protein LOC103970...  55.8    6e-06   
emb|CDY50812.1|  BnaCnng19760D                                        55.1    1e-05   Brassica napus [oilseed rape]
ref|XP_009405681.1|  PREDICTED: uncharacterized protein LOC103988772  52.8    6e-05   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_006352716.1| PREDICTED: uncharacterized protein LOC102578662 isoform X1 [Solanum 
tuberosum]
Length=1089

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
            EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126  EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  184  YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  219



>ref|XP_006352719.1| PREDICTED: uncharacterized protein LOC102578662 isoform X4 [Solanum 
tuberosum]
Length=1087

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
            EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126  EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  184  YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  219



>ref|XP_006352718.1| PREDICTED: uncharacterized protein LOC102578662 isoform X3 [Solanum 
tuberosum]
Length=1088

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
            EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126  EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  184  YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  219



>ref|XP_006352717.1| PREDICTED: uncharacterized protein LOC102578662 isoform X2 [Solanum 
tuberosum]
Length=1088

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARM  510
            EM   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM
Sbjct  126  EMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRM  183

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  184  YPSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  219



>ref|XP_009592673.1| PREDICTED: uncharacterized protein LOC104089467 isoform X2 [Nicotiana 
tomentosiformis]
Length=974

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   Q+GK+R  +KP PGCLGRMVNLFD+N GV GNRLLTDKPHRDG+L RSQSDV R+S
Sbjct  1    MNGFQSGKSRNHDKPSPGCLGRMVNLFDINSGVPGNRLLTDKPHRDGTLLRSQSDVVRLS  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQ+E+K IVS+L+R +S  K+NGTP+KMLIA+
Sbjct  61   PSEDQVEEKNIVSDLKRTSSNRKSNGTPIKMLIAQ  95



>ref|XP_009592672.1| PREDICTED: uncharacterized protein LOC104089467 isoform X1 [Nicotiana 
tomentosiformis]
Length=975

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   Q+GK+R  +KP PGCLGRMVNLFD+N GV GNRLLTDKPHRDG+L RSQSDV R+S
Sbjct  1    MNGFQSGKSRNHDKPSPGCLGRMVNLFDINSGVPGNRLLTDKPHRDGTLLRSQSDVVRLS  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQ+E+K IVS+L+R +S  K+NGTP+KMLIA+
Sbjct  61   PSEDQVEEKNIVSDLKRTSSNRKSNGTPIKMLIAQ  95



>ref|XP_009770284.1| PREDICTED: uncharacterized protein LOC104221001 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   Q+GK+R  +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSL RSQSDV R+S
Sbjct  1    MNGFQSGKSRNHDKPSPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSLLRSQSDVVRLS  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQ+E+K IVS+L+R +S  K+NGTP+K+LIA+
Sbjct  61   PSEDQVEEKMIVSDLKRTSSNRKSNGTPIKLLIAQ  95



>ref|XP_009770277.1| PREDICTED: uncharacterized protein LOC104221001 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   Q+GK+R  +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSL RSQSDV R+S
Sbjct  1    MNGFQSGKSRNHDKPSPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSLLRSQSDVVRLS  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQ+E+K IVS+L+R +S  K+NGTP+K+LIA+
Sbjct  61   PSEDQVEEKMIVSDLKRTSSNRKSNGTPIKLLIAQ  95



>ref|XP_006352720.1| PREDICTED: uncharacterized protein LOC102578662 isoform X5 [Solanum 
tuberosum]
Length=963

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 80/95 (84%), Gaps = 2/95 (2%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGN+LLTDKPH  GSLSRSQSDV RM 
Sbjct  1    MNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVAGNKLLTDKPH--GSLSRSQSDVVRMY  58

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PS DQIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  59   PSGDQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  93



>ref|XP_010323074.1| PREDICTED: uncharacterized protein LOC101266733 isoform X2 [Solanum 
lycopersicum]
Length=987

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  310  FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
            F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18   FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  76   QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  118



>ref|XP_010323073.1| PREDICTED: uncharacterized protein LOC101266733 isoform X1 [Solanum 
lycopersicum]
Length=988

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  310  FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
            F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18   FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  76   QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  118



>ref|XP_010323075.1| PREDICTED: uncharacterized protein LOC101266733 isoform X3 [Solanum 
lycopersicum]
Length=985

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  310  FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
            F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18   FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  76   QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  118



>ref|XP_010323076.1| PREDICTED: uncharacterized protein LOC101266733 isoform X4 [Solanum 
lycopersicum]
Length=984

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  310  FALLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRS  489
            F  +   EM   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRS
Sbjct  18   FVCVSGGEMNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRS  75

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QSDV RM PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  76   QSDVVRMYPSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  118



>ref|XP_006350289.1| PREDICTED: uncharacterized protein LOC102583747 [Solanum tuberosum]
Length=975

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M  +QNG++R  +KP PGCLGRMVNLFDLN GVAGNRLLTDKPHRDGSLSRSQSD+ R+ 
Sbjct  1    MNGLQNGRSRTYDKPSPGCLGRMVNLFDLNSGVAGNRLLTDKPHRDGSLSRSQSDLVRLP  60

Query  514  P-SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            P SEDQ+E+K +VS L+R NS  K+NG PMKMLIA+
Sbjct  61   PSSEDQVEEKMVVSGLKRTNSNRKSNGMPMKMLIAQ  96



>ref|XP_009589098.1| PREDICTED: uncharacterized protein LOC104086523 isoform X3 [Nicotiana 
tomentosiformis]
Length=972

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1    MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQIE K I S+L+RN+S  K+NGTPMK LIA+
Sbjct  59   PSEDQIEGKMIFSDLKRNSSNKKSNGTPMKKLIAQ  93



>ref|XP_010323077.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323078.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323079.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
Length=963

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN GV GN+LLTDKPH  GSLSRSQSDV RM 
Sbjct  1    MNGFQNGKNCNLDKPFPGCLGRMVNLFDLNSGVTGNKLLTDKPH--GSLSRSQSDVVRMY  58

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            PS +QIE+K IVS+L+RN+S  K+NGTPMKMLIA+
Sbjct  59   PSGNQIEEKMIVSDLKRNSSNRKSNGTPMKMLIAQ  93



>ref|XP_004247114.1| PREDICTED: uncharacterized protein LOC101266067 isoform X1 [Solanum 
lycopersicum]
Length=981

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNG+    +KP PGCLGRMVNLFDLN GV GNRLLTDKPHRDGSLSRSQSD+ R+ 
Sbjct  1    MNGFQNGRIHTHDKPSPGCLGRMVNLFDLNSGVTGNRLLTDKPHRDGSLSRSQSDLVRLP  60

Query  514  P-SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            P SEDQ+E+K +VS+L+R NS  K+NG PMKMLIA+
Sbjct  61   PSSEDQVEEKMVVSDLKRTNSNRKSNGMPMKMLIAQ  96



>ref|XP_009589097.1| PREDICTED: uncharacterized protein LOC104086523 isoform X2 [Nicotiana 
tomentosiformis]
Length=976

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1    MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514  PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQIE K     +I S+L+RN+S  K+NGTPMK LIA+
Sbjct  59   PSEDQIEGKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQ  98



>ref|XP_009589093.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589095.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589096.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
Length=977

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN GVAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1    MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSGVAGNRMLTDKPH--GSLSRSQSDVVRAY  58

Query  514  PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQIE K     +I S+L+RN+S  K+NGTPMK LIA+
Sbjct  59   PSEDQIEGKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQ  98



>ref|XP_009780627.1| PREDICTED: uncharacterized protein LOC104229654 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN  VAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1    MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSVVAGNRMLTDKPH--GSLSRSQSDVVRTY  58

Query  514  PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQIE+K     +I S+L+RN+S  K+NGTPMK LIA+
Sbjct  59   PSEDQIEEKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQ  98



>ref|XP_009780624.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780625.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780626.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMS  513
            M   QNGKN  L+KP PGCLGRMVNLFDLN  VAGNR+LTDKPH  GSLSRSQSDV R  
Sbjct  1    MNGFQNGKNSNLDKPFPGCLGRMVNLFDLNSVVAGNRMLTDKPH--GSLSRSQSDVVRTY  58

Query  514  PSEDQIEDK-----EIVSELRRNNSKMKANGTPMKMLIAE  618
            PSEDQIE+K     +I S+L+RN+S  K+NGTPMK LIA+
Sbjct  59   PSEDQIEEKMIWCMQIFSDLKRNSSNKKSNGTPMKKLIAQ  98



>ref|XP_010091854.1| hypothetical protein L484_015923 [Morus notabilis]
 gb|EXB46062.1| hypothetical protein L484_015923 [Morus notabilis]
Length=981

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +QN K    EKP PGCLGRMVNLFDL+ GVAGNR+LTD+PH DG SL+RSQSDV+RM
Sbjct  1    MNGIQNRKALNAEKPFPGCLGRMVNLFDLSTGVAGNRMLTDRPHHDGSSLARSQSDVSRM  60

Query  511  -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP  D+IEDK IVSE+RRN+S  KANGTPMKMLI +
Sbjct  61   SSPFVDKIEDKLIVSEIRRNSSNRKANGTPMKMLIDQ  97



>emb|CAN81514.1| hypothetical protein VITISV_012030 [Vitis vinifera]
Length=1081

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1    MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511  -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+ DQ+EDK +VSEL R +++ K+NGTPMKMLIA+
Sbjct  61   SSPTGDQVEDKPMVSELSRTSNR-KSNGTPMKMLIAQ  96



>emb|CBI37234.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1    MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511  -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+ DQ+EDK +VSEL R +++ K+NGTP+KMLIA+
Sbjct  61   SSPTGDQVEDKPMVSELSRTSNR-KSNGTPVKMLIAQ  96



>ref|XP_011024525.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024526.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024527.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
Length=996

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K + +EKP PGCLGRMVNLFDLN GVAGNRLLTDKPH DG S+SRSQSDVARM
Sbjct  1    MNGMQYRKGQSIEKPFPGCLGRMVNLFDLNNGVAGNRLLTDKPHYDGSSISRSQSDVARM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
               P  DQ+EDK IVSELRR++   KAN TPMK LIA+
Sbjct  61   LSVPFGDQVEDKMIVSELRRSSLNKKANATPMKTLIAQ  98



>ref|XP_002267519.1| PREDICTED: uncharacterized protein LOC100241277 isoform X1 [Vitis 
vinifera]
Length=991

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1    MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511  -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+ DQ+EDK +VSEL R +++ K+NGTP+KMLIA+
Sbjct  61   SSPTGDQVEDKPMVSELSRTSNR-KSNGTPVKMLIAQ  96



>gb|KDP26434.1| hypothetical protein JCGZ_17592 [Jatropha curcas]
Length=965

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K + +EKP PGCLGRMV+LFDL  GV GNRLLTDKPH DG SLSRS+SDVARM
Sbjct  1    MNGIQGRKTQNVEKPFPGCLGRMVSLFDLANGVTGNRLLTDKPHHDGYSLSRSRSDVARM  60

Query  511  SPSE--DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
              S   D +EDK IVSELRR++S  KANGTPMK LIA+
Sbjct  61   KSSSFGDHVEDKMIVSELRRSSSNAKANGTPMKTLIAQ  98



>ref|XP_007050069.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94226.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=984

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +QN K + +EK  PGCLGRMVNLFDLN G+ GNRLLTDKPH DG SLSRSQSDV RM
Sbjct  1    MNGIQNRKGQNIEK-FPGCLGRMVNLFDLNTGIPGNRLLTDKPHPDGSSLSRSQSDVVRM  59

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SPS  DQIEDK +VSELRR  S  KANGTPMKMLIA+
Sbjct  60   LSPSFGDQIEDKVVVSELRRTLSNKKANGTPMKMLIAQ  97



>ref|XP_007050070.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94227.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=988

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +QN K + +EK  PGCLGRMVNLFDLN G+ GNRLLTDKPH DG SLSRSQSDV RM
Sbjct  1    MNGIQNRKGQNIEK-FPGCLGRMVNLFDLNTGIPGNRLLTDKPHPDGSSLSRSQSDVVRM  59

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SPS  DQIEDK +VSELRR  S  KANGTPMKMLIA+
Sbjct  60   LSPSFGDQIEDKVVVSELRRTLSNKKANGTPMKMLIAQ  97



>ref|XP_002303096.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|EEE82369.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=940

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K + +EKP PGCLGRMVNLFDL+ GVAGNRLLTDKPH DG S+SRSQSDVARM
Sbjct  1    MNGMQYRKGQKIEKPFPGCLGRMVNLFDLSNGVAGNRLLTDKPHHDGSSISRSQSDVARM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
               P  DQ+EDK IVSEL+R++   KAN TPMK LIA+
Sbjct  61   LSVPFGDQVEDKMIVSELKRSSLNKKANATPMKTLIAQ  98



>ref|XP_006386899.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|ERP64696.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=968

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K + +EKP PGCLGRMVNLFDL+ GVAGNRLLTDKPH DG S+SRSQSDVARM
Sbjct  1    MNGMQYRKGQKIEKPFPGCLGRMVNLFDLSNGVAGNRLLTDKPHHDGSSISRSQSDVARM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
               P  DQ+EDK IVSEL+R++   KAN TPMK LIA+
Sbjct  61   LSVPFGDQVEDKMIVSELKRSSLNKKANATPMKTLIAQ  98



>gb|EYU17961.1| hypothetical protein MIMGU_mgv1a0013543mg, partial [Erythranthe 
guttata]
Length=558

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE  522
            +NGK    EK  PGCLGRMVNLF++N GV+ N+LLTDKPHRDGS +SRS+SDV R SPS 
Sbjct  6    RNGKTSDFEKTYPGCLGRMVNLFEMNIGVSANKLLTDKPHRDGSPVSRSRSDVTRTSPSH  65

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQI++K IVSELR  +S+ K N TPMKMLIA+
Sbjct  66   DQIQEKAIVSELRNTSSQRKLNVTPMKMLIAQ  97



>gb|KDO65803.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1010

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 5/101 (5%)
 Frame = +1

Query  331  EMYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDV  501
            EM  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDV
Sbjct  8    EMNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDV  67

Query  502  ARM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            AR+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+
Sbjct  68   ARIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQ  108



>ref|XP_004292261.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458059.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
Length=987

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  V + K    EKPIPGCLGRMVNLFD++ GV+ N+LLTDKPH DG SLSRSQSDV  M
Sbjct  1    MKGVHSSKAHSAEKPIPGCLGRMVNLFDMSTGVSRNKLLTDKPHHDGSSLSRSQSDVVTM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
              SP  DQIEDK IVSELRR++S  KANGTP+KML+
Sbjct  61   LGSPFGDQIEDKVIVSELRRSSSNNKANGTPIKMLL  96



>gb|KDO65805.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1000

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +1

Query  334  MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
            M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDVA
Sbjct  1    MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDVA  60

Query  505  RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+
Sbjct  61   RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQ  100



>gb|KDO65804.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1002

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +1

Query  334  MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
            M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTDKPHRDG+ LSRSQSDVA
Sbjct  1    MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDKPHRDGAMLSRSQSDVA  60

Query  505  RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+
Sbjct  61   RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQ  100



>ref|XP_006443684.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
 ref|XP_006480168.1| PREDICTED: uncharacterized protein LOC102618918 [Citrus sinensis]
 gb|ESR56924.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
Length=991

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 5/100 (5%)
 Frame = +1

Query  334  MYAVQNGK--NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVA  504
            M  +Q+ K  N  ++K + GCLGRMVNLFDL+ G+ GNRLLTD+PHRDG+ LSRSQSDVA
Sbjct  1    MNGIQSTKAQNINVDKHVVGCLGRMVNLFDLSTGIPGNRLLTDEPHRDGAMLSRSQSDVA  60

Query  505  RM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            R+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+
Sbjct  61   RIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQ  100



>gb|KHG22481.1| Viral inhibitor of RIP activation [Gossypium arboreum]
Length=1004

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 5/99 (5%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR  507
            EM  +Q+ K + +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDG SLSRSQSDV R
Sbjct  11   EMNGIQHKKGQNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVR  69

Query  508  M-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            M SP+  DQIEDK IVSELR  ++K K N TPMKML+A+
Sbjct  70   MPSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQ  107



>gb|KJB10997.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=999

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 78/99 (79%), Gaps = 5/99 (5%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR  507
            EM  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDG SLSRSQSDV R
Sbjct  11   EMNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVR  69

Query  508  M-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            M SP+  DQIEDK IVSELR  ++K K N TPMKML+A+
Sbjct  70   MPSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQ  107



>ref|XP_011080145.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
 ref|XP_011080146.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
Length=957

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE  522
            QN KNR  +K  PGCLGRMVNLF+LN GV+ NRLL DKPHRDGS LSRS+SDV+RMS S 
Sbjct  6    QNDKNRNFKKTYPGCLGRMVNLFELNVGVSTNRLLADKPHRDGSLLSRSRSDVSRMSSSG  65

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQIE+K    E + +    K+NGTPMKMLIA+
Sbjct  66   DQIEEKVTAPEFKSSFPNRKSNGTPMKMLIAQ  97



>ref|XP_011024528.1| PREDICTED: uncharacterized protein LOC105125670 isoform X2 [Populus 
euphratica]
Length=991

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 73/98 (74%), Gaps = 8/98 (8%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K + +EKP PGCLGRMVNLFDLN GVAGNRLLTDKPH DG S+SRSQSDVARM
Sbjct  1    MNGMQYRKGQSIEKPFPGCLGRMVNLFDLNNGVAGNRLLTDKPHYDGSSISRSQSDVARM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
               P  DQ     IVSELRR++   KAN TPMK LIA+
Sbjct  61   LSVPFGDQ-----IVSELRRSSLNKKANATPMKTLIAQ  93



>gb|KJB10994.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=701

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 5/98 (5%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDG SLSRSQSDV RM
Sbjct  1    MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+  DQIEDK IVSELR  ++K K N TPMKML+A+
Sbjct  60   PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQ  96



>ref|XP_010684822.1| PREDICTED: uncharacterized protein LOC104899346 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=993

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 83/100 (83%), Gaps = 5/100 (5%)
 Frame = +1

Query  328  SEMYAVQ-NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDV  501
            S+M  +  NGK RG EKP+PGCLGRMVNLFDL+  ++GNRLL+DKP+ DG SLSRS+SDV
Sbjct  11   SQMNGIHLNGKTRGSEKPVPGCLGRMVNLFDLS--ISGNRLLSDKPYNDGSSLSRSRSDV  68

Query  502  ARMSP-SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            +RMS  + D++EDK +VSELRR++S  K NGTP+KML+A+
Sbjct  69   SRMSSIAVDEMEDKVMVSELRRSSSNRKPNGTPVKMLMAQ  108



>ref|XP_010684824.1| PREDICTED: uncharacterized protein LOC104899346 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=981

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 4/92 (4%)
 Frame = +1

Query  349  NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARMSP-SE  522
            NGK RG EKP+PGCLGRMVNLFDL+  ++GNRLL+DKP+ DG SLSRS+SDV+RMS  + 
Sbjct  7    NGKTRGSEKPVPGCLGRMVNLFDLS--ISGNRLLSDKPYNDGSSLSRSRSDVSRMSSIAV  64

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            D++EDK +VSELRR++S  K NGTP+KML+A+
Sbjct  65   DEMEDKVMVSELRRSSSNRKPNGTPVKMLMAQ  96



>ref|XP_009371010.1| PREDICTED: uncharacterized protein LOC103960277 isoform X2 [Pyrus 
x bretschneideri]
Length=985

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q GK    +KP PGCLGRMVNLFDL  GV+GN+LLTDKPHRDG SLSRSQSDVA M
Sbjct  1    MNGMQIGKALNADKPSPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511  ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
                P  D I+DK IVSELRR++S  KA+GTP+K+L+
Sbjct  61   LGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILL  97



>ref|XP_007162644.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
 gb|ESW34638.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
Length=971

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M   QN K   +EKP PGCLGRMVNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR+
Sbjct  1    MNGAQNRKVHNIEKPFPGCLGRMVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+  DQIEDK IVS+  R  S  K NGTP+KMLI +
Sbjct  61   TSPTLGDQIEDKLIVSDSMRALSNKKINGTPIKMLIDQ  98



>emb|CDP03827.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LS-RSQSDVAR  507
            M     GKN  +E P PGCLG+MVNLFD++GG+AGNRLLTDKPHRDGS LS RSQSDV+R
Sbjct  1    MNGFHKGKNHNVEGPFPGCLGKMVNLFDMSGGMAGNRLLTDKPHRDGSPLSRRSQSDVSR  60

Query  508  MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            M   ED+IE+K ++SE  R     K++GTPMKMLIA+
Sbjct  61   MGQFEDRIEEK-VMSEFSRTCPNRKSSGTPMKMLIAQ  96



>ref|XP_008372424.1| PREDICTED: uncharacterized protein LOC103435787 isoform X2 [Malus 
domestica]
Length=985

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q GK    +KP PGCLGRMVNLFDL  GV GN+LLTDKPHRDG SLSRSQSDVA M
Sbjct  1    MNGMQIGKAHNADKPSPGCLGRMVNLFDLGNGVPGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511  ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
                P  D I+DK IVSELRR++S  KA+GTP+K+L+
Sbjct  61   LGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILL  97



>gb|KJB10995.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
 gb|KJB10998.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=988

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 5/98 (5%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDG SLSRSQSDV RM
Sbjct  1    MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+  DQIEDK IVSELR  ++K K N TPMKML+A+
Sbjct  60   PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQ  96



>gb|KJB10996.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=962

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 5/98 (5%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q+ K   +EK  PGCLGRMVNLFDLN GV GNRLLTDKPHRDG SLSRSQSDV RM
Sbjct  1    MNGIQHKKGHNIEK-FPGCLGRMVNLFDLNSGVPGNRLLTDKPHRDGSSLSRSQSDVVRM  59

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+  DQIEDK IVSELR  ++K K N TPMKML+A+
Sbjct  60   PSPTFGDQIEDKVIVSELRTFSNK-KGNVTPMKMLLAQ  96



>ref|XP_010652446.1| PREDICTED: uncharacterized protein LOC100241277 isoform X2 [Vitis 
vinifera]
Length=986

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 8/97 (8%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  + N K RG EKP PGCLGRMVNLFDLN G+ GNR+LTD+PH+DGS LSRS+SDVAR+
Sbjct  1    MSGIHNSKTRGFEKPFPGCLGRMVNLFDLNAGMPGNRMLTDRPHQDGSPLSRSRSDVARV  60

Query  511  -SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             SP+ DQ     +VSEL R +++ K+NGTP+KMLIA+
Sbjct  61   SSPTGDQ-----MVSELSRTSNR-KSNGTPVKMLIAQ  91



>ref|XP_006576977.1| PREDICTED: uncharacterized protein LOC100793360 [Glycine max]
Length=979

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
            M  VQN +   +EKP PGCLGR+VNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1    MNGVQNRRVHNVEKPFPGCLGRVVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508  MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI +
Sbjct  61   MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLIDQ  97



>gb|KHN09408.1| hypothetical protein glysoja_016507 [Glycine soja]
Length=979

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 4/96 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
            M  VQN +   +EKP PGCLGR+VNLFDL GGV GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1    MNGVQNRRVHNVEKPFPGCLGRVVNLFDLTGGVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508  MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI
Sbjct  61   MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLI  95



>ref|XP_006604525.1| PREDICTED: uncharacterized protein LOC100816611 isoform X1 [Glycine 
max]
 ref|XP_006604526.1| PREDICTED: uncharacterized protein LOC100816611 isoform X2 [Glycine 
max]
 gb|KHN02438.1| hypothetical protein glysoja_002462 [Glycine soja]
Length=982

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 4/98 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
            M  VQN +   +EKP PGCLGRMVNLFDL G V GN+LLTD+PHRD  SLSRSQSDVAR 
Sbjct  1    MNGVQNRRVHNVEKPFPGCLGRMVNLFDLTGDVNGNKLLTDRPHRDASSLSRSQSDVARI  60

Query  508  MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            MSP+  DQIEDK IVS+  R  +K K NGTP+KMLI +
Sbjct  61   MSPTLGDQIEDKLIVSDSMRATNK-KINGTPIKMLIDQ  97



>ref|XP_008382666.1| PREDICTED: uncharacterized protein LOC103445438 [Malus domestica]
Length=983

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q GK    +K  PGCLGRMVNLFDL  GV+GN+LLTDKPHRDG SLSRSQSDVA M
Sbjct  1    MNEMQIGKAHDADKAFPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDGSSLSRSQSDVATM  60

Query  511  --SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
               PS  D ++DK IVSELRR++S  KA+GTP+K+L+
Sbjct  61   LGPPSFGDHVDDKPIVSELRRSSSNNKASGTPIKILL  97



>ref|XP_009371001.1| PREDICTED: uncharacterized protein LOC103960277 isoform X1 [Pyrus 
x bretschneideri]
Length=988

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD----GSLSRSQSDV  501
            M  +Q GK    +KP PGCLGRMVNLFDL  GV+GN+LLTDKPHRD     SLSRSQSDV
Sbjct  1    MNGMQIGKALNADKPSPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDVLVGSSLSRSQSDV  60

Query  502  ARM---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            A M    P  D I+DK IVSELRR++S  KA+GTP+K+L+
Sbjct  61   ATMLGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILL  100



>ref|XP_008372423.1| PREDICTED: uncharacterized protein LOC103435787 isoform X1 [Malus 
domestica]
Length=988

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 7/100 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD----GSLSRSQSDV  501
            M  +Q GK    +KP PGCLGRMVNLFDL  GV GN+LLTDKPHRD     SLSRSQSDV
Sbjct  1    MNGMQIGKAHNADKPSPGCLGRMVNLFDLGNGVPGNKLLTDKPHRDVLVGSSLSRSQSDV  60

Query  502  ARM---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            A M    P  D I+DK IVSELRR++S  KA+GTP+K+L+
Sbjct  61   ATMLGPPPFGDHIDDKVIVSELRRSSSNNKASGTPIKILL  100



>ref|XP_002521158.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41309.1| conserved hypothetical protein [Ricinus communis]
Length=990

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q+ + + +EK  PGCLGRMVNLFDL+ G   N+LLTDKPHRD  SLSRS+SDVARM
Sbjct  1    MNGIQSTRAQKIEKQFPGCLGRMVNLFDLSNGATENKLLTDKPHRDASSLSRSRSDVARM  60

Query  511  --SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
              +P  DQIEDK IVSELRR++S  K+NGTPMK LIA
Sbjct  61   MNAPFGDQIEDKMIVSELRRSSSSKKSNGTPMKTLIA  97



>ref|XP_008235543.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
 ref|XP_008235544.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
Length=981

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K    +KP PGCLGRMVNLFDL+ GV+GN+LLT+KPH DG S+SRSQSDVA M
Sbjct  1    MNGMQISKAHNTDKPFPGCLGRMVNLFDLSTGVSGNKLLTEKPHHDGSSVSRSQSDVATM  60

Query  511  ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
               SP  D I+DK IV ELRR++S  K  GTP+KML+
Sbjct  61   LGPSPFGDHIDDKLIVPELRRSSSNNKVCGTPIKMLL  97



>ref|XP_007199004.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
 gb|EMJ00203.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
Length=981

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K    +KP PGCLGRMVNLFDL+ GV+GN+LLT+KPH DG SLSRSQSDVA M
Sbjct  1    MNGMQISKAHNTDKPFPGCLGRMVNLFDLSTGVSGNKLLTEKPHHDGSSLSRSQSDVATM  60

Query  511  ---SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
                P  D I+DK IV ELRR++S  K  GTP+KML+ +
Sbjct  61   LGPPPFGDHIDDKLIVPELRRSSSNNKVCGTPIKMLLDQ  99



>gb|KJB26066.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=716

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-  507
            EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR 
Sbjct  10   EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVART  68

Query  508  MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            + P+      QIEDK I+SELRR  S  K N TP+KML+A+
Sbjct  69   LRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQ  109



>gb|KJB26068.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=998

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 73/106 (69%), Gaps = 6/106 (6%)
 Frame = +1

Query  316  LLRHSEMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQS  495
            +L   EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQS
Sbjct  1    MLTGVEMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQS  59

Query  496  DVAR-MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DVAR + P+      QIEDK I+SELRR  S  K N TP+KML+A+
Sbjct  60   DVARTLRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQ  105



>gb|KJB26065.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=1002

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-  507
            EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR 
Sbjct  10   EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVART  68

Query  508  MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            + P+      QIEDK I+SELRR  S  K N TP+KML+A+
Sbjct  69   LRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQ  109



>gb|KJB26067.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=992

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR-M  510
            M   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLLTDK H   SLSRSQSDVAR +
Sbjct  1    MNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVPGNRLLTDKQHDGSSLSRSQSDVARTL  59

Query  511  SPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             P+      QIEDK I+SELRR  S  K N TP+KML+A+
Sbjct  60   RPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQ  99



>ref|XP_010243642.1| PREDICTED: uncharacterized protein LOC104587645 isoform X2 [Nelumbo 
nucifera]
Length=996

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 5/103 (5%)
 Frame = +1

Query  319  LRHSEMY--AVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRS  489
            +R +EM+   +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RS
Sbjct  1    MRSTEMHMNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRS  60

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QS+  +  P  DQ+++K I  ELRR  S  K++GTPMKMLIA+
Sbjct  61   QSE--KSDPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQ  101



>ref|XP_010243641.1| PREDICTED: uncharacterized protein LOC104587645 isoform X1 [Nelumbo 
nucifera]
Length=997

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 5/103 (5%)
 Frame = +1

Query  319  LRHSEMY--AVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRS  489
            +R +EM+   +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RS
Sbjct  1    MRSTEMHMNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRS  60

Query  490  QSDVARMSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            QS+  +  P  DQ+++K I  ELRR  S  K++GTPMKMLIA+
Sbjct  61   QSE--KSDPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQ  101



>ref|XP_004493852.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004493853.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=984

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLN-GGVAGNRLLTDKPHRDG----SLSRSQSD  498
            M  VQN +    +KP PGCLGRMVNLFDL    V GN+LLTDKPHRD     SLSRSQSD
Sbjct  1    MNDVQNRRVHNDDKPFPGCLGRMVNLFDLTVVTVNGNKLLTDKPHRDHHHAPSLSRSQSD  60

Query  499  VARM-SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            V+R+ SPS  D+IEDK IVS+  R  S  K NGTP+KMLI +
Sbjct  61   VSRIASPSFGDRIEDKPIVSDSMRAFSNKKVNGTPIKMLIDQ  102



>gb|EYU46370.1| hypothetical protein MIMGU_mgv1a000965mg [Erythranthe guttata]
Length=929

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARMSPSE  522
             NGKN  LEK   GCLGRMVNLF+LN  +  NRLL DKPH DG SLSRS+SDV+RMS S 
Sbjct  6    HNGKNSNLEKKYAGCLGRMVNLFELNTEMPANRLLQDKPHADGSSLSRSRSDVSRMSLSG  65

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            D  E+K  VSE + ++S  K+NGTPMKMLIA+
Sbjct  66   DSAEEKVTVSEFKSSSSNRKSNGTPMKMLIAQ  97



>ref|XP_010243643.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010243644.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
Length=992

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 3/96 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  +Q  +   L+KP PGC+GRMVN  DL+ GVAGN+LLT+KPHRD S L RSQS+  + 
Sbjct  3    MNGMQQRRAHDLDKPFPGCMGRMVNFLDLSTGVAGNKLLTEKPHRDCSFLPRSQSE--KS  60

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             P  DQ+++K I  ELRR  S  K++GTPMKMLIA+
Sbjct  61   DPIRDQMDNKPIGYELRRAYSSKKSSGTPMKMLIAQ  96



>emb|CDY35217.1| BnaA01g08140D [Brassica napus]
Length=837

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1    MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E   I+S+LRR  S  KA+GTPMK LIA
Sbjct  61   PSPSYKGHSEPDLIMSDLRRTASS-KASGTPMKKLIA  96



>ref|XP_009129280.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
 ref|XP_009129285.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
Length=837

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1    MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E   I+S+LRR  S  KA+GTPMK LIA
Sbjct  61   PSPSYKGHSEPDLIMSDLRRTASS-KASGTPMKKLIA  96



>ref|XP_006284953.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
 gb|EOA17851.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
Length=925

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1    MNELRGRKGQNIESPVPGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGYSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E + I+ +LRR  S  K NGTPMK LIA
Sbjct  61   PSPSYKGHSEAELIMCDLRRTASS-KVNGTPMKKLIA  96



>ref|XP_010540945.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540947.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540948.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540949.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540950.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540951.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540952.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
Length=863

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 7/87 (8%)
 Frame = +1

Query  367  LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHR-DGSLSRSQSDVARM--SPSEDQIED  537
            +E P+PGCLGRMVNLFDL    +GN+LLTDKPHR   SLSRSQSDVA+M   PS D  ED
Sbjct  12   MENPVPGCLGRMVNLFDLGTAGSGNKLLTDKPHRYASSLSRSQSDVAQMPSPPSGDHTED  71

Query  538  KEIVSELRRNNSKMKANGTPMKMLIAE  618
            + I+S LRR+ S    NGTPMK LIA+
Sbjct  72   ELIMSNLRRSAS----NGTPMKKLIAQ  94



>ref|XP_010540953.1| PREDICTED: uncharacterized protein LOC104814547 isoform X2 [Tarenaya 
hassleriana]
Length=834

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 7/87 (8%)
 Frame = +1

Query  367  LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHR-DGSLSRSQSDVARM--SPSEDQIED  537
            +E P+PGCLGRMVNLFDL    +GN+LLTDKPHR   SLSRSQSDVA+M   PS D  ED
Sbjct  12   MENPVPGCLGRMVNLFDLGTAGSGNKLLTDKPHRYASSLSRSQSDVAQMPSPPSGDHTED  71

Query  538  KEIVSELRRNNSKMKANGTPMKMLIAE  618
            + I+S LRR+ S    NGTPMK LIA+
Sbjct  72   ELIMSNLRRSAS----NGTPMKKLIAQ  94



>ref|XP_006412913.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
 gb|ESQ54366.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
Length=913

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E PIPGCLGRMVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1    MNEIRGRKVQKVESPIPGCLGRMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E + I+S+LRR+ S    +GTPMK LIA
Sbjct  61   PSPSYKGHSEAELIMSDLRRSASS-NVSGTPMKKLIA  96



>ref|XP_003625464.1| hypothetical protein MTR_7g099410 [Medicago truncatula]
 gb|AES81682.1| DUF3741 family protein [Medicago truncatula]
Length=982

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 5/95 (5%)
 Frame = +1

Query  349  NGKNRGLEKPIPGCLGRMVNLFDLN-GGVAGNRLLTDKPHRD--GSLSRSQSDVARM-SP  516
            N +    +KP PGCLGRMVNLFDL    V  N+LLTDKPHRD   SLSRSQSDV+R  SP
Sbjct  7    NTRVHADDKPFPGCLGRMVNLFDLTPSTVNANKLLTDKPHRDHHASLSRSQSDVSRTASP  66

Query  517  S-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            S  D+IEDK IVS+  R +S  K NGTP+KML+ +
Sbjct  67   SFGDRIEDKPIVSDSMRASSNKKVNGTPIKMLMDQ  101



>emb|CDY06873.1| BnaC01g09720D [Brassica napus]
Length=845

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLGRMVNLFDL   V GN++LTDKPHRDG SLSRS+SDV+RM
Sbjct  1    MNELRGRKVQKIESPVPGCLGRMVNLFDLGTAVNGNKMLTDKPHRDGSSLSRSRSDVSRM  60

Query  511  S-PS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
              PS +   E + I+S+LRR  S  KA+GTPMK LIA
Sbjct  61   PIPSYKGHSEPELIMSDLRRTASS-KASGTPMKKLIA  96



>ref|XP_010447916.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
 ref|XP_010447917.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
Length=919

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E PIPGCLG+MVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1    MNELRGRKVQNIESPIPGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E + I+ +LRR+ S  K +GTPMK LIA
Sbjct  61   PSPSYKGHSEAELIMCDLRRSASN-KVSGTPMKKLIA  96



>ref|XP_008447347.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
 ref|XP_008447348.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
Length=971

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 5/99 (5%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  +Q  K    EKP PGCLGRMVNLFDL+ G++ N+LLTD PHR+G +LSR+Q+DVARM
Sbjct  1    MNGIQRRKVGNDEKPFPGCLGRMVNLFDLSTGISRNKLLTDAPHREGPTLSRNQADVARM  60

Query  511  -SPSEDQIED--KEIVSELRRNNSKMKANGTPMKMLIAE  618
             + S +Q ED   + V EL+R ++K +A+GTP+KMLI +
Sbjct  61   FNHSTNQSEDNLSQTVPELQRASNK-RASGTPVKMLIDQ  98



>ref|XP_010433164.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
 ref|XP_010433165.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
Length=915

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E PI GCLG+MVNLFDL   V GN+LLTDKPHRDG SLSRS+SDV RM
Sbjct  1    MNELRGRKVQNIESPISGCLGKMVNLFDLGTAVNGNKLLTDKPHRDGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E + I+ +LRR++S  K +GTPMK LIA
Sbjct  61   PSPSYKGHSEAELIMCDLRRSDSN-KVSGTPMKKLIA  96



>gb|KGN58324.1| hypothetical protein Csa_3G622430 [Cucumis sativus]
Length=963

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  +Q  K    EKP PGCLGRMVNLFDL+ GV+ N+LLTD PHR+G  LSR+Q+DVARM
Sbjct  1    MNGIQRRKVGNNEKPFPGCLGRMVNLFDLSTGVSRNKLLTDAPHREGPILSRNQADVARM  60

Query  511  -SPSEDQIED--KEIVSELRRNNSKMKANGTPMKMLIAE  618
             + S +Q ED   + V ELRR ++K +A+GTP+KMLI +
Sbjct  61   FNHSINQSEDNLSQTVPELRRASNK-RASGTPVKMLIDQ  98



>ref|XP_010438384.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
 ref|XP_010438385.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
Length=916

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 5/92 (5%)
 Frame = +1

Query  352  GKN-RGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM-SPS-  519
            G+N + +E PIPGCLG+MVNLFDL   V GN+LLTD PHRDG SLSRS+SDV RM SPS 
Sbjct  6    GRNVQNIESPIPGCLGKMVNLFDLGTAVTGNKLLTDIPHRDGSSLSRSRSDVTRMPSPSY  65

Query  520  EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
            +   E + I+ +LRR+ S  K +GTPMK LIA
Sbjct  66   KGHSEAELIMCDLRRSASN-KVSGTPMKKLIA  96



>ref|XP_010038329.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038330.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038331.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038332.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038333.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038334.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 gb|KCW50152.1| hypothetical protein EUGRSUZ_K03587 [Eucalyptus grandis]
Length=974

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            MY+ QN K    EK  PGCLGR+VNLFDL+ GV  NRLLTDKPH  G S+SRS SD+A M
Sbjct  1    MYSSQNRKVHNFEKQFPGCLGRVVNLFDLSAGVTSNRLLTDKPHPYGSSISRSLSDMATM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             +P+  DQ E+K IV   RR +S   + GTPMKMLIAE
Sbjct  61   LAPTFGDQTEEKGIVLNSRRISSSRNSMGTPMKMLIAE  98



>ref|XP_002869475.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45734.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  V+  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH  G SLSRS+SDV RM
Sbjct  1    MNEVRGRKAQKIESPVPGCLGKMVNLFDLGTAVNGNKLLTDKPHLYGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
             SPS +   E + I+S+LRR+ S  K +GTPMK LIA
Sbjct  61   PSPSYKGHSEAELIMSDLRRSASS-KVSGTPMKKLIA  96



>ref|XP_010263991.1| PREDICTED: uncharacterized protein LOC104602116 isoform X3 [Nelumbo 
nucifera]
Length=993

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  3    MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  60

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+
Sbjct  61   DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQ  96



>ref|XP_010263989.1| PREDICTED: uncharacterized protein LOC104602116 isoform X1 [Nelumbo 
nucifera]
Length=1017

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  27   MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  84

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+
Sbjct  85   DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQ  120



>ref|XP_010263990.1| PREDICTED: uncharacterized protein LOC104602116 isoform X2 [Nelumbo 
nucifera]
Length=1013

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M  +QN + R L+KP PGC+GRMVN FDL+ G+ GN+LLT+K HRDG  L RS+S+  + 
Sbjct  23   MNGMQNRRARDLDKPFPGCMGRMVNFFDLSAGIPGNKLLTEKAHRDGYFLPRSRSE--KS  80

Query  511  SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             P  DQ+ED  I  EL R +S  K+ GTPMKMLIA+
Sbjct  81   DPIRDQMEDNLIGYELSRTSSSKKSRGTPMKMLIAQ  116



>gb|KHG04276.1| Methyl-coenzyme M reductase II subunit gamma [Gossypium arboreum]
Length=1005

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 9/102 (9%)
 Frame = +1

Query  331  EMYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR  507
            EM   ++ + + +EK  PGCLGRMVNLFDLN  V GNRLL  K  +DG SLSRSQSDVAR
Sbjct  10   EMNGFESRRGQNIEK-FPGCLGRMVNLFDLNTNVTGNRLL--KIKQDGSSLSRSQSDVAR  66

Query  508  -MSPS----EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             + P+      QIEDK I+SELRR  S  K N TP+KML+A+
Sbjct  67   TLRPTFGDQNHQIEDKVIISELRRAFSNKKGNKTPIKMLMAQ  108



>ref|NP_567819.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974633.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93687.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44897.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85538.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
 gb|AEE85539.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
Length=924

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH DG SLSRS+SDV RM
Sbjct  1    MNELRGRKAQKIESPVPGCLGKMVNLFDLGIAVNGNKLLTDKPHLDGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
              PS +   E + I+S+LRR+ S  K +GTPMK LIA
Sbjct  61   PGPSYKGHSEAELIMSDLRRSASS-KLSGTPMKKLIA  96



>ref|XP_011083092.1| PREDICTED: uncharacterized protein LOC105165697 [Sesamum indicum]
Length=958

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS--LSRSQSDVARMSPS  519
            +NGKN   +K  PGCLGRMVNLF+LN GV  N+LLTDKP  DGS          +  SPS
Sbjct  6    RNGKNCNFDKTYPGCLGRMVNLFELNIGVPANKLLTDKPRSDGSPVSRSRSDVSSLSSPS  65

Query  520  EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             DQIEDK IVSE R  +S  K+N TPMKMLIA+
Sbjct  66   VDQIEDKVIVSEFRNTSSNRKSNVTPMKMLIAQ  98



>dbj|BAH19995.1| AT4G28760 [Arabidopsis thaliana]
Length=924

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM  510
            M  ++  K + +E P+PGCLG+MVNLFDL   V GN+LLTDKPH DG SLSRS+SDV RM
Sbjct  1    MNELRGRKAQKIESPVPGCLGKMVNLFDLGIAVNGNKLLTDKPHLDGSSLSRSRSDVTRM  60

Query  511  -SPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
              PS +   E + I+S+LRR+ S  K +GTPMK LIA
Sbjct  61   PGPSYKGHSEAELIMSDLRRSASS-KLSGTPMKKLIA  96



>ref|XP_010069683.1| PREDICTED: uncharacterized protein LOC104456566 [Eucalyptus grandis]
 gb|KCW58104.1| hypothetical protein EUGRSUZ_H00827 [Eucalyptus grandis]
Length=971

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-  507
            M   +N K +G ++  PGCLGRMVNLFDL+ G A  +LLT KPH D  SL+RSQ DV R 
Sbjct  1    MDRARNNKAQGTKEQFPGCLGRMVNLFDLSTGAASKKLLTYKPHYDDPSLTRSQPDVPRI  60

Query  508  MSPS-EDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            +SPS  + IEDK I S  RR++   ++N  PMKMLIA+
Sbjct  61   LSPSCRNDIEDKMITSNSRRSSPNRQSNSMPMKMLIAQ  98



>ref|XP_010556872.1| PREDICTED: uncharacterized protein LOC104826058 [Tarenaya hassleriana]
Length=937

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 5/90 (6%)
 Frame = +1

Query  358  NRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDV-ARMSPS-EDQ  528
            ++G+ + IPGCLGRMVNLFDL     GN++LTDKPH DG SLSRS+S V +R SP   D 
Sbjct  9    DQGMGRQIPGCLGRMVNLFDLAANGGGNKMLTDKPHYDGSSLSRSRSAVPSRPSPPMGDY  68

Query  529  IEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            IED+ +VSE+R  ++  + NGTPMK LIA+
Sbjct  69   IEDEVVVSEIR--STANRVNGTPMKKLIAQ  96



>ref|XP_010940679.1| PREDICTED: uncharacterized protein LOC105059154 isoform X2 [Elaeis 
guineensis]
Length=954

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  343  VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--S  513
            + N + +  + P  GC+GRM+N+FDL+ GVAG +LLTDK HRDGS +S++QSD  +    
Sbjct  1    MNNRRGQNFQNPSLGCMGRMINIFDLSTGVAGTKLLTDKAHRDGSPISKNQSDALKKPRD  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            PS   +EDK+I  E R++ S   + GTPMKMLI
Sbjct  61   PSLVPVEDKQITRESRKSASNKNSGGTPMKMLI  93



>ref|XP_010940678.1| PREDICTED: uncharacterized protein LOC105059154 isoform X1 [Elaeis 
guineensis]
Length=955

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +1

Query  343  VQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--S  513
            + N + +  + P  GC+GRM+N+FDL+ GVAG +LLTDK HRDGS +S++QSD  +    
Sbjct  1    MNNRRGQNFQNPSLGCMGRMINIFDLSTGVAGTKLLTDKAHRDGSPISKNQSDALKKPRD  60

Query  514  PSEDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            PS   +EDK+I  E R++ S   + GTPMKMLI
Sbjct  61   PSLVPVEDKQITRESRKSASNKNSGGTPMKMLI  93



>ref|XP_010526471.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526472.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526473.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526474.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
Length=882

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 4/90 (4%)
 Frame = +1

Query  355  KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARM-SPS-ED  525
            K + +E P+PGCLG MVNLF L+    GN+ LTDKPH D  SLSRS+SDV +M SPS  D
Sbjct  7    KVQNMESPVPGCLGSMVNLFVLDATARGNKFLTDKPHNDASSLSRSRSDVVQMLSPSFGD  66

Query  526  QIEDKEIVSELRRNNSKMKANGTPMKMLIA  615
              E + ++S LRR+ S  + NGTPMK LIA
Sbjct  67   HTEAELVLSNLRRSASD-EVNGTPMKKLIA  95



>ref|XP_008809662.1| PREDICTED: uncharacterized protein LOC103721293 isoform X2 [Phoenix 
dactylifera]
Length=1003

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
            M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  18   MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  77

Query  508  -MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             + P+   ++ K+I S+LR+++S  K+ GT +KMLIA+
Sbjct  78   ALHPAGLYVDGKQIASDLRKSSSIKKSGGTLVKMLIAQ  115



>ref|XP_008809664.1| PREDICTED: uncharacterized protein LOC103721293 isoform X4 [Phoenix 
dactylifera]
Length=986

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 70/98 (71%), Gaps = 3/98 (3%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
            M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  1    MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  60

Query  508  -MSPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             + P+   ++ K+I S+LR+++S  K+ GT +KMLIA+
Sbjct  61   ALHPAGLYVDGKQIASDLRKSSSIKKSGGTLVKMLIAQ  98



>ref|XP_004139729.1| PREDICTED: uncharacterized protein LOC101207165 [Cucumis sativus]
 ref|XP_004154490.1| PREDICTED: uncharacterized protein LOC101227256 [Cucumis sativus]
 gb|KGN44553.1| hypothetical protein Csa_7G329380 [Cucumis sativus]
Length=960

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 64/97 (66%), Gaps = 11/97 (11%)
 Frame = +1

Query  334  MYAVQNGKNRG-LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
            M  +Q  K R   EKP PGCLGRMVNLFDL+ GV+ N+LLTDKPHRD S L RS SD A 
Sbjct  1    MKEIQRRKVRSNTEKPFPGCLGRMVNLFDLSAGVSRNKLLTDKPHRDVSLLPRSHSDAAI  60

Query  508  M-SPSED-QIEDKEIVSELRRNNSKMKANGTPMKMLI  612
            + SPS D Q+ED          +S  +AN TPMKMLI
Sbjct  61   ISSPSHDSQLEDG-------LEHSIGQANRTPMKMLI  90



>ref|XP_008461986.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
 ref|XP_008461987.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
Length=970

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 10/84 (12%)
 Frame = +1

Query  370  EKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPSED-QIEDK  540
            EKP PGCLGRMVNLFDL+ GV+ N+LLTDKPHRD S L RS SD A + SPS D QIED 
Sbjct  14   EKPFPGCLGRMVNLFDLSAGVSRNKLLTDKPHRDVSLLRRSHSDAAIISSPSHDSQIEDG  73

Query  541  EIVSELRRNNSKMKANGTPMKMLI  612
                     +S  +AN TPMKMLI
Sbjct  74   -------LEHSIGQANRTPMKMLI  90



>ref|XP_008789491.1| PREDICTED: uncharacterized protein LOC103706972 isoform X3 [Phoenix 
dactylifera]
Length=944

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +1

Query  349  NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--SPS  519
            N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    P 
Sbjct  3    NRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRDPI  62

Query  520  EDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
               +EDK+I  ELR++ S   + GTPM+MLI
Sbjct  63   LFPVEDKQITHELRKSASNKNSGGTPMRMLI  93



>ref|XP_008789490.1| PREDICTED: uncharacterized protein LOC103706972 isoform X2 [Phoenix 
dactylifera]
Length=962

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +1

Query  349  NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--SPS  519
            N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    P 
Sbjct  3    NRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRDPI  62

Query  520  EDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
               +EDK+I  ELR++ S   + GTPM+MLI
Sbjct  63   LFPVEDKQITHELRKSASNKNSGGTPMRMLI  93



>ref|XP_008789489.1| PREDICTED: uncharacterized protein LOC103706972 isoform X1 [Phoenix 
dactylifera]
Length=963

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +1

Query  349  NGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM--SPS  519
            N + + L+KP  GC+GRM+N+ DL+ G+AG +LL DK HRDG  +S++QSDV +    P 
Sbjct  3    NRRGQTLQKPSLGCMGRMINILDLSTGMAGTKLLADKAHRDGYPISKNQSDVVKKPRDPI  62

Query  520  EDQIEDKEIVSELRRNNSKMKANGTPMKMLI  612
               +EDK+I  ELR++ S   + GTPM+MLI
Sbjct  63   LFPVEDKQITHELRKSASNKNSGGTPMRMLI  93



>ref|XP_008809661.1| PREDICTED: uncharacterized protein LOC103721293 isoform X1 [Phoenix 
dactylifera]
Length=1007

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 70/102 (69%), Gaps = 7/102 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
            M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  18   MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  77

Query  508  -MSPSEDQIEDK----EIVSELRRNNSKMKANGTPMKMLIAE  618
             + P+   ++ K    +I S+LR+++S  K+ GT +KMLIA+
Sbjct  78   ALHPAGLYVDGKQTSVQIASDLRKSSSIKKSGGTLVKMLIAQ  119



>ref|XP_008809663.1| PREDICTED: uncharacterized protein LOC103721293 isoform X3 [Phoenix 
dactylifera]
Length=990

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 70/102 (69%), Gaps = 7/102 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNG-GVAGNRLLTDKPHRDGS-LSRSQSDVAR  507
            M   Q  K + L+KP P C+GRM+N+FDL+  G+AG +LLTDK HRDGS + R+Q DV +
Sbjct  1    MSGFQQRKVQDLQKPFPSCMGRMINIFDLSSTGMAGTKLLTDKAHRDGSPVHRNQPDVKK  60

Query  508  -MSPSEDQIEDK----EIVSELRRNNSKMKANGTPMKMLIAE  618
             + P+   ++ K    +I S+LR+++S  K+ GT +KMLIA+
Sbjct  61   ALHPAGLYVDGKQTSVQIASDLRKSSSIKKSGGTLVKMLIAQ  102



>ref|XP_010918845.1| PREDICTED: uncharacterized protein LOC105043126 [Elaeis guineensis]
Length=993

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-  507
            M   Q    + L+KP PGC+GRM+N+FDLN  +AG +LLTD+ HR GS + R+Q DV + 
Sbjct  1    MSGFQKRNVQDLQKPFPGCMGRMINIFDLNMAMAGTKLLTDEAHRGGSPVRRNQPDVKKE  60

Query  508  -MSPSEDQIEDK----EIVSELRRNNSKMKANGTPMKMLIAE  618
             M P+   ++ K    +I S+L +++S  K+ GT +KMLIA+
Sbjct  61   AMDPAGRFVDGKQTSLQIASDLWKSSSIKKSGGTSVKMLIAQ  102



>ref|XP_006375643.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
 gb|ERP53440.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
Length=951

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  379  IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPS--EDQIEDKEIVS  552
             PGCLGRMVNLF L+ GVAGNRLL            SQSDVARM  +    + EDK IVS
Sbjct  10   FPGCLGRMVNLFYLSNGVAGNRLLKS--------VYSQSDVARMLSALFGGKTEDKMIVS  61

Query  553  ELRRNNSKMKANGTPMKMLIAE  618
            ELRR++S  KANGTP+K L A+
Sbjct  62   ELRRSSSNKKANGTPVKTLTAQ  83



>ref|XP_006854321.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
 gb|ERN15788.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
Length=1073

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 7/102 (7%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM  510
            M   Q  K    EK  PGC+GRMVNL DL+ G+  NR+LTDK   +GS L RS  DV   
Sbjct  1    MNEHQYQKQCNTEKRYPGCMGRMVNLLDLSSGLNVNRMLTDKAQFNGSALPRSHHDVPMK  60

Query  511  SP------SEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            +P      + + +  K I  ELRR+ S+ K NGTPMKMLIA+
Sbjct  61   TPPRHNAYTGEYVAQKPIDHELRRSFSEKKGNGTPMKMLIAQ  102



>ref|XP_009411376.1| PREDICTED: uncharacterized protein LOC103993144 [Musa acuminata 
subsp. malaccensis]
Length=932

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
            M+N+FD + GVAGN++LT++PHRDG  ++R++ D  +  +PS  + +DK+I ++L++N S
Sbjct  1    MINIFDFSAGVAGNKMLTERPHRDGFPVNRNKHDARKATTPSGTKADDKQIANDLKQNLS  60

Query  574  KMKANGTPMKMLIAE  618
              KA+GTPMKMLIA+
Sbjct  61   SKKASGTPMKMLIAQ  75



>ref|XP_008367440.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Malus domestica]
Length=421

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  334  MYAVQNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSD  498
            M  +Q  K     K  PGCLGRMVNLFDL  GV+GN+LLTDKPHRDG SL RSQSD
Sbjct  1    MNEMQISKAHDANKAFPGCLGRMVNLFDLGNGVSGNKLLTDKPHRDGSSLLRSQSD  56



>ref|XP_004954364.1| PREDICTED: uncharacterized protein LOC101771268 isoform X1 [Setaria 
italica]
 ref|XP_004954365.1| PREDICTED: uncharacterized protein LOC101771268 isoform X2 [Setaria 
italica]
 ref|XP_004954366.1| PREDICTED: uncharacterized protein LOC101771268 isoform X3 [Setaria 
italica]
 ref|XP_004954367.1| PREDICTED: uncharacterized protein LOC101771268 isoform X4 [Setaria 
italica]
 ref|XP_004954368.1| PREDICTED: uncharacterized protein LOC101771268 isoform X5 [Setaria 
italica]
Length=915

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 9/90 (10%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSED-QIEDKEIV  549
            P PGCLGRM+N+FDL+ GV   ++LTDK HRD S   R +S+  +M+ +   Q EDK+  
Sbjct  20   PFPGCLGRMINMFDLSNGVVATKMLTDKAHRDVSPAGRDRSNTFKMAINPPVQTEDKQRD  79

Query  550  SELRRNNSKMKAN-------GTPMKMLIAE  618
            S+ RRN+   ++N       GTP+KML+ +
Sbjct  80   SQARRNSPTKRSNSPTKRSGGTPVKMLMEQ  109



>ref|XP_003570390.1| PREDICTED: uncharacterized protein LOC100830114 [Brachypodium 
distachyon]
Length=931

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 59/91 (65%), Gaps = 10/91 (11%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
            P PGCLGR++N+FDL  GV   ++LT+K HRD S + + +S   +M+ ++   QIEDK+ 
Sbjct  20   PFPGCLGRVINMFDLGNGVVATKMLTEKAHRDVSPVGKDRSGTFKMASNQFPAQIEDKQR  79

Query  547  VSELRRNNSKMKANG-------TPMKMLIAE  618
             S+LRRN+   ++N        +P+KML+ +
Sbjct  80   DSQLRRNSPTKRSNSPTNRFGMSPVKMLMEQ  110



>ref|XP_006403169.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
 gb|ESQ44622.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
Length=845

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 50/86 (58%), Gaps = 14/86 (16%)
 Frame = +1

Query  364  GLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQIEDK  540
            G+ + IPGCLGRMVNLFD      G +LLTDKP+  DGS+ R+Q          DQIED 
Sbjct  14   GVGRQIPGCLGRMVNLFDFGTVGNGKKLLTDKPYFDDGSIKRNQF---------DQIEDN  64

Query  541  EIVSELRRNNSKMKANGTPMKMLIAE  618
              +    RN+     NGTPMK L+ E
Sbjct  65   VAL----RNDCTFGVNGTPMKKLLEE  86



>ref|XP_010441970.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
 ref|XP_010441971.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
Length=827

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 17/92 (18%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
            +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH R+GS+ R+Q          
Sbjct  7    RNVQGHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFRNGSIRRTQL---------  57

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQIEDK  V       +   ANGT MKMLI +
Sbjct  58   DQIEDKVDV-------TNGGANGTRMKMLIEQ  82



>ref|XP_010441972.1| PREDICTED: uncharacterized protein LOC104725068 isoform X2 [Camelina 
sativa]
Length=832

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 17/92 (18%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
            +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH R+GS+ R+Q          
Sbjct  7    RNVQGHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFRNGSIRRTQL---------  57

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQIEDK  V       +   ANGT MKMLI +
Sbjct  58   DQIEDKVDV-------TNGGANGTRMKMLIEQ  82



>ref|XP_006648110.1| PREDICTED: uncharacterized protein LOC102717592 [Oryza brachyantha]
Length=927

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 10/91 (11%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS--PSEDQIEDKEI  546
            P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + +  +M+  P   QIEDK+ 
Sbjct  20   PFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRGNAFKMAIGPFSSQIEDKKR  79

Query  547  VSELRRN------NSKMKANG-TPMKMLIAE  618
             S+ R+       +S  K +G TP+KMLI +
Sbjct  80   DSQTRKQSPTKRLSSPTKRSGETPVKMLIEQ  110



>ref|XP_008679171.1| PREDICTED: uncharacterized protein LOC103654120 isoform X2 [Zea 
mays]
Length=932

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 13/92 (14%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
            P PGCLGRM+++FDL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20   PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAIIPPA--QTEDKQ  77

Query  544  IVSELRRN------NSKMKANG-TPMKMLIAE  618
            I S+ RRN      NS  K +G  P+KM++ +
Sbjct  78   IDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQ  109



>ref|XP_008679173.1| PREDICTED: uncharacterized protein LOC103654120 isoform X4 [Zea 
mays]
 gb|AFW64006.1| hypothetical protein ZEAMMB73_603433 [Zea mays]
Length=926

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 13/92 (14%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
            P PGCLGRM+++FDL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20   PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAIIPPA--QTEDKQ  77

Query  544  IVSELRRN------NSKMKANG-TPMKMLIAE  618
            I S+ RRN      NS  K +G  P+KM++ +
Sbjct  78   IDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQ  109



>ref|XP_009382176.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382177.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382178.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382179.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382180.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382181.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382182.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382183.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382184.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382185.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382186.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382187.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=925

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARM-SPSEDQIEDKEIVSELRRNNS  573
            M+N+FDL+ G+AG ++L ++ HR+GS + R+  +V    +PS    ++K+I S L +N+S
Sbjct  1    MINIFDLSAGMAGTKMLPERDHRNGSPVHRNNPNVNEAATPSATNTDNKQITSVLYQNSS  60

Query  574  KMKANGTPMKMLIAE  618
            K K+ GTPMKMLIA+
Sbjct  61   KKKSGGTPMKMLIAQ  75



>ref|XP_009407163.1| PREDICTED: uncharacterized protein LOC103989929 [Musa acuminata 
subsp. malaccensis]
Length=943

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = +1

Query  367  LEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVAR--MSPSEDQIEDK  540
            L    PGC+GRM++LFDL+ G+A  +LLT++PH D  + R+ SDV +    P+  + E K
Sbjct  3    LADSFPGCMGRMMSLFDLSAGMAKTKLLTERPHSD--VVRNCSDVVKKPTYPAVAKTEGK  60

Query  541  EIVSELRRNNSKMKANGTPMKMLIAE  618
            ++V+E R ++   K+  TP+K LI++
Sbjct  61   QMVNEQRSSSPNKKSGRTPIKSLISQ  86



>ref|XP_009410914.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410921.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410929.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410937.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410945.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410954.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=938

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 7/87 (8%)
 Frame = +1

Query  379  IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL----SRSQSDVAR--MSPSEDQIEDK  540
            +PGC+GRM+ LFDL  G+   +LLT+KPH D +L     R+ SD  +  + P+  + +DK
Sbjct  7    LPGCMGRMIGLFDLTAGMTKTKLLTEKPHMDAALGSAVGRNCSDAVKKPIYPAVAETQDK  66

Query  541  E-IVSELRRNNSKMKANGTPMKMLIAE  618
            + IV+E R  +S   +  TP+KML+++
Sbjct  67   QLIVNEQRSGSSNKNSGRTPIKMLLSQ  93



>ref|XP_009410963.1| PREDICTED: uncharacterized protein LOC103992789 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=932

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 7/87 (8%)
 Frame = +1

Query  379  IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL----SRSQSDVAR--MSPSEDQIEDK  540
            +PGC+GRM+ LFDL  G+   +LLT+KPH D +L     R+ SD  +  + P+  + +DK
Sbjct  7    LPGCMGRMIGLFDLTAGMTKTKLLTEKPHMDAALGSAVGRNCSDAVKKPIYPAVAETQDK  66

Query  541  E-IVSELRRNNSKMKANGTPMKMLIAE  618
            + IV+E R  +S   +  TP+KML+++
Sbjct  67   QLIVNEQRSGSSNKNSGRTPIKMLLSQ  93



>gb|KDO65806.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=952

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +1

Query  478  LSRSQSDVARM--SPSEDQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            LSRSQSDVAR+  SP  DQIEDK +VSELRR +S   ANGTPMK LIA+
Sbjct  2    LSRSQSDVARIVTSPHADQIEDKPVVSELRRTSSNKNANGTPMKTLIAQ  50



>ref|XP_008679165.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679166.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679167.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679168.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679169.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679170.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
Length=936

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 17/96 (18%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS-----RSQSDVARMS---PSEDQI  531
            P PGCLGRM+++FDL+ GV   ++LT+K HRD   +     + +S+  +M+   P+  Q 
Sbjct  20   PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVCFAVSPAGKDRSNTFKMAIIPPA--QT  77

Query  532  EDKEIVSELRRN------NSKMKANG-TPMKMLIAE  618
            EDK+I S+ RRN      NS  K +G  P+KM++ +
Sbjct  78   EDKQIDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQ  113



>ref|XP_008679172.1| PREDICTED: uncharacterized protein LOC103654120 isoform X3 [Zea 
mays]
Length=930

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 17/96 (18%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLS-----RSQSDVARMS---PSEDQI  531
            P PGCLGRM+++FDL+ GV   ++LT+K HRD   +     + +S+  +M+   P+  Q 
Sbjct  20   PFPGCLGRMIDMFDLSNGVVATKMLTEKAHRDVCFAVSPAGKDRSNTFKMAIIPPA--QT  77

Query  532  EDKEIVSELRRN------NSKMKANG-TPMKMLIAE  618
            EDK+I S+ RRN      NS  K +G  P+KM++ +
Sbjct  78   EDKQIDSQTRRNSPTKRSNSPTKRSGAAPVKMIMEQ  113



>emb|CDX94731.1| BnaC07g17400D [Brassica napus]
Length=794

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 12/80 (15%)
 Frame = +1

Query  379  IPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSEL  558
            + GCLGRMVNLFD     +G +LL DKP+ D        D    S   D+IEDK +    
Sbjct  12   VQGCLGRMVNLFDFGTVGSGKKLLDDKPYFD-------DDWFIKSKQFDEIEDKVV----  60

Query  559  RRNNSKMKANGTPMKMLIAE  618
             RN   +  NGTPMKML+AE
Sbjct  61   -RNGFTVGVNGTPMKMLLAE  79



>ref|XP_008646431.1| PREDICTED: uncharacterized protein LOC103627892 isoform X3 [Zea 
mays]
 gb|AFW74025.1| hypothetical protein ZEAMMB73_702258 [Zea mays]
Length=932

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 13/92 (14%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMS---PSEDQIEDKE  543
            P PGCLGRM+N+ DL+ GV   ++LT+K HRD S   + +S+  +M+   P+  Q EDK+
Sbjct  20   PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDVSPAGKDRSNTFKMAINPPA--QTEDKQ  77

Query  544  IVSELRRN------NSKMKANGT-PMKMLIAE  618
              S+ RRN      NS  K  G  P+KML+ +
Sbjct  78   RDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQ  109



>gb|EMT03099.1| hypothetical protein F775_52439 [Aegilops tauschii]
Length=939

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 10/91 (11%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
            P PGCLGR++N+FDL+ GV   ++LTDK HRD S   + +S   +M+ ++   Q+EDK  
Sbjct  20   PFPGCLGRVINMFDLSNGVVATKMLTDKAHRDVSPAGKDRSGSFKMASNQFPAQMEDKHR  79

Query  547  VSELRRNNSKMKANG-------TPMKMLIAE  618
             S+ RR++   ++N        +P+KML+ +
Sbjct  80   DSQQRRSSPTKRSNSPTNRSGVSPVKMLMEQ  110



>gb|EMS54382.1| hypothetical protein TRIUR3_15055 [Triticum urartu]
Length=1009

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 10/91 (11%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVARMSPSE--DQIEDKEI  546
            P PGCLGR++N+FDL+ GV   ++LTDK HRD S   + +S   +M+ ++   Q+EDK  
Sbjct  98   PFPGCLGRVINMFDLSNGVVATKMLTDKAHRDVSPAGKDRSGSFKMASNQFPAQMEDKHR  157

Query  547  VSELRRNNSKMKANG-------TPMKMLIAE  618
             S+ RR++   ++N        +P+KML+ +
Sbjct  158  DSQQRRSSPTKRSNSPTNRSGVSPVKMLMEQ  188



>gb|EPS67990.1| hypothetical protein M569_06787, partial [Genlisea aurea]
Length=122

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 8/81 (10%)
 Frame = +1

Query  385  GCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSL---SRSQSDVARMSPSEDQIEDKEIVSE  555
            G LGRMVN+ + +  ++ NR+L+D+ H DGS    S S SDV+RMS S      ++IV +
Sbjct  5    GLLGRMVNILETSASLSANRMLSDERHLDGSYRGRSSSASDVSRMSLS----GHRKIVPD  60

Query  556  LRRNNSKMKANGTPMKMLIAE  618
            L +N   +K++G P+KMLIA+
Sbjct  61   L-KNYPNVKSSGMPVKMLIAQ  80



>gb|EEC74239.1| hypothetical protein OsI_09439 [Oryza sativa Indica Group]
Length=934

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 15/110 (14%)
 Frame = +1

Query  334  MYAVQNGKNRGLEK-----PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQS  495
            M  VQ+ K +  +      P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + 
Sbjct  1    MRGVQDRKQKKKQDLQVLGPFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRG  60

Query  496  DVARMS--PSEDQIEDKEIVSELRRN------NSKMKANG-TPMKMLIAE  618
            +  +M+  P   QIEDK+  S+ R+       +S  K +G  P+K+L+ +
Sbjct  61   NAFKMAIGPFSSQIEDKKRDSQPRKQSPTKRLSSPTKRSGEAPVKLLMEQ  110



>ref|NP_001048512.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAD22010.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10426.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAG94939.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58041.1| hypothetical protein OsJ_08870 [Oryza sativa Japonica Group]
Length=934

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 15/110 (14%)
 Frame = +1

Query  334  MYAVQNGKNRGLEK-----PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQS  495
            M  VQ+ K +  +      P PGCLGRM+N+FDL+ GV   ++LT+K HRD S   + + 
Sbjct  1    MRGVQDRKQKKKQDLQVLGPFPGCLGRMINMFDLSNGVVATKMLTEKAHRDVSPAGKDRG  60

Query  496  DVARMS--PSEDQIEDKEIVSELRRN------NSKMKANG-TPMKMLIAE  618
            +  +M+  P   QIEDK+  S+ R+       +S  K +G  P+K+L+ +
Sbjct  61   NAFKMAIGPFSSQIEDKKRDSQPRKQSPTKRLSSPTKRSGEAPVKLLMEQ  110



>ref|XP_008646424.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646425.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646426.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646428.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646429.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
Length=937

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 18/97 (19%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG------SLSRSQSDVARMS---PSEDQ  528
            P PGCLGRM+N+ DL+ GV   ++LT+K HRD          + +S+  +M+   P+  Q
Sbjct  20   PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDAYAFAVSPAGKDRSNTFKMAINPPA--Q  77

Query  529  IEDKEIVSELRRN------NSKMKANGT-PMKMLIAE  618
             EDK+  S+ RRN      NS  K  G  P+KML+ +
Sbjct  78   TEDKQRDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQ  114



>ref|XP_008646430.1| PREDICTED: uncharacterized protein LOC103627892 isoform X2 [Zea 
mays]
Length=936

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 18/97 (19%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG------SLSRSQSDVARMS---PSEDQ  528
            P PGCLGRM+N+ DL+ GV   ++LT+K HRD          + +S+  +M+   P+  Q
Sbjct  20   PFPGCLGRMINMLDLSNGVVATKMLTEKAHRDAYAFAVSPAGKDRSNTFKMAINPPA--Q  77

Query  529  IEDKEIVSELRRN------NSKMKANGT-PMKMLIAE  618
             EDK+  S+ RRN      NS  K  G  P+KML+ +
Sbjct  78   TEDKQRDSQTRRNFPTKRSNSPTKRTGAMPVKMLMEQ  114



>ref|XP_010481809.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
 ref|XP_010481810.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
Length=829

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 17/92 (18%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSE  522
            +N +  G+ + IPGCLGR+VNLFD      G +LLT+KPH  +GS+ R+Q          
Sbjct  7    RNVQGHGVGRQIPGCLGRVVNLFDFGTVGNGKKLLTEKPHFVNGSIRRNQL---------  57

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQI+DK  V    RN      +GTPMKML+ +
Sbjct  58   DQIKDKVDV----RNGG---VSGTPMKMLLEQ  82



>ref|XP_006279984.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12882.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=838

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 19/92 (21%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSE  522
            +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH D GS+ R+Q          
Sbjct  7    RNVQAHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFDNGSIRRNQL---------  57

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQIE   +             NGTPMKML+ +
Sbjct  58   DQIEVDVM---------NGGVNGTPMKMLLEQ  80



>ref|XP_006279983.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12881.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=893

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 19/92 (21%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSE  522
            +N +  G+ + IPGCLGRMVNLFD      G +LLT+KPH D GS+ R+Q          
Sbjct  62   RNVQAHGVGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFDNGSIRRNQL---------  112

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            DQIE   +             NGTPMKML+ +
Sbjct  113  DQIEVDVM---------NGGVNGTPMKMLLEQ  135



>ref|XP_010494373.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
 ref|XP_010494374.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
Length=837

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 17/92 (18%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHR-DGSLSRSQSDVARMSPSE  522
            +N +  G  + IPGCLGRMVNLFD      G +LLT+KPH  +GS+ R++          
Sbjct  7    RNVQGHGTGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHFGNGSIRRNRL---------  57

Query  523  DQIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            D I+DK  V    RN      NGTPMKML+ +
Sbjct  58   DHIKDKVDV----RNGG---VNGTPMKMLLEQ  82



>ref|XP_010494375.1| PREDICTED: uncharacterized protein LOC104771538 isoform X2 [Camelina 
sativa]
Length=835

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 51/91 (56%), Gaps = 17/91 (19%)
 Frame = +1

Query  346  QNGKNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSED  525
            +N +  G  + IPGCLGRMVNLFD      G +LLT+KPH  GS+ R++          D
Sbjct  7    RNVQGHGTGRQIPGCLGRMVNLFDFGTVGNGKKLLTEKPHF-GSIRRNRL---------D  56

Query  526  QIEDKEIVSELRRNNSKMKANGTPMKMLIAE  618
             I+DK  V    RN      NGTPMKML+ +
Sbjct  57   HIKDKVDV----RNGG---VNGTPMKMLLEQ  80



>ref|XP_002863627.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39886.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
Length=833

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 17/79 (22%)
 Frame = +1

Query  385  GCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
            GCLGRMVNLFD      G +LL++KP+ D GS+ R+Q          DQIEDK  V    
Sbjct  13   GCLGRMVNLFDFGTVGNGKKLLSEKPYFDHGSIKRNQF---------DQIEDKVDV----  59

Query  562  RNNSKMKANGTPMKMLIAE  618
            RN      NGTPMKML+ +
Sbjct  60   RNGG---VNGTPMKMLLEQ  75



>emb|CDY32928.1| BnaA09g16650D [Brassica napus]
Length=755

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 20/89 (22%)
 Frame = +1

Query  355  KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQI  531
            + R +++P  GCLGRMVNLFD     +G +LLTDKP+  DGS+ R+Q D+      ED++
Sbjct  5    RRRNVQQP-HGCLGRMVNLFDFGTVASGKKLLTDKPYFDDGSIKRNQLDLL-----EDKV  58

Query  532  EDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            +              +  NGTP+K L+ E
Sbjct  59   D-------------TVAVNGTPIKKLLEE  74



>ref|XP_009113974.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113975.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113976.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
Length=757

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 20/89 (22%)
 Frame = +1

Query  355  KNRGLEKPIPGCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQI  531
            + R +++P  GCLGRMVNLFD     +G +LLTDKP+  DGS+ R+Q D+      ED++
Sbjct  5    RRRNVQQP-HGCLGRMVNLFDFGTVASGKKLLTDKPYFDDGSIKRNQLDLL-----EDKV  58

Query  532  EDKEIVSELRRNNSKMKANGTPMKMLIAE  618
            +              +  NGTP+K L+ E
Sbjct  59   D-------------TVAVNGTPIKKLLEE  74



>gb|EAY88009.1| hypothetical protein OsI_09433 [Oryza sativa Indica Group]
Length=290

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  376  PIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG  474
            P PGCLGRM+N+FDL+ GV   ++LT+K HRDG
Sbjct  20   PFPGCLGRMINMFDLSNGVVATKMLTEKAHRDG  52



>ref|XP_010933202.1| PREDICTED: uncharacterized protein LOC105053649 isoform X1 [Elaeis 
guineensis]
Length=963

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDGSLSRS-QSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
            M+N+ DLN G+AG +LLTDK H DGS  RS QSDV + M+ +   ++DK+I  +LR+++S
Sbjct  1    MINMLDLNAGMAGTKLLTDKAHGDGSPVRSNQSDVKKAMNLNGVYVDDKQIACDLRKSSS  60

Query  574  KMKANGTPMKMLIAE  618
              ++ GTP+K+L+A+
Sbjct  61   SKRSGGTPVKVLMAQ  75



>ref|XP_010933203.1| PREDICTED: uncharacterized protein LOC105053649 isoform X2 [Elaeis 
guineensis]
Length=965

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDGSLSRS-QSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
            M+N+ DLN G+AG +LLTDK H DGS  RS QSDV + M+ +   ++DK+I  +LR+++S
Sbjct  1    MINMLDLNAGMAGTKLLTDKAHGDGSPVRSNQSDVKKAMNLNGVYVDDKQIACDLRKSSS  60

Query  574  KMKANGTPMKMLIAE  618
              ++ GTP+K+L+A+
Sbjct  61   SKRSGGTPVKVLMAQ  75



>gb|ACN40217.1| unknown [Picea sitchensis]
Length=894

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +1

Query  373  KPIPGCLGRMVNLFDLNGGVAGNRLLTDKPHRDG-SLSRSQSDVARMSPSEDQIEDKEIV  549
            K  PGC+G ++NLFD N    G RLLT+K H DG    R+  DV+  +P   ++++++I 
Sbjct  15   KDFPGCMGGLLNLFDFNQAHNGRRLLTEKRHGDGLEAPRNSLDVSLETPPSREVKNEDIP  74

Query  550  SELRRN---NSKMKANGTPMKMLIAE  618
                 N    ++ K +G PMK LIA+
Sbjct  75   YAYEMNKVPTTRKKVSGMPMKTLIAQ  100



>ref|XP_009418765.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418843.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418912.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=922

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  391  LGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNN  570
            +GRM+N FDL+ G+  ++LL ++P RD   + S      + P E +IE K+I+SE R ++
Sbjct  1    MGRMINTFDLSAGMDRSKLLAERPQRDVIRNCSHVVTKPIYPVEMEIEGKQIISEQRISS  60

Query  571  SKMKANGTPMKMLIAE  618
               K+ GT +KML+A+
Sbjct  61   PNKKSGGTTIKMLMAQ  76



>ref|XP_009418989.1| PREDICTED: uncharacterized protein LOC103998847 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=900

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  391  LGRMVNLFDLNGGVAGNRLLTDKPHRDGSLSRSQSDVARMSPSEDQIEDKEIVSELRRNN  570
            +GRM+N FDL+ G+  ++LL ++P RD   + S      + P E +IE K+I+SE R ++
Sbjct  1    MGRMINTFDLSAGMDRSKLLAERPQRDVIRNCSHVVTKPIYPVEMEIEGKQIISEQRISS  60

Query  571  SKMKANGTPMKMLIAE  618
               K+ GT +KML+A+
Sbjct  61   PNKKSGGTTIKMLMAQ  76



>ref|NP_199201.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA98068.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM91604.1| putative protein [Arabidopsis thaliana]
 gb|AED95020.1| uncharacterized protein AT5G43880 [Arabidopsis thaliana]
Length=836

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 44/79 (56%), Gaps = 17/79 (22%)
 Frame = +1

Query  385  GCLGRMVNLFDLNGGVAGNRLLTDKPHRD-GSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
            GCL RMVNLFD      G +LLT+KPH D GS+  +Q          DQIEDK  V    
Sbjct  13   GCLARMVNLFDFGTVGNGKKLLTEKPHFDHGSIKGNQF---------DQIEDKVDV----  59

Query  562  RNNSKMKANGTPMKMLIAE  618
            RN      NGTPMKML+ +
Sbjct  60   RNGG---VNGTPMKMLLEQ  75



>ref|XP_009382188.1| PREDICTED: uncharacterized protein LOC103970221 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=918

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 9/75 (12%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDGS-LSRSQSDVAR-MSPSEDQIEDKEIVSELRRNNS  573
            M+N+FDL+ G+AG ++L ++ HR+GS + R+  +V    +PS    ++K+       N+S
Sbjct  1    MINIFDLSAGMAGTKMLPERDHRNGSPVHRNNPNVNEAATPSATNTDNKQ-------NSS  53

Query  574  KMKANGTPMKMLIAE  618
            K K+ GTPMKMLIA+
Sbjct  54   KKKSGGTPMKMLIAQ  68



>emb|CDY50812.1| BnaCnng19760D [Brassica napus]
Length=750

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 19/79 (24%)
 Frame = +1

Query  385  GCLGRMVNLFDLNGGVAGNRLLTDKPH-RDGSLSRSQSDVARMSPSEDQIEDKEIVSELR  561
            GCLGRMVNLFD     +G +LLTDKP+  DG + R+Q D+         IEDK       
Sbjct  14   GCLGRMVNLFDFGTVGSGKKLLTDKPYFDDGCIKRNQLDL---------IEDK-------  57

Query  562  RNNSKMKANGTPMKMLIAE  618
                 +  NGTP+K L+ E
Sbjct  58   --VDTIAVNGTPIKKLLEE  74



>ref|XP_009405681.1| PREDICTED: uncharacterized protein LOC103988772 [Musa acuminata 
subsp. malaccensis]
Length=931

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  400  MVNLFDLNGGVAGNRLLTDKPHRDGSLSR-SQSDV--ARMSPSEDQIEDKEIVSELRRNN  570
            M+N+FDL+  + G + L + PHRD  ++  + SD+   R+  +  Q E K +  E R++ 
Sbjct  1    MINMFDLSAHMNGIKQLAENPHRDDLMAVGNHSDMLKKRVDSNAVQREGKHVTCEHRKSP  60

Query  571  SKMKANGTPMKMLIAE  618
            S  K++GTPMKMLIAE
Sbjct  61   SGKKSSGTPMKMLIAE  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520