BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023G17

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           225   2e-67   Nicotiana tomentosiformis
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           224   6e-67   Nicotiana sylvestris
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      216   4e-64   Solanum tuberosum [potatoes]
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           216   5e-64   Solanum lycopersicum
emb|CDP09891.1|  unnamed protein product                                192   6e-55   Coffea canephora [robusta coffee]
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           187   6e-53   Sesamum indicum [beniseed]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     186   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      186   1e-52   Glycine max [soybeans]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    185   3e-52   
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    184   6e-52   Tarenaya hassleriana [spider flower]
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       184   8e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAK93670.1|  putative nucleotide sugar epimerase                     184   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        184   1e-51   Medicago truncatula
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             183   1e-51   Eutrema salsugineum [saltwater cress]
emb|CDX86716.1|  BnaA09g21060D                                          183   2e-51   
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             183   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             182   2e-51   Phaseolus vulgaris [French bean]
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    182   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      181   9e-51   Glycine max [soybeans]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    181   9e-51   Arabis alpina [alpine rockcress]
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      180   2e-50   
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       180   2e-50   Gossypium hirsutum [American cotton]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             179   4e-50   Citrus clementina [clementine]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         179   4e-50   Jatropha curcas
emb|CDX94504.1|  BnaC09g23320D                                          179   4e-50   
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           179   5e-50   Cucumis melo [Oriental melon]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      179   5e-50   Cicer arietinum [garbanzo]
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    179   5e-50   
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       179   6e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB41101.1|  hypothetical protein B456_007G090500                    179   9e-50   Gossypium raimondii
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   9e-50   
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    178   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    178   1e-49   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   2e-49   Sesamum indicum [beniseed]
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      177   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             177   2e-49   Capsella rubella
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             177   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           177   5e-49   Eucalyptus grandis [rose gum]
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    176   5e-49   
emb|CDY63064.1|  BnaAnng18570D                                          176   7e-49   Brassica napus [oilseed rape]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           176   8e-49   Brassica rapa
emb|CDO97699.1|  unnamed protein product                                176   9e-49   Coffea canephora [robusta coffee]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      176   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      176   1e-48   Brassica rapa
gb|EPS72617.1|  hypothetical protein M569_02133                         176   1e-48   Genlisea aurea
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       175   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    175   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      175   2e-48   Populus euphratica
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             174   3e-48   Capsella rubella
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           174   3e-48   Nicotiana tomentosiformis
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      174   5e-48   Sesamum indicum [beniseed]
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                174   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           174   7e-48   
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           173   9e-48   Solanum lycopersicum
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    173   1e-47   Arabis alpina [alpine rockcress]
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           172   2e-47   Pyrus x bretschneideri [bai li]
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                172   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      171   3e-47   Vitis vinifera
emb|CAN60968.1|  hypothetical protein VITISV_008097                     172   3e-47   Vitis vinifera
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             172   4e-47   Prunus persica
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           171   4e-47   
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      172   4e-47   Solanum lycopersicum
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           171   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      171   5e-47   Solanum tuberosum [potatoes]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      171   5e-47   Solanum tuberosum [potatoes]
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           171   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      171   6e-47   Vitis vinifera
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           170   1e-46   Populus euphratica
emb|CDY67756.1|  BnaA03g56770D                                          170   1e-46   Brassica napus [oilseed rape]
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           170   2e-46   Brassica rapa
emb|CDX95646.1|  BnaC03g25270D                                          169   2e-46   
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      169   2e-46   Nicotiana tomentosiformis
emb|CDX97356.1|  BnaA02g21470D                                          169   4e-46   
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           169   4e-46   
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      169   5e-46   Nicotiana sylvestris
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      168   8e-46   Nicotiana sylvestris
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           168   8e-46   Nicotiana tomentosiformis
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             168   9e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      168   1e-45   Morus notabilis
gb|KJB24820.1|  hypothetical protein B456_004G162700                    167   1e-45   Gossypium raimondii
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      167   2e-45   Solanum tuberosum [potatoes]
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      162   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      167   3e-45   Vitis vinifera
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           166   4e-45   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    166   4e-45   Arabis alpina [alpine rockcress]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      166   6e-45   Vitis vinifera
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      165   9e-45   Cucumis sativus [cucumbers]
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      165   1e-44   Eucalyptus grandis [rose gum]
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           165   1e-44   Cucumis melo [Oriental melon]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      164   1e-44   Cicer arietinum [garbanzo]
emb|CAN73016.1|  hypothetical protein VITISV_004388                     164   3e-44   Vitis vinifera
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      163   5e-44   Solanum lycopersicum
gb|KJB09908.1|  hypothetical protein B456_001G174300                    162   9e-44   Gossypium raimondii
gb|EPS73152.1|  hypothetical protein M569_01604                         161   1e-43   Genlisea aurea
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           162   1e-43   Fragaria vesca subsp. vesca
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      162   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           162   1e-43   Camelina sativa [gold-of-pleasure]
emb|CDY04398.1|  BnaC02g28500D                                          161   3e-43   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    161   3e-43   Arabidopsis lyrata subsp. lyrata
gb|KJB43946.1|  hypothetical protein B456_007G225300                    160   4e-43   Gossypium raimondii
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      160   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         160   1e-42   Jatropha curcas
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      159   1e-42   Citrus sinensis [apfelsine]
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           159   1e-42   Prunus mume [ume]
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           159   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           159   2e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    159   2e-42   Arabis alpina [alpine rockcress]
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             158   3e-42   
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    158   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      158   5e-42   Populus euphratica
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       158   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16292.1|  unknown                                                 157   7e-42   Picea sitchensis
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      157   7e-42   Populus euphratica
gb|KJB25649.1|  hypothetical protein B456_004G202200                    157   1e-41   Gossypium raimondii
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             157   1e-41   Capsella rubella
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           156   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      156   3e-41   Cucumis sativus [cucumbers]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           155   4e-41   Elaeis guineensis
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      156   4e-41   Phoenix dactylifera
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      150   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             155   4e-41   Citrus clementina [clementine]
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      155   4e-41   Glycine max [soybeans]
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      155   5e-41   Sesamum indicum [beniseed]
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      152   5e-41   Phoenix dactylifera
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    155   6e-41   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              155   6e-41   Ricinus communis
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   155   6e-41   Citrus sinensis [apfelsine]
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           155   9e-41   Cucumis melo [Oriental melon]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             154   9e-41   Citrus clementina [clementine]
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             154   1e-40   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       154   2e-40   Cucumis sativus [cucumbers]
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      154   2e-40   Cucumis melo [Oriental melon]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      153   3e-40   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      153   3e-40   Nicotiana sylvestris
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      153   3e-40   
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          153   3e-40   Amborella trichopoda
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           153   3e-40   Cucumis melo [Oriental melon]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      153   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         153   4e-40   Jatropha curcas
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      153   4e-40   Morus notabilis
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           152   5e-40   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    153   5e-40   Elaeis guineensis
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              152   5e-40   
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      152   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             152   6e-40   Phaseolus vulgaris [French bean]
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      152   6e-40   Camelina sativa [gold-of-pleasure]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           152   6e-40   Medicago truncatula
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           152   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      152   8e-40   Cucumis sativus [cucumbers]
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      152   8e-40   Glycine max [soybeans]
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           152   9e-40   Tarenaya hassleriana [spider flower]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      152   9e-40   Nicotiana tomentosiformis
gb|KJB72008.1|  hypothetical protein B456_011G153500                    152   1e-39   Gossypium raimondii
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      151   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       152   1e-39   Gossypium hirsutum [American cotton]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           151   1e-39   Brassica rapa
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             151   1e-39   
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    152   1e-39   Theobroma cacao [chocolate]
emb|CDY70926.1|  BnaCnng70410D                                          151   1e-39   Brassica napus [oilseed rape]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          151   2e-39   Amborella trichopoda
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             151   2e-39   Capsella rubella
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             151   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           151   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           151   2e-39   Camelina sativa [gold-of-pleasure]
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       151   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     151   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    151   2e-39   
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           151   2e-39   Sesamum indicum [beniseed]
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          150   2e-39   Amborella trichopoda
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   2e-39   Nicotiana tomentosiformis
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           150   3e-39   Medicago truncatula
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      150   3e-39   Cicer arietinum [garbanzo]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      150   3e-39   Morus notabilis
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           150   4e-39   Sesamum indicum [beniseed]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    150   4e-39   Gossypium raimondii
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       150   4e-39   Phaseolus vulgaris [French bean]
emb|CDP21869.1|  unnamed protein product                                150   4e-39   Coffea canephora [robusta coffee]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             150   4e-39   Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           150   5e-39   Phaseolus vulgaris [French bean]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           150   5e-39   Eucalyptus grandis [rose gum]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    150   5e-39   Arabis alpina [alpine rockcress]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           150   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      150   5e-39   Nelumbo nucifera [Indian lotus]
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           149   6e-39   Populus euphratica
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         149   6e-39   Jatropha curcas
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   6e-39   Camelina sativa [gold-of-pleasure]
gb|AFK49564.1|  unknown                                                 150   7e-39   Medicago truncatula
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           150   7e-39   Eucalyptus grandis [rose gum]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  149   7e-39   Medicago truncatula
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          149   7e-39   Amborella trichopoda
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      149   8e-39   Solanum tuberosum [potatoes]
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      149   8e-39   Vitis vinifera
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           149   9e-39   Sesamum indicum [beniseed]
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   9e-39   Nicotiana sylvestris
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   9e-39   Nelumbo nucifera [Indian lotus]
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       149   9e-39   Gossypium hirsutum [American cotton]
ref|XP_001759693.1|  predicted protein                                  149   1e-38   
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             149   1e-38   Citrus clementina [clementine]
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   1e-38   Nicotiana sylvestris
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   149   1e-38   Citrus sinensis [apfelsine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   1e-38   Citrus sinensis [apfelsine]
emb|CDX72242.1|  BnaC07g42640D                                          149   1e-38   
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   1e-38   Populus euphratica
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           149   1e-38   Vitis vinifera
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   1e-38   Nicotiana tomentosiformis
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     149   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE71216.1|  putative NAD dependent epimerase                       149   2e-38   Trifolium pratense [peavine clover]
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Tarenaya hassleriana [spider flower]
emb|CDY39205.1|  BnaA03g50170D                                          148   2e-38   Brassica napus [oilseed rape]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   2e-38   Glycine max [soybeans]
gb|KJB76605.1|  hypothetical protein B456_012G096800                    148   2e-38   Gossypium raimondii
emb|CAN83418.1|  hypothetical protein VITISV_041351                     148   2e-38   Vitis vinifera
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       148   2e-38   Gossypium hirsutum [American cotton]
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      147   2e-38   Solanum lycopersicum
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      148   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      149   3e-38   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           147   3e-38   Medicago truncatula
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           147   3e-38   Eucalyptus grandis [rose gum]
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              147   4e-38   Ricinus communis
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          148   4e-38   Sorghum bicolor [broomcorn]
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   4e-38   Nicotiana sylvestris
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      147   5e-38   Phoenix dactylifera
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   5e-38   Solanum tuberosum [potatoes]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      147   5e-38   Solanum tuberosum [potatoes]
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           147   5e-38   Fragaria vesca subsp. vesca
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   5e-38   Cicer arietinum [garbanzo]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           147   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    146   7e-38   
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   8e-38   Populus euphratica
gb|ABK25339.1|  unknown                                                 146   8e-38   Picea sitchensis
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             147   9e-38   
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      146   9e-38   Populus euphratica
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              147   9e-38   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        146   9e-38   Medicago truncatula
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           146   9e-38   Elaeis guineensis
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      146   1e-37   Solanum lycopersicum
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           146   1e-37   Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             146   1e-37   Prunus persica
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    146   1e-37   Glycine max [soybeans]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           146   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           146   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             146   1e-37   
gb|EPS60141.1|  hypothetical protein M569_14661                         146   1e-37   Genlisea aurea
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      146   1e-37   Nicotiana tomentosiformis
emb|CDP21367.1|  unnamed protein product                                145   2e-37   Coffea canephora [robusta coffee]
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      146   2e-37   Zea mays [maize]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           145   2e-37   Solanum lycopersicum
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           145   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           145   2e-37   Malus domestica [apple tree]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           145   2e-37   Malus domestica [apple tree]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      145   2e-37   Oryza brachyantha
emb|CBI18845.3|  unnamed protein product                                141   2e-37   Vitis vinifera
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      145   2e-37   Morus notabilis
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      145   2e-37   Solanum tuberosum [potatoes]
ref|NP_001048359.1|  Os02g0791500                                       145   3e-37   
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      145   3e-37   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           145   3e-37   Malus domestica [apple tree]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      145   4e-37   
emb|CDY18087.1|  BnaA01g23480D                                          145   5e-37   Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           145   5e-37   Brassica rapa
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           144   5e-37   Prunus mume [ume]
emb|CDY64583.1|  BnaCnng44170D                                          145   5e-37   Brassica napus [oilseed rape]
ref|NP_001105911.1|  LOC732831                                          144   6e-37   Zea mays [maize]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    144   6e-37   Zea mays [maize]
dbj|BAJ86203.1|  predicted protein                                      145   6e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             144   6e-37   Prunus persica
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                144   7e-37   Erythranthe guttata [common monkey flower]
ref|XP_001767292.1|  predicted protein                                  144   7e-37   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           144   8e-37   Phoenix dactylifera
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           144   8e-37   Nicotiana tomentosiformis
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      144   9e-37   Glycine max [soybeans]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           144   1e-36   Fragaria vesca subsp. vesca
gb|KJB27036.1|  hypothetical protein B456_004G273500                    143   1e-36   Gossypium raimondii
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             144   1e-36   Eutrema salsugineum [saltwater cress]
gb|ACN26174.1|  unknown                                                 140   1e-36   Zea mays [maize]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      143   1e-36   Zea mays [maize]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      144   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          143   1e-36   
gb|KJB27035.1|  hypothetical protein B456_004G273500                    143   1e-36   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      143   1e-36   
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      143   2e-36   
ref|XP_001751991.1|  predicted protein                                  143   2e-36   
ref|NP_001142515.1|  hypothetical protein                               143   2e-36   
dbj|BAK06545.1|  predicted protein                                      143   2e-36   
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          143   2e-36   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             142   2e-36   
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      143   2e-36   
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           142   2e-36   
ref|XP_001769370.1|  predicted protein                                  143   2e-36   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      142   2e-36   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           142   3e-36   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   142   3e-36   
ref|NP_001062295.1|  Os08g0526100                                       143   3e-36   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           143   3e-36   
emb|CDY53207.1|  BnaC03g74010D                                          142   3e-36   
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      142   3e-36   
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      142   3e-36   
emb|CDX92990.1|  BnaA03g37120D                                          142   3e-36   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      142   3e-36   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      142   4e-36   
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   5e-36   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      142   5e-36   
gb|EEC83914.1|  hypothetical protein OsI_29969                          142   5e-36   
gb|AAN60250.1|  unknown                                                 142   5e-36   
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           142   6e-36   
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      141   6e-36   
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             142   6e-36   
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       142   6e-36   
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             142   6e-36   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          142   8e-36   
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      141   9e-36   
ref|NP_001147328.1|  protein capI                                       141   9e-36   
gb|EEC84839.1|  hypothetical protein OsI_31939                          142   9e-36   
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    141   9e-36   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          142   9e-36   
dbj|BAJ85817.1|  predicted protein                                      141   9e-36   
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    141   9e-36   
ref|NP_001063595.1|  Os09g0504000                                       141   1e-35   
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                140   1e-35   
emb|CDX77481.1|  BnaA07g06190D                                          141   1e-35   
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           141   1e-35   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    140   1e-35   
emb|CDX85133.1|  BnaC07g07730D                                          140   1e-35   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          141   1e-35   
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      140   1e-35   
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   2e-35   
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   2e-35   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   2e-35   
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   2e-35   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      139   2e-35   
ref|XP_001761086.1|  predicted protein                                  140   2e-35   
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   2e-35   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    140   3e-35   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      140   3e-35   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             139   3e-35   
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    140   3e-35   
dbj|BAJ99315.1|  predicted protein                                      140   3e-35   
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      140   4e-35   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      139   4e-35   
ref|XP_001754001.1|  predicted protein                                  139   5e-35   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           139   5e-35   
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           139   5e-35   
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      139   6e-35   
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      138   8e-35   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             138   9e-35   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      139   1e-34   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      137   1e-34   
ref|XP_001761984.1|  predicted protein                                  138   1e-34   
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              138   1e-34   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    138   1e-34   
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             138   1e-34   
gb|EAY99954.1|  hypothetical protein OsI_21957                          138   1e-34   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         138   1e-34   
dbj|BAJ88176.1|  predicted protein                                      137   2e-34   
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      137   3e-34   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      137   4e-34   
gb|EPS64795.1|  hypothetical protein M569_09984                         135   6e-34   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         135   8e-34   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      135   9e-34   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           136   3e-33   
ref|NP_001049561.1|  Os03g0249500                                       134   3e-33   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      133   5e-33   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      133   6e-33   
ref|XP_001781238.1|  predicted protein                                  132   8e-33   
ref|XP_001777338.1|  predicted protein                                  131   4e-32   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      131   5e-32   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    130   7e-32   
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           129   8e-32   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    130   8e-32   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    130   8e-32   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    129   9e-32   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    130   1e-31   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    130   1e-31   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      128   4e-31   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      127   4e-31   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             127   6e-31   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    125   2e-30   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      125   3e-30   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      124   5e-30   
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      122   4e-29   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              120   2e-28   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              120   2e-28   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      120   2e-28   
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                    119   3e-28   
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699              105   2e-25   
ref|XP_002504144.1|  predicted protein                                  109   2e-24   
ref|XP_001416501.1|  predicted protein                                  107   6e-24   
emb|CEG01274.1|  Nucleotide sugar epimerase                             106   2e-23   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          104   8e-23   
emb|CBI24539.3|  unnamed protein product                                103   1e-22   
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      104   2e-22   
ref|XP_003060215.1|  protein arginine methyltransferase                 102   2e-22   
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                101   8e-22   
gb|KDD74739.1|  NAD dependent epimerase/dehydratase                     100   1e-21   
ref|XP_007512695.1|  predicted protein                                99.0    2e-20   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                        97.8    2e-20   
ref|WP_013942574.1|  NAD-dependent epimerase                          96.7    3e-20   
ref|WP_039386438.1|  hypothetical protein                             95.9    5e-20   
ref|WP_013182875.1|  NAD-dependent epimerase                          94.0    2e-19   
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                         94.0    2e-19   
ref|WP_006341506.1|  NAD-dependent epimerase                          94.0    2e-19   
ref|WP_013924154.1|  NAD-dependent epimerase                          94.0    2e-19   
gb|KIA76468.1|  UDP-glucuronate 4-epimerase 4                         94.0    3e-19   
ref|WP_042239280.1|  hypothetical protein                             94.0    3e-19   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                         95.1    4e-19   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase              93.6    4e-19   
gb|AFW73830.1|  hypothetical protein ZEAMMB73_770166                  87.8    2e-18   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                         91.3    2e-18   
ref|WP_032124748.1|  protein CapI                                     89.4    1e-17   
gb|KJE95471.1|  UDP-glucuronat epimerase                              91.3    1e-17   
ref|XP_004345510.1|  UDP-glucuronat epimerase                         91.3    1e-17   
ref|XP_001422311.1|  predicted protein                                89.0    2e-17   
ref|WP_010150292.1|  nucleoside-diphosphate sugar epimerase           88.2    3e-17   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                         88.2    7e-17   
ref|XP_004989570.1|  NAD-dependent epimerase/dehydratase              85.5    6e-16   
emb|CAF22803.1|  probable UDP-glucuronat epimerase                    84.0    6e-16   
gb|KIC74368.1|  UDP-glucuronate 4-epimerase 4                         84.3    6e-16   
gb|ABQ26775.1|  NAD-dependent epimerase/dehydratase                   84.0    9e-16   
ref|WP_041245451.1|  capsular biosynthesis protein CpsI               83.6    1e-15   
ref|WP_034946167.1|  protein CapI                                     83.2    1e-15   
ref|WP_041017905.1|  hypothetical protein                             82.8    2e-15   
ref|WP_034900611.1|  protein CapI                                     82.8    2e-15   
gb|AFW76910.1|  hypothetical protein ZEAMMB73_383341                  83.6    2e-15   
gb|AFW77898.1|  hypothetical protein ZEAMMB73_133895                  82.8    2e-15   
ref|WP_020559072.1|  NAD dependent epimerase/dehydratase              82.8    2e-15   
ref|WP_034931450.1|  protein CapI                                     82.8    2e-15   
ref|WP_035516218.1|  hypothetical protein                             82.8    2e-15   
ref|WP_011335367.1|  NAD-dependent epimerase/dehydratase              82.4    2e-15   
ref|WP_039742914.1|  capsular biosynthesis protein CpsI               82.4    2e-15   
gb|AFW73050.1|  hypothetical protein ZEAMMB73_892883                  82.4    4e-15   
ref|XP_005705758.1|  NAD-dependent epimerase/dehydratase              82.4    5e-15   
gb|EKE24914.1|  hypothetical protein ACD_5C00356G0001                 80.9    6e-15   
ref|WP_039355857.1|  protein CapI                                     81.3    6e-15   
ref|WP_042281578.1|  protein CapI                                     80.9    7e-15   
ref|WP_010584368.1|  NAD-dependent epimerase/dehydratase              80.9    1e-14   
ref|WP_038527232.1|  protein CapI                                     80.1    1e-14   
ref|XP_002515933.1|  UDP-glucuronate 5-epimerase, putative            77.8    1e-14   
ref|WP_013179120.1|  epimerase                                        80.1    2e-14   
ref|XP_004346304.1|  NAD-dependent epimerase/dehydratase              80.1    2e-14   
ref|XP_005538382.1|  probable nucleotide sugar epimerase              80.5    2e-14   
ref|WP_026816618.1|  capsular biosynthesis protein CpsI               79.3    3e-14   
ref|WP_028995746.1|  hypothetical protein                             79.0    5e-14   
ref|WP_038151637.1|  protein CapI                                     79.0    5e-14   
ref|WP_009552387.1|  nucleoside-diphosphate-sugar epimerase           78.6    6e-14   
ref|WP_014240523.1|  UDP-glucose/glucuronate epimerase                78.2    8e-14   
ref|WP_044432182.1|  protein CapI                                     78.2    8e-14   
ref|WP_014248472.1|  UDP-glucose/glucuronate epimerase                78.2    9e-14   
ref|WP_019952784.1|  hypothetical protein                             77.8    1e-13   
gb|EWM20515.1|  nad-dependent epimerase dehydratase                   77.0    1e-13   
ref|WP_027853547.1|  capsular biosynthesis protein CpsI               77.8    1e-13   
ref|WP_042696174.1|  protein CapI                                     77.8    1e-13   
ref|WP_035680547.1|  protein CapI                                     77.8    1e-13   
ref|WP_008813890.1|  hypothetical protein                             77.0    2e-13   
ref|XP_005855804.1|  nad-dependent epimerase dehydratase              78.6    2e-13   
ref|WP_039186181.1|  protein CapI                                     77.0    2e-13   
gb|EWM29155.1|  nad-dependent epimerase dehydratase                   78.2    2e-13   
ref|XP_005854894.1|  UDP-glucuronate 4-epimerase                      77.4    3e-13   
ref|WP_023794561.1|  hypothetical protein                             73.9    3e-13   
ref|WP_012468563.1|  NAD-dependent epimerase/dehydratase              76.6    4e-13   
ref|WP_020164790.1|  NAD dependent epimerase/dehydratase              76.6    4e-13   
ref|WP_014235516.1|  nucleoside-diphosphate-sugar epimerase           76.3    4e-13   
ref|WP_029733863.1|  hypothetical protein                             75.9    4e-13   
ref|WP_015827645.1|  NAD-dependent epimerase                          76.3    4e-13   
ref|WP_004368982.1|  NAD-dependent epimerase/dehydratase              76.3    4e-13   
ref|WP_023782500.1|  NAD dependent epimerase/dehydratase              75.9    4e-13   
ref|XP_005854551.1|  nad-dependent epimerase dehydratase              77.8    5e-13   
ref|WP_013259566.1|  epimerase                                        75.9    5e-13   
ref|WP_012823883.1|  NAD-dependent epimerase/dehydratase              75.9    5e-13   
ref|WP_043953063.1|  protein CapI                                     75.9    5e-13   
ref|WP_010214816.1|  NAD-dependent epimerase/dehydratase              75.9    5e-13   
ref|WP_032917384.1|  capsular biosynthesis protein CpsI               76.3    5e-13   
ref|WP_010161169.1|  NAD-dependent epimerase/dehydratase              75.9    5e-13   
gb|KIA57531.1|  protein CapI                                          75.9    5e-13   
ref|WP_027183803.1|  capsular biosynthesis protein CpsI               75.9    6e-13   
ref|WP_036168659.1|  protein CapI                                     75.9    6e-13   
ref|WP_023678750.1|  NAD dependent epimerase/dehydratase              75.9    6e-13   
ref|XP_001749782.1|  hypothetical protein                             76.6    6e-13   
ref|WP_003844286.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  75.9    6e-13   
ref|WP_023760577.1|  NAD dependent epimerase/dehydratase              75.9    6e-13   
ref|WP_032949582.1|  protein CapI                                     75.9    7e-13   
ref|WP_013896526.1|  NAD-dependent epimerase/dehydratase              75.9    7e-13   
ref|WP_015329924.1|  putative UDP-glucose epimerase ytcB              75.5    7e-13   
ref|WP_011289653.1|  NAD-dependent epimerase/dehydratase              75.5    7e-13   
ref|WP_024503650.1|  capsular biosynthesis protein CpsI               75.5    7e-13   
ref|WP_034680088.1|  capsular biosynthesis protein CpsI               75.5    8e-13   
ref|WP_027058136.1|  capsular biosynthesis protein CpsI               75.5    8e-13   
gb|KHN22625.1|  Putative 37.6 kDa protein in cld 5'region             75.5    8e-13   
ref|WP_026444165.1|  capsular biosynthesis protein CpsI               75.5    8e-13   
ref|WP_036184088.1|  capsular biosynthesis protein CpsI               75.5    8e-13   
ref|WP_019866614.1|  NAD dependent epimerase/dehydratase              75.5    9e-13   
ref|WP_029116486.1|  UDP-glucose epimerase                            75.1    1e-12   
ref|WP_032442109.1|  protein CapI                                     75.1    1e-12   
ref|XP_009033147.1|  hypothetical protein AURANDRAFT_19538            75.5    1e-12   
ref|WP_009787825.1|  NAD-dependent epimerase                          75.1    1e-12   
ref|WP_009802664.1|  NAD-dependent epimerase/dehydratase family p...  74.7    1e-12   
ref|WP_018410819.1|  NAD dependent epimerase/dehydratase              75.1    1e-12   
ref|WP_013532735.1|  NAD-dependent epimerase/dehydratase              75.1    1e-12   
ref|WP_043743205.1|  protein CapI                                     74.7    1e-12   



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 157/191 (82%), Gaps = 7/191 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSA---FYrlrlqprlflrlilWSfvfvfvillfff  255
            M Q K +L+H D++PSTPGKFKP+KS+    YRLR  P LF R  LWSF+F+  I+LFFF
Sbjct  1    MTQLKPILTHLDAIPSTPGKFKPDKSSPYSLYRLRFHPTLFPRFTLWSFLFICFIVLFFF  60

Query  256  iSPPASGAS--NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
             SPP + A+  NRR+L  K T S    LGPNWERRVRASA PRSK+GF+VLVTGAAGFVG
Sbjct  61   FSPPTNSAAGNNRRSL--KNTVSPPAALGPNWERRVRASARPRSKTGFTVLVTGAAGFVG  118

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            SHVSLALKRRGDGVLGLDNFN+YY+VGLK+AR  LL RSG++I++GDINDAVLL+KL DA
Sbjct  119  SHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIVDGDINDAVLLKKLFDA  178

Query  610  VAFTHVMHLAA  642
            VAFTHVMH+AA
Sbjct  179  VAFTHVMHMAA  189



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 156/191 (82%), Gaps = 7/191 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSA---FYrlrlqprlflrlilWSfvfvfvillfff  255
            M Q K +L+H D++PSTPGKFKP+KS+    YRLR  P LF R  LWSF+F+  I+LFFF
Sbjct  1    MTQLKPILTHLDAIPSTPGKFKPDKSSPYSLYRLRFHPTLFPRFTLWSFLFICFIVLFFF  60

Query  256  iSPPASGAS--NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
             SPP S A+  NRR+L  K T S    LGPNWERRVRASA PRSK+GF+VLVTGAAGFVG
Sbjct  61   FSPPTSPAAGNNRRSL--KNTVSPPAALGPNWERRVRASARPRSKTGFTVLVTGAAGFVG  118

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            SHVSLALKRRGDGVLGLDNFN+YY+VGLK+AR  LL RSG++I++GDINDAVLL+KL DA
Sbjct  119  SHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIVDGDINDAVLLKKLFDA  178

Query  610  VAFTHVMHLAA  642
            V FTHVMH+AA
Sbjct  179  VPFTHVMHMAA  189



>ref|XP_006363737.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Solanum tuberosum]
Length=446

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 152/191 (80%), Gaps = 7/191 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSA---FYrlrlqprlflrlilWSfvfvfvillfff  255
            M Q K +L+H DS+PSTPGKFKP+KS+    YRLR  P LF R  LWSF F+F I+L  F
Sbjct  1    MTQLKPILTHLDSIPSTPGKFKPDKSSPYNLYRLRFHPTLFPRFTLWSFFFIFFIVLLIF  60

Query  256  iSPPA--SGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
             S P   +  ++RR+L  K + S +  LGPNWERRVRASA PRSK+GF+VLVTGAAGFVG
Sbjct  61   FSSPTNPTTGNSRRSL--KNSLSPSPPLGPNWERRVRASARPRSKTGFTVLVTGAAGFVG  118

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            +HVSL LKRRGDGVLGLDNFN YY+VGLK+AR+ LL RSG+ ++EGDINDAVLL+KL DA
Sbjct  119  THVSLGLKRRGDGVLGLDNFNQYYDVGLKKARQGLLERSGIMVVEGDINDAVLLRKLFDA  178

Query  610  VAFTHVMHLAA  642
            VAFTHVMH+AA
Sbjct  179  VAFTHVMHMAA  189



>ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum lycopersicum]
Length=445

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 153/191 (80%), Gaps = 7/191 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSA---FYrlrlqprlflrlilWSfvfvfvillfff  255
            M Q K +L H DS+PSTPGKFKP+KS+    YRLR  P LF R  LWSF F+F I+L  F
Sbjct  1    MTQLKPILMHLDSIPSTPGKFKPDKSSPYNLYRLRFHPTLFPRFTLWSFFFIFFIVLLIF  60

Query  256  iSPPA--SGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
             S P+  +  ++RR+L  K + S +  LGPNWERRVRASA PRSK+GF+VLVTGAAGFVG
Sbjct  61   FSSPSNPTAGNSRRSL--KNSLSPSPALGPNWERRVRASARPRSKTGFTVLVTGAAGFVG  118

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            +HVSL LKRRGDGVLGLDNFN YY+VGLK+AR+SLL RSG+ +++GDINDAVLL+KL DA
Sbjct  119  THVSLGLKRRGDGVLGLDNFNQYYDVGLKKARQSLLERSGIMVVKGDINDAVLLRKLFDA  178

Query  610  VAFTHVMHLAA  642
            VAFTHVMH+AA
Sbjct  179  VAFTHVMHMAA  189



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 146/200 (73%), Gaps = 16/200 (8%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEK-----SAFYrlrlqprlflrlilWSfvfvfvillf  249
            M Q K +LSH D++PSTPGK KP+K     S F+RLRL   L  R  LWSF+F+F+ILLF
Sbjct  1    MTQLKPILSHLDAIPSTPGKCKPDKTSPYHSTFHRLRLHSALLPRRTLWSFIFLFLILLF  60

Query  250  ffiSPPA--SGASN-------RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVL  402
             F+SPP+  S ASN       RR+L       V   LGPNWE R  ASA P SKSG SVL
Sbjct  61   LFLSPPSATSTASNASVNGGKRRSL--HTAAVVGPSLGPNWENRAWASARPASKSGLSVL  118

Query  403  VTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDA  582
            VTGA GFVG+HVSLALK+RGDGV+G+DNFN+YYE GLK+AR SLL +SG+ ++EGDINDA
Sbjct  119  VTGAVGFVGAHVSLALKKRGDGVVGVDNFNSYYETGLKKARNSLLEKSGIFVVEGDINDA  178

Query  583  VLLQKLLDAVAFTHVMHLAA  642
             LL+KL + V FTHVMHLAA
Sbjct  179  ALLRKLFETVKFTHVMHLAA  198



>ref|XP_011081125.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Sesamum indicum]
Length=439

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = +1

Query  85   MIQPKTVLSHFDSM-PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiS  261
            M Q K +LSH D + PS+ GKFK    A +RLR  PRL      WSF+F+F +LLFFF S
Sbjct  1    MTQLKPILSHLDPIIPSSTGKFKSSPYAVHRLRFHPRLTF----WSFLFLFFLLLFFFCS  56

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PPA+  + +R  +     S   + GPNWE + R SA P+SKSG +VLVTGAAGFVG+HV+
Sbjct  57   PPAASNAGKRRSLQNTAYSARARPGPNWEVKARNSARPQSKSGVTVLVTGAAGFVGTHVA  116

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            +ALK RGDGV+GLDNFNNYYE GLK+ARKSLL R GV+IIEGDINDA LL KL + V FT
Sbjct  117  MALKNRGDGVVGLDNFNNYYETGLKKARKSLLERRGVYIIEGDINDAALLGKLFEIVHFT  176

Query  622  HVMHLAA  642
            HVMHLAA
Sbjct  177  HVMHLAA  183



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D  PSTPGKFK +KS +Y          +L +WSF+F+ VI +FF+ SPP+S  S+
Sbjct  1    MSHLDHTPSTPGKFKMDKSPYYSRTRWHSSVAKLTIWSFLFIAVIFVFFYRSPPSSSNSD  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
                + ++  +     G  WE+RVR SA  RS++GFSVLVTGAAGFVG+HVS ALKRRGD
Sbjct  61   ----LSRRYLTSATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL + V FTHVMHLAA
Sbjct  117  GVLGLDNFNDYYDPTLKRARQALLERSGVFIVEGDINDVSLLKKLFEVVPFTHVMHLAA  175



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            +SH DS PSTPGKFK EK++++          +L +WSFVF+  IL+FF  SP   P   
Sbjct  7    MSHIDSAPSTPGKFKMEKASYFNRVRWHTSLAKLAVWSFVFLGAILIFFLRSPASSPVPA  66

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L         +  GP WE+RVRASA  RS++GF+VLVTGAAGFVG+HVS ALKR
Sbjct  67   DLSRRSL------RTYNWGGPVWEKRVRASAQIRSRNGFAVLVTGAAGFVGTHVSAALKR  120

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR+ LL RSGV+I+EGDIND  LL+KL + V FTHVMHL
Sbjct  121  RGDGVLGLDNFNDYYDPSLKRARQGLLERSGVYIVEGDINDEALLRKLFEVVPFTHVMHL  180

Query  637  AA  642
            AA
Sbjct  181  AA  182



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K   Y +          +L LW+ +F+ + L +  +SPP S  
Sbjct  1    MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPS--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RRNL D  + S     G +WE++VR SA PRS+ G +VLVTGA+GFVG+HVS+AL+RR
Sbjct  59   PSRRNLNDSSSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFVGTHVSIALRRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 133/182 (73%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            +SH D +PSTPGKFK +KS ++          +L  WS VF  +I +FF+ SP   P S 
Sbjct  4    MSHLDDIPSTPGKFKMDKSPYFHRTRWQSSVAKLAFWSLVFTGLIFIFFYRSPSSNPISS  63

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
            A +RR+L   +T S     GP+WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKR
Sbjct  64   APSRRSL---RTYSWG---GPDWEKRVRSSARVRTRNGISVLVTGAAGFVGTHVSAALKR  117

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKR R++LL RSGV I+EGDIND+ LL+K+ + V FTHVMHL
Sbjct  118  RGDGVLGLDNFNDYYDPSLKRTRQALLERSGVFIVEGDINDSALLKKIFEVVPFTHVMHL  177

Query  637  AA  642
            AA
Sbjct  178  AA  179



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K   Y +          +L LW+ +F+ + L +  +SPP S  
Sbjct  1    MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPS--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RRNL D  + S     G +WE++VR SA PRS  G +VLVTGA+GFVG+HVS+AL+RR
Sbjct  59   PSRRNLNDSSSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K   Y +          +L LW+ +F+ + L +  +SPP S  
Sbjct  1    MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPS--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RRNL D  + S     G +WE++VR SA PRS  G +VLVTGA+GFVG+HVS+AL+RR
Sbjct  59   PSRRNLNDSSSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALQRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 9/183 (5%)
 Frame = +1

Query  106  LSHFD-SMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PAS  273
            +SH D S PSTPGKFK EK++++          +L LWSFVF   IL+FFF SP   P  
Sbjct  7    MSHADNSAPSTPGKFKMEKASYFNRVRWHASPAKLCLWSFVFSAAILIFFFRSPASSPLP  66

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L     RS ++  GP WE+RVR+SA  RS++GFSVLVTGAAGFVG+HVS ALK
Sbjct  67   ADPSRRSL-----RSPSNWGGPVWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSAALK  121

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLG+DNFN+YY+  LKRAR++LL R+GV I+EGDINDA LL+KL + V FTHVMH
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGVFIVEGDINDAALLRKLFEVVPFTHVMH  181

Query  634  LAA  642
            LAA
Sbjct  182  LAA  184



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 129/181 (71%), Gaps = 5/181 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K   Y +          +L LW+ +F+ + L +  +SPP S  
Sbjct  1    MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPS--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RRNL D    S     G +WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RR
Sbjct  59   PSRRNLYDSSV-SAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLA  177

Query  640  A  642
            A
Sbjct  178  A  178



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K+  Y +          +  LW+ +F+ + L +  +SPP +  
Sbjct  1    MSHLDDLPSTPGKYKTDKALPYGILHHHRYLRLSKPTLWASLFLALFLFYLLLSPPPT--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RR+L D    S     G  WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RR
Sbjct  59   PSRRSLNDSSLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 133/182 (73%), Gaps = 7/182 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            +SH D +PSTPGKFK +KS ++          +L  WS VFV +I +FF+ SP   P S 
Sbjct  4    MSHLDDIPSTPGKFKMDKSPYFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPSSNPVSS  63

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L   +T + T   GP WE+RVR+SA  R++ G SVLVTGAAGFVG+HVS ALKR
Sbjct  64   DPSRRSL---RTYAYT-WGGPAWEKRVRSSARVRTRHGISVLVTGAAGFVGTHVSAALKR  119

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR++LL RSGV +++GDINDA LL+KL + V FTHVMHL
Sbjct  120  RGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVQGDINDAALLKKLFEVVPFTHVMHL  179

Query  637  AA  642
            AA
Sbjct  180  AA  181



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            +SH DS PSTPGKFK EK++++          +L +WSFVF+  IL+FFF SP   P   
Sbjct  1    MSHIDSAPSTPGKFKMEKASYFNRVRWHTSLAKLAVWSFVFLGAILIFFFRSPASSPVPA  60

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L         +  GP WE+RVRASA  RS++GF+VLVTGAAGFVG+HVS ALKR
Sbjct  61   DLSRRSL------RTYNWGGPVWEKRVRASARVRSRNGFAVLVTGAAGFVGTHVSAALKR  114

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLG+DNFN YY+  LKRAR+ LL R+GV+I+EGDIND  LL+KL + V FTHVMHL
Sbjct  115  RGDGVLGIDNFNEYYDPSLKRARQLLLERTGVYIVEGDINDEALLRKLFEVVPFTHVMHL  174

Query  637  AA  642
            AA
Sbjct  175  AA  176



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 129/182 (71%), Gaps = 5/182 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq---prlflrlilWSfvfvfvillfffiSPPASG  276
            +SH D +P TPGK+K +K   Y + L         +L LW+ +F+ + L +  +SPP S 
Sbjct  1    MSHLDDLPPTPGKYKTDKVPPYWMILHHHRYLRLSKLTLWASLFLALFLFYLILSPPPS-  59

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RRNL D  + S     G +WE++VR SA PRS  G +VLVTGA+GFVG+HVS+AL+R
Sbjct  60   -PSRRNLNDSSSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRR  118

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHL
Sbjct  119  RGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHL  178

Query  637  AA  642
            AA
Sbjct  179  AA  180



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 131/182 (72%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            +SH DS P TPGKFK +K++++          +L +WSFVF+  IL+FF  SP   P   
Sbjct  7    MSHIDSAPPTPGKFKMDKASYFNRVRWHTSLAKLAVWSFVFLGAILIFFLRSPASSPVPA  66

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L         +  GP WE+RVRASA  RS++GF+VLVTGAAGFVG+HVS ALKR
Sbjct  67   DLSRRSL------RTYNWGGPVWEKRVRASAQVRSRNGFAVLVTGAAGFVGTHVSAALKR  120

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR+ LL R+GV+I+EGDIND  LL+KL + V FTHVMHL
Sbjct  121  RGDGVLGLDNFNDYYDPSLKRARQGLLERNGVYIVEGDINDEALLRKLFEVVPFTHVMHL  180

Query  637  AA  642
            AA
Sbjct  181  AA  182



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PASG  276
            + H D +PSTPGKFK +KS ++          +L  WS VFV +I +FF+ SP   P S 
Sbjct  1    MKHLDDIPSTPGKFKMDKSPYFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPSSNPVSS  60

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L   +T S     GP WE+RVR+SA  R++ G SVLVTGAAGFVG+HVS ALKR
Sbjct  61   DPSRRSL---RTYSWG---GPAWEKRVRSSARVRTRHGVSVLVTGAAGFVGTHVSAALKR  114

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHL
Sbjct  115  RGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHL  174

Query  637  AA  642
            AA
Sbjct  175  AA  176



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 9/183 (5%)
 Frame = +1

Query  103  VLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS  282
            V+SH D++PSTPGKFK +KS +           +L  WS V +  IL+FFF SP +S   
Sbjct  6    VMSHLDNIPSTPGKFKMDKSPYIHRLRWHSSLTKLTFWSLVILGSILIFFFRSPSSSPLP  65

Query  283  ---NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L      S  D  GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS+ALK
Sbjct  66   SDHSRRSL------STYDWGGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALK  119

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFNNYY+  LKRAR++LL R+GV ++EGDIND+ LL+KL + V FTHVMH
Sbjct  120  RRGDGVLGLDNFNNYYDQSLKRARQALLERTGVFVVEGDINDSALLKKLFEVVPFTHVMH  179

Query  634  LAA  642
            LAA
Sbjct  180  LAA  182



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 133/184 (72%), Gaps = 10/184 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq---prlflrlilWSfvfvfvillfffiSPPASG  276
            +SH D +PSTPGKFK EKS F   R++        +L  WS VF  +IL+FFF SP    
Sbjct  1    MSHLDDIPSTPGKFKMEKSPFIHSRMRWHWQSSLAKLTFWSIVFFCLILIFFFRSP----  56

Query  277  ASNRRNLIDKQTRSV--TDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLAL  450
             S+   L D   RS+   +  GP WE+RVR+SA  RS++GFSVLVTGAAGFVG+HVS AL
Sbjct  57   -SSNPLLQDPYRRSLRTYNWGGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSAL  115

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            K+RGDGVLGLDNFN+YY+  LKRAR+ LL RSGV I+EGDIND+ LL KL + VAFTHVM
Sbjct  116  KKRGDGVLGLDNFNDYYDPSLKRARQELLERSGVFIVEGDINDSALLMKLFEVVAFTHVM  175

Query  631  HLAA  642
            HLAA
Sbjct  176  HLAA  179



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 134/181 (74%), Gaps = 6/181 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK +KS ++          +L  WSF+F+ VIL+FFF SP    +SN
Sbjct  7    MSHLDNIPSTPGKFKMDKSPYFNRLRFHSSLAKLTFWSFIFLAVILIFFFRSP----SSN  62

Query  286  RRNLIDKQTRSV--TDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
                 D   RS+   D  GP +E+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  63   PLPSADPSRRSLRTYDWGGPAFEKRVRSSARVRARNGISVLVTGAAGFVGTHVSAALKRR  122

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LK+AR++LL RSG+ I+EGDIND  LL+KL D V+FTHVMHLA
Sbjct  123  GDGVLGLDNFNDYYDPSLKKARQALLERSGIFIVEGDINDMALLKKLFDVVSFTHVMHLA  182

Query  640  A  642
            A
Sbjct  183  A  183



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 131/185 (71%), Gaps = 13/185 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAF-YrlrlqprlflrlilWSfvfvfvillfffiSP-----P  267
            +SH D +PSTPGKFK +KS++ Y          +L  WS VFV VI LFF+ SP     P
Sbjct  1    MSHLDHIPSTPGKFKMDKSSYPYSRVRWHSSLAKLTFWSLVFVGVIFLFFYRSPSSSTNP  60

Query  268  ASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLA  447
                 +RR+L        T   G +WE+RVR+SA  RS++GFSVLVTGAAGFVG+HVS A
Sbjct  61   LPSDPSRRSL-------RTSWGGSDWEKRVRSSARIRSRNGFSVLVTGAAGFVGTHVSAA  113

Query  448  LKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHV  627
            LKRRGDGVLGLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL + V FTHV
Sbjct  114  LKRRGDGVLGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDVALLKKLFEVVPFTHV  173

Query  628  MHLAA  642
            MHLAA
Sbjct  174  MHLAA  178



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 5/181 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K+  Y +          +  LW+ +F+ + L +  +SPP +  
Sbjct  1    MSHLDDLPSTPGKYKTDKALPYGILHHHRYLRLSKPTLWASLFLALFLFYLLLSPPPT--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RR+L D  + S     G  WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RR
Sbjct  59   PSRRSLND-SSLSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFDVVLFTHVMHLA  177

Query  640  A  642
            A
Sbjct  178  A  178



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK +KS +           +L  WS V +  IL+FFF SP +S   +
Sbjct  1    MSHLDNIPSTPGKFKMDKSPYIHRLRWHSSLTKLTFWSLVILGSILIFFFRSPSSSPLPS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +   +++ S  D  GP+WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS+ALKRRGD
Sbjct  61   DHS---RRSLSTYDWGGPSWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALKRRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFNNYY+  LKRAR++LL R+GV ++EGDIND+ LL+KL + V FTHVMHLAA
Sbjct  118  GVLGLDNFNNYYDQSLKRARQALLERTGVFVVEGDINDSALLKKLFEVVPFTHVMHLAA  176



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = +1

Query  106  LSHFD-SMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP---PAS  273
            +SH D S PSTPGKFK EK++++          +LILWSFVF   IL+FFF SP   P  
Sbjct  7    MSHADNSAPSTPGKFKMEKASYFNRVRWHASPAKLILWSFVFSAAILIFFFRSPATSPLP  66

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L     RS ++  GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS ALK
Sbjct  67   ADPSRRSL-----RSPSNWGGPIWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALK  121

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLG+DNFN+YY+  LKRAR++LL R+G+ I+EGDIND  LL+KL + V FTHVMH
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGIFIVEGDINDGALLRKLFEVVPFTHVMH  181

Query  634  LAA  642
            LAA
Sbjct  182  LAA  184



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 5/181 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K+  Y +          +  LW+ +F+ + L +  +SPP +  
Sbjct  1    MSHLDDLPSTPGKYKTDKALPYGILHHHRYLRLSKPTLWASLFLALFLFYLLLSPPPT--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RR+L D    S     G  WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RR
Sbjct  59   PSRRSLNDSSLSSA-KYGGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLA  177

Query  640  A  642
            A
Sbjct  178  A  178



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 128/181 (71%), Gaps = 12/181 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP +S    
Sbjct  4    MSHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPVSS----  55

Query  286  RRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
              N  D   RS+      GP WE+RVR+SA  R++ GFSVLVTGAAGFVG+HVS ALKRR
Sbjct  56   --NPADPSRRSLRTYSWGGPAWEKRVRSSARLRTRRGFSVLVTGAAGFVGTHVSAALKRR  113

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHLA
Sbjct  114  GDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLA  173

Query  640  A  642
            A
Sbjct  174  A  174



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 132/183 (72%), Gaps = 10/183 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAF-YrlrlqprlflrlilWSfvfvfvillfffiSP---PAS  273
            +SH D +PSTPGKFK EKS F +          +L  WSF+F+ +IL+FFF SP   P  
Sbjct  5    MSHLDDIPSTPGKFKMEKSPFVHNRLRWHSSLAKLTFWSFIFLGLILIFFFRSPSSNPLP  64

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L         +  GP WE+RVR+SA  RS +G SVLVTGAAGFVG+HVS ALK
Sbjct  65   QDPSRRSL------RTYNWGGPAWEKRVRSSARVRSHNGISVLVTGAAGFVGTHVSAALK  118

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFN+YY+  LKRAR++LL RSGV I+EGDIND+ LL+KL + VAFTHVMH
Sbjct  119  RRGDGVLGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDSALLRKLFEVVAFTHVMH  178

Query  634  LAA  642
            LAA
Sbjct  179  LAA  181



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +SH D++PSTPGKFK +KS +           +L  WS V +  IL+FFF SP +S    
Sbjct  1    MSHLDNIPSTPGKFKMDKSPYIHRLRWHSSLTKLTFWSLVILGSILIFFFRSPSSSPLPS  60

Query  283  --NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
              +RR+L      S  D  GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS+ALKR
Sbjct  61   DHSRRSL------STYDWGGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSVALKR  114

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFNNYY+  LKRAR++LL R+GV ++EGDIND+ LL+KL + V FTHVMHL
Sbjct  115  RGDGVLGLDNFNNYYDQSLKRARQALLERTGVFVVEGDINDSALLKKLFEVVPFTHVMHL  174

Query  637  AA  642
            AA
Sbjct  175  AA  176



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 131/180 (73%), Gaps = 11/180 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +SH D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP +S    
Sbjct  4    MSHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPVSSNPDP  59

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +RR+L   +T S     GP WE+RVR+SA  R++ GFSVLVTGAAGFVG+HVS ALKRRG
Sbjct  60   SRRSL---RTYSWG---GPAWEKRVRSSARVRTRRGFSVLVTGAAGFVGTHVSAALKRRG  113

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHLAA
Sbjct  114  DGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAA  173



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 134/183 (73%), Gaps = 10/183 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAF-YrlrlqprlflrlilWSfvfvfvillfffiSP---PAS  273
            +SH D++PSTPGKFK EKS + +          +L  WSF+F+ +IL+FFF SP   P  
Sbjct  5    MSHLDNIPSTPGKFKMEKSPYVHNRLRWHSSLAKLTFWSFIFLGLILIFFFRSPSSNPLP  64

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L         +  GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS ALK
Sbjct  65   QDPSRRSL------RTYNWGGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSAALK  118

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFN+YY+  LKRAR++LL R+GV I+EGDIND+ LL+KL + VAFTHVMH
Sbjct  119  RRGDGVLGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSALLRKLFEVVAFTHVMH  178

Query  634  LAA  642
            LAA
Sbjct  179  LAA  181



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 131/180 (73%), Gaps = 6/180 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D+ PSTPGKFK EKSA Y          +L  WSFVF+ +I +FFF     S +S+
Sbjct  4    MKHIDNTPSTPGKFKMEKSA-YNRLRLHSSLAKLTFWSFVFLGLIFVFFF----RSPSSS  58

Query  286  RRNLIDKQTRSVTDQLG-PNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
                 D   RS+    G PN+E+RVRASA  RS++G SVLVTGAAGFVGSHVS ALKRRG
Sbjct  59   SHVPSDLSRRSLRSSYGGPNFEKRVRASAKIRSRNGISVLVTGAAGFVGSHVSAALKRRG  118

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLG+DNFNNYY+  LKRAR++LL RSGV+I+EGDIND+ LL+KL D V FTHVMHLAA
Sbjct  119  DGVLGIDNFNNYYDPSLKRARQALLERSGVYIVEGDINDSALLKKLFDIVPFTHVMHLAA  178



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 129/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq---prlflrlilWSfvfvfvillfffiSPPASG  276
            +SH D +P TPGK+K +K   Y + L         +L LW+ +F+ + L +  +SPP S 
Sbjct  1    MSHLDDLPPTPGKYKTDKVPPYWMILHHHRYLRLSKLTLWASLFLALFLFYLILSPPPS-  59

Query  277  ASNRRNLIDKQTR-SVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
              +RRNL D  +  S     G +WE++VR SA PRS  G +VLVTGA+GFVG+HVS+AL+
Sbjct  60   -PSRRNLNDSSSSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALR  118

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMH
Sbjct  119  RRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMH  178

Query  634  LAA  642
            LAA
Sbjct  179  LAA  181



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 128/182 (70%), Gaps = 5/182 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFY--rlrlqprlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +P TPGK+K +K   Y      +     +L LW+ +F+ + L +  +SPP S  
Sbjct  1    MSHLDDLPPTPGKYKTDKVPPYWILHHHRYLRLSKLTLWASLFLALFLFYLILSPPPS--  58

Query  280  SNRRNLIDKQTR-SVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
             +RRNL D  +  S     G +WE++VR SA PR+  G +VLVTGA+GFVG+HVS+AL+R
Sbjct  59   PSRRNLNDSSSSVSAAKYGGSHWEKQVRKSARPRTHGGLTVLVTGASGFVGTHVSIALRR  118

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHL
Sbjct  119  RGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFDVVLFTHVMHL  178

Query  637  AA  642
            AA
Sbjct  179  AA  180



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D  PSTPGKFK +KS +Y          +L LWS +FV +I LFF+ SP +S  + 
Sbjct  1    MSHLDHTPSTPGKFKIDKSPYYSRTRWHSSVAKLTLWSSLFVALIFLFFYRSPSSSSNNP  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +   ++  +  +  G  WE+RVR SA  RS++GFSVLVTGAAGFVG+HVS ALKRRGD
Sbjct  61   PSSDPSRRYLASANWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLG+DNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL D V FTHVMHLAA
Sbjct  121  GVLGIDNFNDYYDPTLKRARQALLERSGVFIVEGDINDVALLKKLFDIVPFTHVMHLAA  179



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D +PSTPGKFK +KS  Y          +L  WSF+F+ +I +FFF SP +S    
Sbjct  4    ISHLDDIPSTPGKFKMDKSP-YNRLRWHSSLAKLTFWSFIFLALIFIFFFRSPSSSAP--  60

Query  286  RRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             ++L D   R + +    G  WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  61   -QSLSDPSRRYLQNYSWGGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRR  119

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKRAR++LL R+GV I+EGDIND  LL+KL + VAFTHVMHLA
Sbjct  120  GDGVLGLDNFNDYYDPSLKRARQALLERAGVFIVEGDINDEALLRKLFEVVAFTHVMHLA  179

Query  640  A  642
            A
Sbjct  180  A  180



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGK+K +K+  Y +          +  LW+ +F+ + L +  +SPP +  
Sbjct  1    MSHLDDLPSTPGKYKTDKALPYGILHHHRYLRLSKPTLWASLFLALFLFYLLLSPPPT--  58

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             +RR+L D  + S     G  WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RR
Sbjct  59   PSRRSLNDSSSLSSAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLA
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 130/180 (72%), Gaps = 7/180 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGAS  282
            + H D  PSTPGKFK +KS ++  R +      +L  WS VFV  I +FF+ SP +    
Sbjct  1    MKHLDETPSTPGKFKMDKSPYFLHRTRWQSSVAKLAFWSLVFVGFIFIFFYRSPSSLPDP  60

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +RR+L   +T S     GP WE+RVR+SA  R++ G SVLVTGAAGFVG+HVS ALKRRG
Sbjct  61   SRRSL---RTYSWG---GPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRG  114

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHLAA
Sbjct  115  DGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAA  174



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 130/180 (72%), Gaps = 7/180 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGAS  282
            + H D  PSTPGKFK +KS ++  R +      +L  WS VFV  I +FF+ SP +    
Sbjct  1    MKHLDETPSTPGKFKMDKSPYFLHRTRWQSSVAKLAFWSLVFVGFIFIFFYRSPSSLPDP  60

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +RR+L   +T S     GP WE+RVR+SA  R++ G SVLVTGAAGFVG+HVS ALKRRG
Sbjct  61   SRRSL---RTYSWG---GPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRG  114

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHLAA
Sbjct  115  DGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAA  174



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I +FFF SP +S   +
Sbjct  4    MKHIDNIPSTPGKFKMEKSP-YNRLRLHSSLAKLTFWSFVFLGLIFVFFFRSPSSSSPES  62

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
                  +++   +   GP+WE+R++ASA  RS++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  63   LTADPSRRSLRTSSYGGPDWEKRIKASAKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGD  122

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL RSGV+I+EGDIND  LL+KL D V FTHVMHLAA
Sbjct  123  GVLGLDNFNDYYDQSLKRARQALLERSGVYIVEGDINDVALLKKLFDIVQFTHVMHLAA  181



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 5/186 (3%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP  264
            M Q K V SH DS+PSTPGKFK +KS +           +L  WSF+F+ +IL FF  SP
Sbjct  1    MSQLKPV-SHLDSIPSTPGKFKMDKSPYIHRLRWHSSLTKLTFWSFLFLGLILFFFLRSP  59

Query  265  PASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSL  444
             +   S+      +     ++  GP+WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS 
Sbjct  60   SSPSPSDPSRRSLR----TSNWGGPSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSA  115

Query  445  ALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTH  624
            ALKRRGDGVLGLDNFN+YY+  LKRAR++LL R+GV ++EGDIND+ LL+KL D VAFTH
Sbjct  116  ALKRRGDGVLGLDNFNDYYDPSLKRARQALLERTGVFVVEGDINDSALLRKLFDVVAFTH  175

Query  625  VMHLAA  642
            VMHLAA
Sbjct  176  VMHLAA  181



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 127/179 (71%), Gaps = 7/179 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D +PSTPGK+K           +     +L LW+ +F+ + L +  +SPPAS   +
Sbjct  1    MSHLDDLPSTPGKYKVVPYGV-LHNHRYLRLSKLTLWASLFLALFLFYLVLSPPAS--PS  57

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            RR+L D   +      G +WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RRGD
Sbjct  58   RRSLNDSSVK----YGGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGD  113

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN YY+  LKRAR+ LL RSGV ++EGD+NDAVLL+KL D V FTHVMHLAA
Sbjct  114  GVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLFTHVMHLAA  172



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H DS PSTPGKFK EK+++   +       +L  WS VF+ +I +FFF SP +S AS 
Sbjct  1    MKHIDSAPSTPGKFKMEKASY---KRLHSSLAKLTFWSLVFLGLIFVFFFRSPASSSASV  57

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRS-KSGFSVLVTGAAGFVGSHVSLALKRRG  462
            + +L  +  R+ T   GP +ER+VR SA  RS + G SVLVTGAAGFVG+HVSLALKRRG
Sbjct  58   QSDLSRRSLRT-TFYGGPEFERKVRGSAKVRSGRRGMSVLVTGAAGFVGTHVSLALKRRG  116

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLD+FN+YY+  LKRAR++LL R GV ++EGDIND  LL KL D VAFTHVMHLAA
Sbjct  117  DGVVGLDSFNDYYDPSLKRARQALLERGGVFVVEGDINDGALLNKLFDVVAFTHVMHLAA  176



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 134/181 (74%), Gaps = 8/181 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKP-EKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D +PSTPGKFK  +KS F+  R +      +L  WS VF  ++ +FF+ SP ++  
Sbjct  1    MSHLDDIPSTPGKFKMMDKSPFFLHRTRWQSSVAKLAFWSLVFFGLLFIFFYRSPISNPD  60

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
            S+RR+L   +T S     GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  61   SSRRSL---RTYSWG---GPAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRR  114

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKR+R++LL RSGV I+EGDIND  LL+KL + V FTHVMHLA
Sbjct  115  GDGVLGLDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDLSLLKKLFEVVPFTHVMHLA  174

Query  640  A  642
            A
Sbjct  175  A  175



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 8/181 (4%)
 Frame = +1

Query  106  LSHFDS-MPSTPGKFKPEKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGA  279
            +SH D  +PSTPGKFK +KS ++  R +      +L  WS VF  ++ +FF+ SP ++  
Sbjct  1    MSHLDDDIPSTPGKFKMDKSPYFLHRTRWQSSVAKLAFWSLVFFGLLFIFFYRSPISNPD  60

Query  280  SNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
            S+RR+L   +T S     GP+WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  61   SSRRSL---RTYSWG---GPHWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRR  114

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKR+R++LL RSGV I+EGDIND  LL+KL + V FTHVMHLA
Sbjct  115  GDGVLGLDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDLSLLKKLFEVVPFTHVMHLA  174

Query  640  A  642
            A
Sbjct  175  A  175



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D  PSTPGKFK +KS +Y          +L LWS +FV  + LFF+ SP +S  + 
Sbjct  1    MSHLDHTPSTPGKFKIDKSPYYSRTRWHSSVAKLTLWSSLFVTFLFLFFYRSPSSSSNNP  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +   ++  +     G  WE+RVR SA  RS++GFSVLVTGAAGFVG+HVS ALKRRGD
Sbjct  61   PSSDPSRRYLASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLG+DNFN+YY+  LKRAR++LL R GV I+EGDIND  LL+KL D V FTHVMHLAA
Sbjct  121  GVLGIDNFNDYYDPTLKRARQALLERGGVFIVEGDINDVALLKKLFDIVPFTHVMHLAA  179



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 129/180 (72%), Gaps = 11/180 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            + H D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP +S    
Sbjct  1    MKHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPVSSNPDP  56

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +RR+L   +T S     GP WE+RVR+SA  R + GFSVLVTGAAGFVG+HVS ALKRRG
Sbjct  57   SRRSL---RTYSWG---GPAWEKRVRSSARLRFRRGFSVLVTGAAGFVGTHVSSALKRRG  110

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHLAA
Sbjct  111  DGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAA  170



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I +FF+ S   + +S 
Sbjct  4    MKHIDNIPSTPGKFKMEKSP-YNRLRVHFSLAKLTFWSFVFLGLIFVFFYRS--PASSSP  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              + + +++   +   GP WE+R++ASA  RS++G SVLVTGAAGFVG+HVS+ALKRRGD
Sbjct  61   VSSDLSRRSLRTSSYGGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL R+GV+I+EGDINDA LL+KL D V FTHVMHLAA
Sbjct  121  GVLGLDNFNDYYDPSLKRARQALLERTGVYIVEGDINDATLLKKLFDIVPFTHVMHLAA  179



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 130/181 (72%), Gaps = 7/181 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D+ PSTPGKFK EKS  Y          +L  WS VF+ +I +FF+ SP +S ++ 
Sbjct  1    MKHIDTTPSTPGKFKIEKSP-YNRLRLHSSLAKLTFWSLVFLGLIFVFFYRSPSSSSSAP  59

Query  286  RRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
                 D   RS+      GPN+ERRVRASA  RS++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  60   S----DLSRRSLRTSYYGGPNFERRVRASAKIRSRNGISVLVTGAAGFVGTHVSAALKRR  115

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKRAR++LL RSGV+I+EGDIND  LL+KL D V FTHVMHLA
Sbjct  116  GDGVLGLDNFNDYYDPSLKRARQALLERSGVYIVEGDINDVSLLKKLFDIVPFTHVMHLA  175

Query  640  A  642
            A
Sbjct  176  A  176



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 129/180 (72%), Gaps = 4/180 (2%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRR  291
            H DS PSTPGKFK EKS  Y          +L  WS  F+ +I  FFF SP  S +S+  
Sbjct  4    HIDSAPSTPGKFKMEKSP-YNRLRLHSSLAKLTFWSLFFLVLIYFFFFKSPSPSSSSSSS  62

Query  292  NLIDKQTRS---VTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +L    +R     +   GPN+E+RVRASA  RS++G SVLVTGAAGFVG+HVS ALKRRG
Sbjct  63   SLPSDLSRRSLRTSSYAGPNFEKRVRASAKIRSRTGISVLVTGAAGFVGTHVSAALKRRG  122

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFN+YY+  LKRAR++LL RSGV+I+EGDINDAVL+ KL D V FTHVMHLAA
Sbjct  123  DGVVGLDNFNDYYDPSLKRARQALLERSGVYIVEGDINDAVLVSKLFDIVPFTHVMHLAA  182



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 132/188 (70%), Gaps = 8/188 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP  264
            M Q K  +SH D+ P TPGKFK +KS +           +L  WSFVF+ +IL+FFF SP
Sbjct  1    MTQLKQ-MSHLDNSPPTPGKFKMDKSPYIHRLRLHGSLAKLTFWSFVFLGLILIFFFRSP  59

Query  265  PASGASNRRNLIDKQTRSV--TDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHV  438
             ++   +     D   RS+   +  GP WE+RVR+SA  RS+ G SVLVTGAAGFVG+HV
Sbjct  60   SSNSLPS-----DPXRRSLRTYNWGGPAWEKRVRSSAKVRSRHGISVLVTGAAGFVGTHV  114

Query  439  SLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAF  618
            S ALKRRGDGVLGLD FN+YY+  LKRAR++LL RSGV I+EGDINDA LL KL + VAF
Sbjct  115  SAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSGVFIVEGDINDAPLLSKLFEVVAF  174

Query  619  THVMHLAA  642
            THVMHLAA
Sbjct  175  THVMHLAA  182



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I +FF+ S   + +S 
Sbjct  4    MMHIDNIPSTPGKFKMEKSP-YNRLRMHFSLAKLTFWSFVFLGLIFVFFYRS--PASSSP  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              + + +++   +   GP WE+R++ASA  RS++G SVLVTGAAGFVG+HVS+ALKRRGD
Sbjct  61   VSSDLSRRSLRTSSYGGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL R+GV+++EGDINDA LL+KL D V FTHVMHLAA
Sbjct  121  GVLGLDNFNDYYDPSLKRARQALLERTGVYVVEGDINDATLLKKLFDIVPFTHVMHLAA  179



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 131/180 (73%), Gaps = 4/180 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGAS  282
            +SH D  PSTPGKFK +KS ++  R +      +L  WS VFV +I +FF+ SP ++  S
Sbjct  4    MSHLDDTPSTPGKFKMDKSPYFLHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPISNPVS  63

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +  +    +  S     GP+WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRRG
Sbjct  64   SDSSRRSLRNYSWG---GPDWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRG  120

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN+YY+  LKR+R++LL RSGV I+EGDIND  LL+KL + V FTHVMHLAA
Sbjct  121  DGVLGLDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDMTLLKKLFEVVPFTHVMHLAA  180



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 132/189 (70%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP  264
            M Q K  +SH D  P TPGKFK +KS +           +L  WSFVF+ +IL+FFF SP
Sbjct  1    MTQLKQ-MSHLDISPPTPGKFKMDKSPYIHRLRGHGSLAKLTFWSFVFLGLILIFFFHSP  59

Query  265  -PASGASN--RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSH  435
             P S  S+  RR+L         +  GP WE+RVR+SA  RS+ G SVLVTGAAGFVG+H
Sbjct  60   SPNSLPSDPSRRSL------RTYNWGGPAWEKRVRSSAKVRSRHGISVLVTGAAGFVGTH  113

Query  436  VSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVA  615
            VS ALKRRGDGVLGLD FN+YY+  LKRAR++LL RSGV I+EGDINDA LL KL + VA
Sbjct  114  VSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSGVFIVEGDINDAPLLSKLFEVVA  173

Query  616  FTHVMHLAA  642
            FTHVMHLAA
Sbjct  174  FTHVMHLAA  182



>gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata]
Length=437

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 133/188 (71%), Gaps = 9/188 (5%)
 Frame = +1

Query  85   MIQPKTVLSHFDSM-PSTPGKFK-PEKSAFYrlrlqprlflrlilWSfvfvfvillfffi  258
            M Q K +LSH D + PS+ GKFK P   AF+RLR  PRL L    WSF+F+F +LLF   
Sbjct  1    MTQLKPILSHLDPIIPSSTGKFKSPPPYAFHRLRFHPRLTL----WSFLFLFFLLLFVIC  56

Query  259  SPPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHV  438
            SPPA+    +R  +     S   +L  NWE + R SA P SKSG +VLVTGAAGFVGSH 
Sbjct  57   SPPAASPGGKRRSLQTTGHS---RLPANWEAKARNSARPVSKSGLTVLVTGAAGFVGSHA  113

Query  439  SLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAF  618
            +LALK RGDGV+GLDNFN YYE GLK+ARK+LL R GV+II+ DINDAVLL KL + V F
Sbjct  114  ALALKNRGDGVVGLDNFNTYYETGLKKARKTLLDRQGVYIIDADINDAVLLGKLFEIVRF  173

Query  619  THVMHLAA  642
            +HVMHLAA
Sbjct  174  SHVMHLAA  181



>ref|XP_003635629.2| PREDICTED: UDP-glucuronate 4-epimerase 3-like, partial [Vitis 
vinifera]
Length=391

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP--PASGASN  285
            H D++PSTPGKFK +K  +           +LILWS  F  VI  FF +SP  P S  ++
Sbjct  4    HMDNIPSTPGKFKSDKYHYIHRFRSHSSLAKLILWSLFFFSVICFFFLLSPTSPTSPPAD  63

Query  286  R-RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            R R ++   T       GP WE++VR SA  RS  G +VLVTG AGFVGSHVS ALKRRG
Sbjct  64   RSRRVLANYTWG-----GPEWEKKVRQSARVRSDHGHTVLVTGGAGFVGSHVSAALKRRG  118

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFNNYY+  LKR R+ LL R+GV ++EGDIND+ LL+KL D VAFTHVMHLAA
Sbjct  119  DGVIGLDNFNNYYDPELKRHRRDLLERAGVFVVEGDINDSELLRKLFDVVAFTHVMHLAA  178



>emb|CAN60968.1| hypothetical protein VITISV_008097 [Vitis vinifera]
Length=435

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP--PASGASN  285
            H D++PSTPGKFK +K  +           +LILWS  F  VI  FF +SP  P S  ++
Sbjct  4    HMDNIPSTPGKFKSDKYHYIHRFRSHSSLAKLILWSLFFFSVICFFFLLSPTSPTSSPAD  63

Query  286  R-RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            R R ++   T       GP WE++VR SA  RS  G +VLVTG AGFVGSHVS ALKRRG
Sbjct  64   RSRRVLANYTWG-----GPEWEKKVRQSARVRSDHGHTVLVTGGAGFVGSHVSAALKRRG  118

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFNNYY+  LKR R+ LL R+GV ++EGDIND+ LL+KL D VAFTHVMHLAA
Sbjct  119  DGVIGLDNFNNYYDPELKRHRRDLLERAGVFVVEGDINDSELLRKLFDVVAFTHVMHLAA  178



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 7/181 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            L H D+ P TPGKFK +KS +           +L  WSF+F+ +IL+FFF SP ++   +
Sbjct  4    LKHLDNSPPTPGKFKMDKSPYIHRLRWHGSLAKLTFWSFIFLGLILIFFFRSPSSNSLPS  63

Query  286  RRNLIDKQTRSV--TDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
                 D   RS+   +  GP WE+RVR+SA  RS+ G SVLVTGAAGFVG+HVS ALKRR
Sbjct  64   -----DPSRRSLRTYNWGGPAWEKRVRSSARVRSRHGMSVLVTGAAGFVGTHVSAALKRR  118

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLD FN+YY+  LKRAR++LL RSGV I+EGDIND+ LL KL + VAFTHVMHLA
Sbjct  119  GDGVLGLDCFNDYYDPSLKRARQALLERSGVFIVEGDINDSALLSKLFEVVAFTHVMHLA  178

Query  640  A  642
            A
Sbjct  179  A  179



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 7/181 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            ++H D+ PSTPGKFK +KS +           +L  WSFVF+ +IL+FFF SP ++   +
Sbjct  1    MTHLDNSPSTPGKFKMDKSPYIHRLRWHGSLAKLTFWSFVFLGMILIFFFRSPSSNSLPS  60

Query  286  RRNLIDKQTRSV--TDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
                 D   RS+   +  GP WE+ VR+SA  RS+ G SVLVTGAAGFVG+HVS ALKRR
Sbjct  61   -----DPSRRSLRTYNWGGPAWEKXVRSSARVRSRHGISVLVTGAAGFVGTHVSAALKRR  115

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLD FN+YY+  LKRAR++LL RSGV I+EGDIND  LL KL + VAFTHVMHLA
Sbjct  116  GDGVLGLDCFNDYYDPSLKRARQALLERSGVFIVEGDINDVTLLSKLFEVVAFTHVMHLA  175

Query  640  A  642
            A
Sbjct  176  A  176



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D+ PSTPGKFK EKS  Y          ++I WS VFV +I +FF+ SP +S +  
Sbjct  4    MKHIDNTPSTPGKFKIEKSP-YHRLRLQFSLAKIIFWSLVFVGLIFVFFYRSP-SSSSHV  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +L  +  R+ +   GP WE++++AS  PRS +G  VLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   SSDLFRRSLRT-SSYGGPAWEKKIKASTKPRSSNGLCVLVTGAAGFVGTHVSAALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR+ LL RSGV+I+E DINDA LL+KL + VAFTHVMHLAA
Sbjct  121  GVLGLDNFNDYYDPSLKRARQELLERSGVYIVEADINDATLLKKLFEIVAFTHVMHLAA  179



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGK+K EK+  Y +  Q R      L  +  +F++L  F++      +S+
Sbjct  1    MSHLDALPSTPGKYKTEKAPPYGVFSQQRFLRLSKLTLWSSLFLVLFLFYLVLSPPPSSS  60

Query  286  RRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
             RNL +K + SV+     G  WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL RR
Sbjct  61   SRNL-NKSSSSVSPATYGGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRR  119

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGVLGLDNFN+YY+  LKRAR+ LL R+GV +++GDINDAVLL+KL D V FTHVMHLA
Sbjct  120  GDGVLGLDNFNHYYDPKLKRARQGLLERTGVFVVDGDINDAVLLRKLFDVVLFTHVMHLA  179

Query  640  A  642
            A
Sbjct  180  A  180



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 133/179 (74%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF  +I +FF+ S   + +S+
Sbjct  4    MMHIDNIPSTPGKFKMEKSP-YNRLRMHFSLAKLTFWSFVFFGLIFVFFYRS--PASSSS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              + + +++   +   GP WE+R++ASA  RS++G SVLVTGAAGFVG+HVS+ALKRRGD
Sbjct  61   VSSDLSRRSLRTSSYGGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL R+GV+++EGDINDA LL+KL D V FTHVMHLAA
Sbjct  121  GVLGLDNFNDYYDPSLKRARQALLERTGVYVVEGDINDATLLKKLFDIVPFTHVMHLAA  179



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 130/179 (73%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D+ PSTPGKFK EKS  Y          ++I WS VFV +I +FF+ SP +S +  
Sbjct  4    MKHIDNTPSTPGKFKIEKSP-YNRLRLQFSLAKIIFWSLVFVGLIFVFFYRSP-SSSSHV  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +L  +  R+ +   GP WE++++ASA PRS +G  VLVTGAAGFVG+HVS ALKRRG+
Sbjct  62   SSDLFRRSLRT-SSYGGPAWEKKIKASAKPRSSNGMCVLVTGAAGFVGTHVSAALKRRGN  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR+ LL RSGV+I+E DINDA LL+KL + VAFTHVMHLAA
Sbjct  121  GVLGLDNFNDYYDPSLKRARQELLERSGVYIVEADINDATLLKKLFEIVAFTHVMHLAA  179



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 133/179 (74%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK +KS +           +L  WSF+F+ +ILLFFF     S   +
Sbjct  7    ISHLDNIPSTPGKFKMDKSPYIHRLRWHSSLAKLTFWSFLFLGLILLFFF----RSPPPS  62

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +   +++ S ++  GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  63   SPSDSSRRSLSNSNWGGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGD  122

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLG+DNFN+YY+  LKRAR++LL R+GV ++EGDIND+ LL+KL D VAFTHVMHLAA
Sbjct  123  GVLGVDNFNDYYDPSLKRARQALLERTGVFVVEGDINDSALLRKLFDVVAFTHVMHLAA  181



>ref|XP_003635586.2| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=435

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP--PASGASN  285
            H D++PSTPGKFK +K  +           +LILWS  F  VI  FF +SP  P S  ++
Sbjct  4    HMDNIPSTPGKFKSDKYHYIHRFRSHSSLAKLILWSLFFFSVICFFFLLSPTSPTSPPAD  63

Query  286  R-RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            R R ++   T       GP WE++VR SA  RS  G +VLVTG AGFVGSHVS ALKRRG
Sbjct  64   RSRRVLANYTWG-----GPEWEKKVRQSARVRSDHGHTVLVTGGAGFVGSHVSAALKRRG  118

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFNNYY+  LKR R+ LL R+GV ++EGDIND+ LL+KL D VAFTHVMHLAA
Sbjct  119  DGVIGLDNFNNYYDPELKRHRRDLLERAGVFVVEGDINDSELLRKLFDVVAFTHVMHLAA  178



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 127/179 (71%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D  PSTPGKFK +KS +Y          +L +WSF+F+ VI LFF+     S  S+
Sbjct  1    MSHLDHTPSTPGKFKMDKSPYYSRTRWHSSVAKLTIWSFLFIAVIFLFFY----RSPPSS  56

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +   ++  +     G  WE+RVR SA  RS++GFSVLVTGAAGFVG+HVS ALKRRGD
Sbjct  57   SNSDPSRRYLTSATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL + V FTHVMHLAA
Sbjct  117  GVLGLDNFNDYYDPTLKRARQALLERSGVFIVEGDINDVSLLKKLFEVVPFTHVMHLAA  175



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 129/184 (70%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +S  D +PS+PGKFK +KS+++         ++    SF  + +I L F  SPP+  +S 
Sbjct  1    MSRLDDIPSSPGKFKIDKSSYFNRLRFQSSPIKFAFISFFLLCLISLLFLRSPPSVNSSQ  60

Query  283  ---NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS-GFSVLVTGAAGFVGSHVSLAL  450
               +RR+L     R+ T   GP WE+R+RASA  R+ S G +VLVTGAAGFVG+HVS AL
Sbjct  61   SDPSRRSL-----RTFTYG-GPAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSAL  114

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL   V+FTHVM
Sbjct  115  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDVELLRKLFKIVSFTHVM  174

Query  631  HLAA  642
            HLAA
Sbjct  175  HLAA  178



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 129/184 (70%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +S  D +PS+PGKFK +KS+++         ++    SF  + +I L F  SPP+  +S 
Sbjct  1    MSRLDDIPSSPGKFKIDKSSYFNRLRFQSSPIKFAFISFFLLCLISLLFLRSPPSVNSSQ  60

Query  283  ---NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS-GFSVLVTGAAGFVGSHVSLAL  450
               +RR+L     R+ T   GP WE+R+RASA  R+ S G +VLVTGAAGFVG+HVS AL
Sbjct  61   SDPSRRSL-----RTFTYG-GPAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSAL  114

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL   V+FTHVM
Sbjct  115  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDVELLRKLFKIVSFTHVM  174

Query  631  HLAA  642
            HLAA
Sbjct  175  HLAA  178



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 128/184 (70%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +S  D +PS+PGKFK +KS+++         ++    SF  + +I L F  SPP+  +S 
Sbjct  1    MSRLDDIPSSPGKFKIDKSSYFNRLRFQSSPIKFAFISFFLLCLISLLFLRSPPSVNSSQ  60

Query  283  ---NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS-GFSVLVTGAAGFVGSHVSLAL  450
               +RR+L     R+ T   GP WE+R+RASA  R+ S G +VLVTGAAGFVG+HVS AL
Sbjct  61   SDPSRRSL-----RTFTYG-GPAWEKRIRASARTRTSSNGMTVLVTGAAGFVGTHVSSAL  114

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL+KL   V FTHVM
Sbjct  115  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDVELLRKLFKIVTFTHVM  174

Query  631  HLAA  642
            HLAA
Sbjct  175  HLAA  178



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 132/179 (74%), Gaps = 2/179 (1%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I +FFF SP +S +S 
Sbjct  4    MKHIDNIPSTPGKFK-EKSP-YNRLRLHFSLTKLTFWSFVFLGLIFVFFFRSPSSSSSSP  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              + + +++   +   GP WE+R++ASA  RS SG SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   AASDLSRRSLRTSSYDGPAWEKRIKASAKVRSHSGISVLVTGAAGFVGTHVSAALKRRGD  121

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL R+GV+I+EGDIND  LL+KL D V F+HVMHLAA
Sbjct  122  GVVGLDNFNDYYDPTLKRARQALLERTGVYIVEGDINDVALLKKLFDIVQFSHVMHLAA  180



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 117/179 (65%), Gaps = 7/179 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D +P TPGK+K             RL    +  S      +      +PP+    +
Sbjct  1    MSHLDDLPPTPGKYKVVPYGVLHNHRYLRLSKLTLWASLFLALFLFYLVLSAPPSP---S  57

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            RR+L D   +      G +WE++VR SA PRS+ G +VLVTGAAGFVG+HVS+AL+RRGD
Sbjct  58   RRSLNDSSVK----YGGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGD  113

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN YY+  LKRAR+ LL RSGV ++EGD+NDAVLL+KL D V FTHVMHLAA
Sbjct  114  GVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLFTHVMHLAA  172



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 131/189 (69%), Gaps = 10/189 (5%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP  264
            M Q K  +SH D  P TPGKFK +KS +           +L  WSFVF+ +IL+FFF SP
Sbjct  1    MTQLKQ-MSHLDISPPTPGKFKMDKSPYIHRLRGHGSLAKLTFWSFVFLGLILIFFFHSP  59

Query  265  -PASGASN--RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSH  435
             P S  S+  RR+L         +  G  WE+RVR+SA  RS+ G SVLVTGAAGFVG+H
Sbjct  60   SPNSLPSDPSRRSL------RTYNWGGXAWEKRVRSSAKVRSRHGISVLVTGAAGFVGTH  113

Query  436  VSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVA  615
            VS ALKRRGDGVLGLD FN+YY+  LKRAR++LL RSGV I+EGDINDA LL KL + VA
Sbjct  114  VSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSGVFIVEGDINDAPLLSKLFEVVA  173

Query  616  FTHVMHLAA  642
            FTHVMHLAA
Sbjct  174  FTHVMHLAA  182



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGK+K EKS  Y          ++I WS VFV +I +FF+ SP +    +
Sbjct  4    MKHIDNIPSTPGKYKIEKSP-YNRLRLQFSLSKIIFWSLVFVGLIFVFFYRSPNSVSNVS  62

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
                + +++   +   GP WE+++++SA  RSK+G  VLVTGAAGFVG+HVS ALKRRGD
Sbjct  63   SD--LSRRSLRTSSYGGPVWEKKIKSSAKIRSKNGICVLVTGAAGFVGTHVSAALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR+ LL RSGV+I+EGDIND  LL+KL + VAFTHVMHLAA
Sbjct  121  GVVGLDNFNDYYDPSLKRARQELLERSGVYIVEGDINDVALLKKLFEVVAFTHVMHLAA  179



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 131/179 (73%), Gaps = 2/179 (1%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I +FFF SP +S +S 
Sbjct  4    MKHIDNIPSTPGKFK-EKSP-YNRLRLHFSLTKLTFWSFVFLGLIFVFFFRSPSSSSSSP  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              + + +++   +   GP WE+R++ASA  RS SG SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   AASDLSRRSLRTSSYDGPAWEKRIKASAKVRSHSGISVLVTGAAGFVGTHVSAALKRRGD  121

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL R GV+I+EGDIND  LL+KL D V F+HVMHLAA
Sbjct  122  GVVGLDNFNDYYDPTLKRARQALLERVGVYIVEGDINDVALLKKLFDIVQFSHVMHLAA  180



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGK+K EKS  Y          ++I W+ VFV +I +FF+ SP +    +
Sbjct  4    MKHIDNIPSTPGKYKIEKSP-YNRLRLQFSLTKIIFWALVFVGLIFVFFYRSPNSVSNVS  62

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
                + +++   +   GP WE+++++SA  RSK+G  VLVTGAAGFVG+HVS ALKRRGD
Sbjct  63   SD--LSRRSLRTSSYGGPVWEKKIKSSAKIRSKNGICVLVTGAAGFVGTHVSAALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR+ LL R+GV+I+EGDIND  LL+KL D VAFTHVMHLAA
Sbjct  121  GVVGLDNFNDYYDPSLKRARQELLERTGVYIVEGDINDVALLKKLFDIVAFTHVMHLAA  179



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 127/184 (69%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS-  282
            +S  D +PS+PGKFK EKS+++          +   +SF  + +I + F  SPP+   S 
Sbjct  1    MSRLDDIPSSPGKFKMEKSSYFHRLRFQSSLTKFAFFSFFLLCLISILFLRSPPSVNPSQ  60

Query  283  ---NRRNLIDKQTRSVTDQLGPNWERRVRASALPR-SKSGFSVLVTGAAGFVGSHVSLAL  450
               +RR+L   +T S     GP WE+ +RASA  R S +G +VLVTGAAGFVG+HVS AL
Sbjct  61   SDPSRRSL---RTYSYG---GPAWEKHLRASARIRTSNNGITVLVTGAAGFVGTHVSAAL  114

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHVM
Sbjct  115  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHVM  174

Query  631  HLAA  642
            HLAA
Sbjct  175  HLAA  178



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 7/186 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqp-------rlflrlilWSfvfvfvillfffiSP  264
            +SH D++PSTPGKFK +KS +                  +L  WSF+F+ +I LFF  SP
Sbjct  4    MSHLDNIPSTPGKFKMDKSPYIHHHHHRLLRWQWHSSLAKLTFWSFLFLALIFLFFLKSP  63

Query  265  PASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSL  444
             +S +S+  +   +++       GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS 
Sbjct  64   SSSSSSSFSSDPSRRSLRTYSWGGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSS  123

Query  445  ALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTH  624
            ALKRRGDGVLGLDNFN+YY+  LKRAR++LL R+GV ++EGDIND+ LL+KL + VAFTH
Sbjct  124  ALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRTGVFVVEGDINDSALLKKLFEVVAFTH  183

Query  625  VMHLAA  642
            VMHLAA
Sbjct  184  VMHLAA  189



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 129/179 (72%), Gaps = 12/179 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlq---prlflrlilWSfvfvfvillfffiSP---PASGASN  285
            +PSTPGKFK EKS +   + +       ++L  WSF+F+ +I +FFF SP   P     +
Sbjct  5    IPSTPGKFKMEKSPYILNKSRWHWHSSIMKLTFWSFIFLGLIFIFFFRSPSSNPIPQDPS  64

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            RR+L         +  GP WE+RVR+SA  RS++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  65   RRSL------RTHNWGGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRRGD  118

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR++LL R+GV ++EGDIND+ LL+KL + V FTHVMHLAA
Sbjct  119  GVLGLDNFNDYYDPSLKRARQALLDRTGVFVVEGDINDSTLLRKLFEVVPFTHVMHLAA  177



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 130/179 (73%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS+ Y          +L  WSFVF+ +I + FF SP +S +  
Sbjct  4    MKHIDNIPSTPGKFK-EKSS-YNRLRLHFSIAKLTFWSFVFLGLIFVCFFRSPSSSSSPA  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +L  +  R+ +   GP WE+R++ASA  RS++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   SSDLSRRSLRTSSYD-GPAWEKRIKASAKIRSRNGISVLVTGAAGFVGTHVSSALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL  +GV+I+EGDIND  LL+KL D V F HVMHLAA
Sbjct  121  GVVGLDNFNDYYDPSLKRARQTLLEGAGVYIVEGDINDVTLLKKLFDVVQFNHVMHLAA  179



>ref|XP_010424029.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like, partial [Camelina 
sativa]
Length=256

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASG---  276
            + H D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP  S    
Sbjct  1    MKHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPLVSDDPT  56

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
            +++RR+L   +T S     GP WE+RVR+SA  RS+ GFSVLVTGAAGFVG+HVS ALKR
Sbjct  57   STSRRSL---RTYSWG---GPAWEKRVRSSARLRSRRGFSVLVTGAAGFVGTHVSSALKR  110

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHL
Sbjct  111  RGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHL  170

Query  637  AA  642
            AA
Sbjct  171  AA  172



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 127/181 (70%), Gaps = 12/181 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK EK   +   L    F     WSFVF  +I +  F+S      S+
Sbjct  1    MSHLDNIPSTPGKFKMEKRLRWHSSLAKLTF-----WSFVFSGLIFIVLFLS-----PSS  50

Query  286  RRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRR  459
                 D   RS+      GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRR
Sbjct  51   SSLPSDPTRRSLRTHSWGGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGV+GLDNFN+YY+  LKRAR++LL R+GV I+EGDIND+ LL+KL + VAFTHVMHLA
Sbjct  111  GDGVIGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSKLLKKLFEVVAFTHVMHLA  170

Query  640  A  642
            A
Sbjct  171  A  171



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 132/179 (74%), Gaps = 8/179 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK EK   +   L    F     WSFVF+ +I +FFF+SP +S   +
Sbjct  7    MSHLDNIPSTPGKFKMEKRLRWHSSLAKLTF-----WSFVFLGLIFIFFFLSPSSSSLPS  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +    +T S     GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   DPSRRSLRTYSWG---GPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGD  118

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL R+GV I+EGDIND+ LL+KL + VAFTHVMHLAA
Sbjct  119  GVVGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSELLRKLFEVVAFTHVMHLAA  177



>gb|KFK31963.1| hypothetical protein AALP_AA6G182500 [Arabis alpina]
Length=429

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 124/180 (69%), Gaps = 6/180 (3%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D +PSTPGK+K +K   +   L+         W+ +F+ + L +  +S     + +
Sbjct  1    MSHLDDLPSTPGKYKTDKVLHHHRYLRLSKLTL---WASLFLALFLFYLLLS--PPPSPS  55

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRS-KSGFSVLVTGAAGFVGSHVSLALKRRG  462
            RRNL D    S     G +WE++VR S+ PR+  +G +VLVTGA+GFVG+HVS+AL+RRG
Sbjct  56   RRNLNDSSASSAAKYGGSHWEKQVRKSSRPRTPHNGLTVLVTGASGFVGTHVSIALRRRG  115

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLGLDNFN YY+  LKRAR+ LL RSGV ++EGDIND +LL+KL D V FTHVMHLAA
Sbjct  116  DGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDVILLKKLFDVVLFTHVMHLAA  175



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 130/179 (73%), Gaps = 8/179 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK EK   +   L    F     WSFVF  +I +FFF SP +S   +
Sbjct  7    MSHLDNIPSTPGKFKMEKRLRWHSSLAKLTF-----WSFVFSGLIFIFFFRSPSSSSLPS  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              ++   ++ S     GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   DSSIRSFRSYSWG---GPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGD  118

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL R+GV I+EGDIND+ LL+KL D V FTHVMHLAA
Sbjct  119  GVVGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSELLKKLFDVVTFTHVMHLAA  177



>ref|XP_004147978.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
 ref|XP_004159529.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
 gb|KGN55909.1| hypothetical protein Csa_3G035870 [Cucumis sativus]
Length=440

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 10/187 (5%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlil-WSfvfvfvillfffiS  261
            M Q KT+ SH D++PSTPGKFK EKS  Y  RL+    +  +  WSF+F+  I+ FFF+S
Sbjct  1    MSQQKTI-SHIDNLPSTPGKFKTEKSPPYIHRLRVHSAISRLTLWSFLFLIFIICFFFLS  59

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PP+S  S RR L            G NWE++V  SA  ++++G +VLVTGAAGFVG+HVS
Sbjct  60   PPSSSVSPRRAL------GGDSWGGHNWEKKVSRSA--QTQTGITVLVTGAAGFVGTHVS  111

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            +ALKRRGDGVLGLDNFN+YY+  LKRAR+ LL R+GV ++EGDIND+ LL+KL D VAFT
Sbjct  112  VALKRRGDGVLGLDNFNDYYDPQLKRARRKLLDRAGVFVVEGDINDSELLRKLFDVVAFT  171

Query  622  HVMHLAA  642
            HVMHLAA
Sbjct  172  HVMHLAA  178



>ref|XP_010055537.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Eucalyptus grandis]
 gb|KCW72021.1| hypothetical protein EUGRSUZ_E00471 [Eucalyptus grandis]
Length=436

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 121/187 (65%), Gaps = 8/187 (4%)
 Frame = +1

Query  85   MIQPKTV-LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiS  261
            M Q KT+ LSH D++PS+PGKFKP+KS  Y  RL+          S   + + L  F   
Sbjct  1    MSQLKTISLSHLDNVPSSPGKFKPDKSLTYIHRLRLHS-------SVSKLTLWLALFLGL  53

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
                   +         RS+    G  WE+R+R SA  RS+S F+VLVTGAAGFVG+HVS
Sbjct  54   LVFFFFLSPPAASPPPRRSLGSWGGSRWEKRIRTSARVRSRSSFTVLVTGAAGFVGTHVS  113

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            LALKRRGDGV+GLDNFN YY+  LKRAR+ +L ++GV ++EGDIND  LL KL D V FT
Sbjct  114  LALKRRGDGVIGLDNFNAYYDTRLKRARQEMLDQAGVFVVEGDINDKDLLNKLFDVVPFT  173

Query  622  HVMHLAA  642
            HVMHLAA
Sbjct  174  HVMHLAA  180



>ref|XP_008448903.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=440

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 10/187 (5%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlil-WSfvfvfvillfffiS  261
            M Q KT+ SH D++PSTPGKFK EKS  Y  RL+    +  +  WSF+F+  I+ FFF+S
Sbjct  1    MSQQKTI-SHIDNLPSTPGKFKTEKSPPYIHRLRVHSAISRLTLWSFLFLIFIICFFFLS  59

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PP+S  S RR L            G NWE++V  SA  ++++G +VLVTGAAGFVG+HVS
Sbjct  60   PPSSSVSPRRAL------GGDSWGGHNWEKKVSRSA--QTQTGITVLVTGAAGFVGTHVS  111

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            +ALKRRGDGVLGLDNFN+YY+  LKRAR+ LL R+GV ++EGDIND+ LL+KL D VAFT
Sbjct  112  VALKRRGDGVLGLDNFNDYYDPQLKRARRKLLDRAGVFVVEGDINDSELLRKLFDVVAFT  171

Query  622  HVMHLAA  642
            HVMHLAA
Sbjct  172  HVMHLAA  178



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPA-SGASNRRN  294
            D++PS+PGKFK EK  ++  R Q   F +   WS +FV +I   FF +P + S  ++RR+
Sbjct  2    DNIPSSPGKFKMEKGPYFHRRWQHSSFTKFTFWSILFVGIIFFLFFRTPSSFSSDTSRRS  61

Query  295  LIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVL  474
            L         +  G  WE++VR+SA   SK+G +VLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  62   L------RTYNYGGSAWEKKVRSSARVTSKNGVTVLVTGAAGFVGTHTSIALKQRGDGVL  115

Query  475  GLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GLDNFN+YY+  LKR R++LL  +GV I+EGDINDA LL+KL + V+FTHVMHLAA
Sbjct  116  GLDNFNDYYDPSLKRGRQALLEHNGVFIVEGDINDATLLKKLFEVVSFTHVMHLAA  171



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 131/179 (73%), Gaps = 8/179 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGKFK EK   +   L    F     WSFVF+ +I +FFF+SP +S   +
Sbjct  1    MSHLDNIPSTPGKFKMEKRLRWHSSLAKLTF-----WSFVFLGLIFIFFFLSPSSSSLPS  55

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +    +T S     GP WE+RVR+SA   +++G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  56   DPSRRSLRTYSWG---GPAWEKRVRSSAKVXARNGISVLVTGAAGFVGTHVSAALKRRGD  112

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL R+GV I+EGDIND+ LL+KL + VAFTHVMHLAA
Sbjct  113  GVVGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSELLRKLFEVVAFTHVMHLAA  171



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            + H D++PSTPGKFK EKS  Y          +L  WSFVF+ +I + FF S  +S +  
Sbjct  4    MKHVDNIPSTPGKFK-EKS-HYNRLRLHFSVAKLTFWSFVFLGLIFICFFKSTSSSSSPV  61

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
              +L  +  R+ +   GP WE+R++ASA  RS +G SVLVTGAAGFVG+HVS ALKRRGD
Sbjct  62   SSDLSRRSLRTSSYD-GPAWEKRIKASAKIRSTNGISVLVTGAAGFVGTHVSSALKRRGD  120

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LKRAR++LL  +GV+I+EGDIND  LL+KL D V F+HVMHLAA
Sbjct  121  GVVGLDNFNDYYDPSLKRARQTLLESAGVYIVEGDINDVALLKKLFDIVQFSHVMHLAA  179



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 134/183 (73%), Gaps = 10/183 (5%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAF-YrlrlqprlflrlilWSfvfvfvillfffiSP---PAS  273
            +SH D++PSTPGKFK +KS + +          +L  WSF+F+ +IL+FFF SP   P  
Sbjct  5    MSHLDNIPSTPGKFKMDKSPYIHNRLRWHSSLAKLTFWSFMFLGLILIFFFRSPSSNPLP  64

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
               +RR+L         +  GP WE+RVR+S+  RS++G SVLVTGAAGFVG+HVS ALK
Sbjct  65   QDPSRRSL------RTYNWGGPAWEKRVRSSSRIRSRNGISVLVTGAAGFVGTHVSAALK  118

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFN+YY+  LKRAR++LL RSGV I+EGDIND+ LL+KL + VAFTHVMH
Sbjct  119  RRGDGVLGLDNFNDYYDPSLKRARQALLERSGVFIVEGDINDSALLRKLFEVVAFTHVMH  178

Query  634  LAA  642
            LAA
Sbjct  179  LAA  181



>gb|EPS73152.1| hypothetical protein M569_01604, partial [Genlisea aurea]
Length=385

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 127/188 (68%), Gaps = 9/188 (5%)
 Frame = +1

Query  85   MIQPK-TVLSHFDSM-PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffi  258
            M Q K  +LSH D + PS+PGKFK     F RLR      + L    F+F   + L    
Sbjct  1    MTQTKPMILSHLDPIIPSSPGKFKSSPYVFGRLRFVTPRAVTLWSSLFLFFLFLFLSCSP  60

Query  259  SPPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHV  438
            +PPAS A+ RR+L        T +  P+WE + R SA  +S SG +VLVTGAAGFVG+HV
Sbjct  61   APPASSAATRRSL-------QTSEALPDWESKARTSARTQSNSGLTVLVTGAAGFVGTHV  113

Query  439  SLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAF  618
            ++ALK RGDGV+GLDNFN+YYE GLK+ARKSLL R GV+IIEGDIND  LL+KL D V F
Sbjct  114  AIALKGRGDGVVGLDNFNHYYEAGLKKARKSLLERRGVYIIEGDINDGELLRKLFDTVRF  173

Query  619  THVMHLAA  642
            THVMHLAA
Sbjct  174  THVMHLAA  181



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 128/180 (71%), Gaps = 8/180 (4%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlq-prlflrlilWSfvfvfvillfffiSPPASGAS  282
            +SH D++PSTPGKFK EKS  Y  RL+      +L LWS  F+  IL ++ +SPP+    
Sbjct  7    ISHLDNIPSTPGKFKLEKSQPYIHRLRFHASLSKLTLWSSFFLVFILFYYVLSPPSPSLP  66

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            +RR L D      +   GP+WE+RV  SA   S  G +VLVTGAAGFVG+HVS+ALKRRG
Sbjct  67   SRRALND------SSWGGPDWEKRVTRSAR-TSPHGLTVLVTGAAGFVGTHVSMALKRRG  119

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGVLG+DNFN+YY+  LKR R+ LL R+GV ++EGDINDA LL+KL D V FTHVMHLAA
Sbjct  120  DGVLGIDNFNHYYDPRLKRDRQKLLERNGVFVVEGDINDAPLLRKLFDVVPFTHVMHLAA  179



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASG---  276
            + H D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP  S    
Sbjct  1    MKHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPLVSDDPT  56

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
            +++RR+L   +T S     GP WE+RVR+SA  RS+ GFSVLVTGAAGFVG+HVS ALKR
Sbjct  57   STSRRSL---RTYSWG---GPAWEKRVRSSARLRSRRGFSVLVTGAAGFVGTHVSSALKR  110

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHL
Sbjct  111  RGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHL  170

Query  637  AA  642
            AA
Sbjct  171  AA  172



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASG---  276
            + H D +PSTPGKFKP    ++          +L  WS VFV +I +FF+ SP  S    
Sbjct  1    MKHLDDIPSTPGKFKP----YFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPLVSDDPT  56

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
            +++RR+L   +T S     GP WE+RVR+SA  RS+ GFSVLVTGAAGFVG+HVS ALKR
Sbjct  57   STSRRSL---RTYSWG---GPAWEKRVRSSARLRSRRGFSVLVTGAAGFVGTHVSSALKR  110

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR++LL RSGV ++EGDINDA LL+KL + V FTHVMHL
Sbjct  111  RGDGVLGLDNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHL  170

Query  637  AA  642
            AA
Sbjct  171  AA  172



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE++VR SA PRS  G +VLVTGAAGFVG+HVS+AL+RRGDGVLGLDNFN YY+  L
Sbjct  70   GSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKL  129

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL RSGV ++EGDINDAVLL+KL D V FTHVMHLAA
Sbjct  130  KRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLAA  172



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 123/181 (68%), Gaps = 3/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +S  D +PS+PGKFK EKS++           +   +SF  + +I L F  SP +   S+
Sbjct  1    MSRLDDIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPLSINPSS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLALKRR  459
              +   +  R+     GP WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS ALKRR
Sbjct  61   PSDPSRRSLRT-NSYGGPAWEKRLRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRR  119

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHVMHLA
Sbjct  120  GDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMHLA  179

Query  640  A  642
            A
Sbjct  180  A  180



>gb|KJB43946.1| hypothetical protein B456_007G225300 [Gossypium raimondii]
Length=432

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGK+KP+K+  +          +L L+S +F+ V+L F  +    S   +
Sbjct  1    MSHLDNIPSTPGKYKPDKAFRFNSSAASSSLSKLTLYSTLFLSVLLFFLLLLSSPSSPPS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
             R  +   +   +  L     + +R SA PRS +G +VLVTGAAGFVG+HVSLALKRRGD
Sbjct  61   PRRHLSSGSHHTSLSLS---HKLIRKSARPRSTTGHTVLVTGAAGFVGTHVSLALKRRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR+ +L ++GV I+EGDIND  LLQ+L DAV FTHVMHLAA
Sbjct  118  GVLGLDNFNHYYDPTLKRARQKILEKAGVFIVEGDINDKGLLQQLFDAVLFTHVMHLAA  176



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 126/190 (66%), Gaps = 19/190 (10%)
 Frame = +1

Query  115  FDSMPSTPGKFKPEKSAFYrlrlq-----------prlflrlilWSfvfvfvillfffiS  261
             DS+P+TPGKFK +K  ++                  L  ++ +WSF+ + +++ FFF+S
Sbjct  2    MDSLPATPGKFKMDKPQYHHHHHHHPRQLTVRWHHYPLVSKVAVWSFLAIALLVAFFFLS  61

Query  262  PP---ASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGS  432
            P    +S  S RR+L     R+     GP WE+ VR+SA  R   G SVLVTGAAGFVG+
Sbjct  62   PTTPNSSSTSGRRSL-----RNAAPWGGPAWEKCVRSSARVRRSGGISVLVTGAAGFVGT  116

Query  433  HVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAV  612
            HVS ALKRRGDGVLGLDNFN+YY+  LKRAR++LL R+GV ++EGD+ND  LL KL D V
Sbjct  117  HVSTALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRAGVFVVEGDVNDGPLLHKLFDVV  176

Query  613  AFTHVMHLAA  642
             FTHVMHLAA
Sbjct  177  PFTHVMHLAA  186



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  127  PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLIDK  306
            PSTPGKFKP+KS+ Y       L L     S   +      F I        +  +   +
Sbjct  10   PSTPGKFKPDKSSAYLHPHHRSLRLHS---SLSKLTFYSFLFLILFLFFFLLSSPSPSSR  66

Query  307  QTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDN  486
               +     GP WE++V  SA P+S+ G +VLVTGAAGFVG+HVS++LKRRGDGVLGLDN
Sbjct  67   HQPNTYPPGGPLWEKKVVKSARPKSRGGLTVLVTGAAGFVGTHVSVSLKRRGDGVLGLDN  126

Query  487  FNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            FN+YY++ LKRAR+ +L RSGV I+EGDIND  LL+KL D V FTHVMHLAA
Sbjct  127  FNHYYDINLKRARQKVLERSGVFIVEGDINDMTLLKKLFDVVFFTHVMHLAA  178



>ref|XP_006477270.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Citrus sinensis]
 gb|KDO63776.1| hypothetical protein CISIN_1g042406mg [Citrus sinensis]
Length=424

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 119/178 (67%), Gaps = 18/178 (10%)
 Frame = +1

Query  112  HFDSMPSTPG-KFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNR  288
            H D  PST G K KPEK          RL  +L +WSF+F+ V L FF ISP  S A+ R
Sbjct  3    HLDRTPSTAGNKLKPEK------FHNHRLRSKLAVWSFLFLTVFLFFFLISPSPS-ATFR  55

Query  289  RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDG  468
            R+             GP WE+++  S  PRS  G +VLVTGAAGFVGSHVSLALK+RGDG
Sbjct  56   RH----------SSGGPQWEKQIVKSTRPRSTRGLTVLVTGAAGFVGSHVSLALKKRGDG  105

Query  469  VLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            VLGLDNFNNYYE  LK+ARK LL R+GV +I+ DIND  LL K+ + VAFTHVMHLAA
Sbjct  106  VLGLDNFNNYYETSLKKARKGLLERAGVFVIDADINDKSLLDKIFNVVAFTHVMHLAA  163



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = +1

Query  109  SHFDSMPSTPGKFKPEKSAFYrlrl-qprlflrlilWSfvfvfvillfffiSPPASGASN  285
            SH D++PSTPGKFK EKS  Y  RL       +L LWS  F+  IL ++ +S P+    +
Sbjct  6    SHLDNIPSTPGKFKLEKSQPYIHRLRFHTSLSKLTLWSSFFLVFILFYYVLSSPSPSLPS  65

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            RR+L D          GP+WE+RV  SA  RS    +VLVTGAAGFVG+HVS+ALKRRGD
Sbjct  66   RRSLNDSWG-------GPSWEKRVTRSAQRRSSHELTVLVTGAAGFVGTHVSIALKRRGD  118

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YYE  LKR R+ LL R+GV ++EGDIND+ LL+KL D VAF+H+MHLAA
Sbjct  119  GVLGLDNFNHYYEPRLKRDRQKLLERNGVFVVEGDINDSSLLKKLFDVVAFSHIMHLAA  177



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 121/179 (68%), Gaps = 7/179 (4%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYrlrlq--prlflrlilWSfvfvfvillfffiSPPASGASNRR  291
            +++PSTPGKFKPEKS+ Y            +L L+SF+F+ ++L  F  SP     +N  
Sbjct  17   NNIPSTPGKFKPEKSSIYFNNRIRWYSSLSKLTLYSFLFLSLLLFLFLASPRHDSTTNFE  76

Query  292  NLIDKQTRSVTDQLGPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLALKRRGD  465
             +   Q+ +     G  WER VR SA  +     G +VLVTGA+GFVG+HVS+ALKRRGD
Sbjct  77   TVSKSQSATWG---GHEWERHVRQSARVKQGGARGLTVLVTGASGFVGTHVSMALKRRGD  133

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN YY+  LKR+R+ LL RSG+ I+EGDIND  L++KL D VAFTHVMHLAA
Sbjct  134  GVLGLDNFNGYYDPSLKRSRQKLLERSGIFIVEGDINDKDLIRKLFDVVAFTHVMHLAA  192



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprl----flrlilWSfvfvfvillfffiSPPAS  273
            ++H D+ PSTPGKFK EKS +               +L  W  +FV +IL+F   S  +S
Sbjct  4    MAHIDNSPSTPGKFKMEKSGYNIHHQYHHRLRWPVAKLTFWCCIFVGLILVFMLRSSSSS  63

Query  274  GAS-----NRRNLIDKQTRSVT--DQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGS  432
              S     ++ ++  + +RS+      GP+WE+RVR S   R+ +GFSVLVTGAAGFVG+
Sbjct  64   SYSASDYRDKDSISTRHSRSLRTFSWGGPSWEKRVRNSGRVRAPNGFSVLVTGAAGFVGT  123

Query  433  HVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAV  612
            HVS ALKRRGDGVLGLDNFN+YY+  LKRAR++LL RSGV I++GDIND  LL+KL   V
Sbjct  124  HVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRSGVFIVQGDINDEPLLKKLFQLV  183

Query  613  AFTHVMHLAA  642
             FTHVMHLAA
Sbjct  184  PFTHVMHLAA  193



>gb|KFK37325.1| hypothetical protein AALP_AA4G242100 [Arabis alpina]
Length=435

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 124/184 (67%), Gaps = 11/184 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPA---SG  276
            +S  D +PS+PGKFK EKS +           +   +SF  +  I + F  SPP+     
Sbjct  1    MSRLDDIPSSPGKFKMEKSTYLNRLRFQSPLTKFAFFSFFLLCFISVLFLRSPPSVYTQS  60

Query  277  ASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLAL  450
              +RR+L   +T S +   GP +E+++R SA  R+ S  G +VLVTGAAGFVG+HVS AL
Sbjct  61   DPSRRSL---RTYSYS---GPAFEKKLRNSAKIRTSSSNGITVLVTGAAGFVGTHVSAAL  114

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL +SG+ I+EGDIND  LL+KL   V+FTHVM
Sbjct  115  KRRGDGVVGLDNFNDYYDPSLKRARQALLEQSGIFIVEGDINDVELLRKLFKIVSFTHVM  174

Query  631  HLAA  642
            HLAA
Sbjct  175  HLAA  178



>ref|XP_002303529.2| hypothetical protein POPTR_0003s11410g [Populus trichocarpa]
 gb|EEE78508.2| hypothetical protein POPTR_0003s11410g [Populus trichocarpa]
Length=434

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = +1

Query  127  PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLIDK  306
            PSTPGK K EKS  Y    + R       +S +  F +  FFF+      +         
Sbjct  9    PSTPGKLKQEKSLLYLQTHRQRSLRL---YSSLSKFALSSFFFLIIFLFFSLLSSPSSPS  65

Query  307  QTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
                +T+ L  G  WE++V  SA P+ ++GF+V VTGAAGFVG+HVS+ALKRRGDGVLGL
Sbjct  66   NRSKITNSLPGGSQWEKKVLKSARPKLRAGFTVFVTGAAGFVGTHVSVALKRRGDGVLGL  125

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+V LKR R+ +L RSGV ++EGDIND  LLQKL D V FTHVMHLAA
Sbjct  126  DNFNHYYDVNLKRDRQKVLERSGVFVVEGDINDVKLLQKLFDVVYFTHVMHLAA  179



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +1

Query  259  SPPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHV  438
            SP ++  S+RR+L   +T S     GP WE+RVR+SA  R+++G SVLVTGAAGFVG+HV
Sbjct  39   SPISNPDSSRRSL---RTYSWG---GPAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHV  92

Query  439  SLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAF  618
            S ALKRRGDGVLGLDNFN+YY+  LKR+R++LL RSGV I+EGDIND  LL+KL + V F
Sbjct  93   SAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDLSLLKKLFEVVPF  152

Query  619  THVMHLAA  642
            THVMHLAA
Sbjct  153  THVMHLAA  160



>ref|XP_011014804.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Populus euphratica]
Length=436

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 112/174 (64%), Gaps = 5/174 (3%)
 Frame = +1

Query  127  PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLIDK  306
            PSTPGK K EKS  Y      R       +S +  F +  FFF+      +         
Sbjct  9    PSTPGKLKQEKSLLYLQTHHQRSLRL---YSSLSKFALSSFFFLIIFLFFSLLSSPSSPS  65

Query  307  QTRSVTDQL--GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
                + + L  G  WE++V  SA P+  +GF+VLVTGAAGFVG+HVS+ALKRRGDGVLGL
Sbjct  66   NRSKIANSLPGGSQWEKKVLKSARPKLHAGFTVLVTGAAGFVGTHVSVALKRRGDGVLGL  125

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+V LKR R+ +L RSGV ++EGDIND  LLQKL DAV FTHVMHLAA
Sbjct  126  DNFNHYYDVNLKRDRQKVLERSGVFVVEGDINDVKLLQKLFDAVYFTHVMHLAA  179



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +S  D +PS+PGKFK EKS++           +   +SF  + +I L F  SPP+   S+
Sbjct  1    MSRLDDIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSINPSS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLALKRR  459
              +   +  R+ T   GP WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS ALKRR
Sbjct  61   PSDPSRRSLRTNTYG-GPAWEKRLRSSARIRTSTNNGITVLVTGAAGFVGTHVSAALKRR  119

Query  460  GDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLA  639
            GDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHVMHLA
Sbjct  120  GDGVIGLDNFNDYYDPSLKRARRALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMHLA  179

Query  640  A  642
            A
Sbjct  180  A  180



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 117/178 (66%), Gaps = 11/178 (6%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYr---lrlqprlflrlilWSfvfvfvillfffiSPPASGASNR  288
            D+ PSTPGK K E+S  Y             +L  W+ V V +I++FF  S  +S    R
Sbjct  11   DAFPSTPGKVKMERSNIYFGRGSTRWQSSVAKLFFWTVVVVGLIVIFFMRS--SSPVETR  68

Query  289  RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDG  468
            R L      S     G +WE+RVR S   +++ G  VLVTGAAGFVGSHVSLALKRRGDG
Sbjct  69   RLL------STPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALKRRGDG  122

Query  469  VLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            VLGLDNFN+YY+  LKRAR+ LL + GV ++EGDINDA LL+KL D V FTHVMHLAA
Sbjct  123  VLGLDNFNDYYDQSLKRARQGLLDKQGVFVVEGDINDAPLLKKLFDVVPFTHVMHLAA  180



>ref|XP_011033905.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Populus euphratica]
Length=436

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++V  SA P+  +GF+VLVTGAAGFVG+HVS+ALKRRGDGVLGLDNFN+YY+V L
Sbjct  77   GSQWEKKVLKSARPKLHAGFTVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNHYYDVNL  136

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ +L RSGV ++EGDIND  LLQKL DAV FTHVMHLAA
Sbjct  137  KRDRQKVLERSGVFVVEGDINDVKLLQKLFDAVYFTHVMHLAA  179



>gb|KJB25649.1| hypothetical protein B456_004G202200 [Gossypium raimondii]
Length=433

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 122/179 (68%), Gaps = 3/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGK KP+K+  +          +L L+S +F+ V+L+F  +    S   +
Sbjct  1    MSHLDNIPSTPGKHKPDKAFRFHSAAASSSLSKLTLYSTLFLSVLLIFLLLLSSPSSPPS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
             R  +   +      L     + +R SA PR  +G +VLVTGAAGFVG+HVSLALKRRGD
Sbjct  61   PRRHLSTGSHHTPLSLS---HKLIRKSARPRYTTGHTVLVTGAAGFVGTHVSLALKRRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN+YY+  LKRAR+ +L ++GV I+EGDIND  LLQ+LLDAV FTHVMHLAA
Sbjct  118  GVLGLDNFNHYYDPTLKRARQKILEKAGVFIVEGDINDKGLLQQLLDAVLFTHVMHLAA  176



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 124/185 (67%), Gaps = 12/185 (6%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfff----iSPPAS  273
            +S  D +PS+PGKFK EKS++           +   +SF  + +I L F        P+ 
Sbjct  1    MSRLDEIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSVNPSP  60

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLA  447
               +RR+L     R+ T   GP WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS A
Sbjct  61   SDPSRRSL-----RTYTYG-GPAWEKRLRSSARIRTSTSNGITVLVTGAAGFVGTHVSAA  114

Query  448  LKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHV  627
            LKRRGDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHV
Sbjct  115  LKRRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHV  174

Query  628  MHLAA  642
            MHLAA
Sbjct  175  MHLAA  179



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R +T   G   WE++VR SA  R   GFSVLVTG AGFVG+HVSLALK+RGD
Sbjct  56   QSFVDTGSRYLTASWGGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LKRARK+LL   G+ ++EGDINDA LL KL D VAFTHVMHLAA
Sbjct  116  GVVGLDNFNNYYDPSLKRARKTLLNNHGIFVVEGDINDARLLAKLFDVVAFTHVMHLAA  174



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDG  468
            RN +       +DQ G  WE++VR S+ PR  +G SVLVTGAAGFVGSH S+ALK+RGDG
Sbjct  76   RNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVGSHCSMALKKRGDG  135

Query  469  VLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            VLGLDNFNNYY+  LKRAR+SLL +  + I+EGD+NDA LL KL D V FTH++HLAA
Sbjct  136  VLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFDVVPFTHILHLAA  193



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE+++RASA PR   GFSVLVTGAAGFVG+HVSLAL++RGDGV+GLDNFN+YY+  L
Sbjct  72   GLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPSL  131

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARKSLLA  G+ ++EGDIND  LL KL D V FTHVMHLAA
Sbjct  132  KKARKSLLASHGIFVVEGDINDGRLLAKLFDVVPFTHVMHLAA  174



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 6/129 (5%)
 Frame = +1

Query  259  SPPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASA-LPRSKSGFSVLVTGAAGFVGSH  435
            SPP+S     R  +   +       GP WE+RVR+SA + R   GFSVLVTGAAGFVG+H
Sbjct  74   SPPSSNLGQHRRSLRTASWG-----GPAWEKRVRSSARIRRRPGGFSVLVTGAAGFVGTH  128

Query  436  VSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVA  615
            VS ALK+RGDGVLGLD FN+YYE  LKRAR++LL R+GV ++EGDINDA+LL+KL D V 
Sbjct  129  VSAALKKRGDGVLGLDCFNDYYEPSLKRARQALLERAGVFVVEGDINDALLLRKLFDVVP  188

Query  616  FTHVMHLAA  642
            FTHVMHLAA
Sbjct  189  FTHVMHLAA  197



>ref|XP_010413058.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Camelina 
sativa]
Length=234

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 121/183 (66%), Gaps = 4/183 (2%)
 Frame = +1

Query  106  LSHFDSM-PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS  282
            +S  D M PS+PGKFK EKS++           +   +SF  + +I L F  SPP+   S
Sbjct  1    MSRLDEMIPSSPGKFKMEKSSYLHRLRFQSYLTKFAFFSFFLLCLISLLFLRSPPSVNPS  60

Query  283  NRRNLIDKQTRSVTDQLG-PNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLALK  453
               +    +    T   G P WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS ALK
Sbjct  61   PSSSSDPSRRSLRTYTYGGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALK  120

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGV+GLDNFN+YY+  LKRAR++LL RS + I+EGDIND  LL+KL   V+FTHVMH
Sbjct  121  RRGDGVIGLDNFNDYYDPSLKRARQALLERSSIFIVEGDINDVELLRKLFKIVSFTHVMH  180

Query  634  LAA  642
            LAA
Sbjct  181  LAA  183



>ref|XP_006440401.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
 gb|ESR53641.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
Length=427

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP WE+++  S  PRS SG +VLVTGAAGFVGSHVSLALK+RGDGVLGLDNFNNYYE  L
Sbjct  64   GPQWEKQIVKSTRPRSTSGLTVLVTGAAGFVGSHVSLALKKRGDGVLGLDNFNNYYETSL  123

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARK LL ++GV +I+ DIND  LL K+ + VAFTHV+HLAA
Sbjct  124  KKARKGLLEQAGVFVIDADINDKSLLDKIFNVVAFTHVIHLAA  166



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 112/174 (64%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S     +L         ++ +    + L   ++S         +  +D
Sbjct  9    FPSTPGKFKIERSHHMNRQLYRCFASTSTMFLWALFLIALTASYLS--------FQGFVD  60

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA    + G SVLVTGAAGFVGSHVSLALKRRGDGV+GL
Sbjct  61   SGSRYLTASWGGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVGL  120

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+ARKSLLA   V I+EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  121  DNFNDYYDPSLKKARKSLLATHDVFIVEGDVNDAKLLAKLFDVVAFTHVMHLAA  174



>ref|XP_011076316.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=421

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 95/136 (70%), Gaps = 16/136 (12%)
 Frame = +1

Query  259  SPPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKS--------GFSVLVTGA  414
            SPP   +S+RR        + T     NWERRV+ SA  RS S          SVLVTGA
Sbjct  38   SPPPDFSSDRR--------TTTTWGSLNWERRVQTSARTRSHSPSHSAGPGHLSVLVTGA  89

Query  415  AGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQ  594
            AGFVGSHVS+ALKRRGDGV+GLDNFNNYY+  LKRAR+ LL R+GV ++EGDIND  LL 
Sbjct  90   AGFVGSHVSMALKRRGDGVVGLDNFNNYYDPSLKRARQKLLERAGVFVVEGDINDTALLN  149

Query  595  KLLDAVAFTHVMHLAA  642
            KL D VAFTHVMHLAA
Sbjct  150  KLFDIVAFTHVMHLAA  165



>ref|XP_008780407.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Phoenix 
dactylifera]
Length=293

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +1

Query  334  GPNWERRVRASA-LPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVG  510
            GP+WE+RVR+SA + R   G SVLVTGAAGFVG+HVS ALK+RGDGVLGLD FN+YY+  
Sbjct  100  GPDWEKRVRSSARIRRQPGGLSVLVTGAAGFVGTHVSAALKKRGDGVLGLDCFNDYYDPS  159

Query  511  LKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LKRAR++LL R+GV ++EGD+NDA+LL+KL D V FTHVMHLAA
Sbjct  160  LKRARQALLKRAGVFVVEGDVNDALLLRKLFDVVLFTHVMHLAA  203



>ref|XP_007039971.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOY24472.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=431

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 4/179 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +SH D++PSTPGK+KP+KS  +       L    +  +     +++L   +S P+S  S 
Sbjct  1    MSHLDNIPSTPGKYKPDKSFRFHSSTASSLSKLTLYSTLFLSLLLILLLLLSTPSSTTSP  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            RR+L      S          + +  SA PRS +G +VLVTGA+GFVG+HVSLALKRRGD
Sbjct  61   RRHLSTGTHHSPVSLP----HKLIHKSARPRSTAGHTVLVTGASGFVGTHVSLALKRRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GVLGLDNFN YY+  LKRAR+  L ++G+ I+EGDIND  LLQ+L DAV FTHVMHLAA
Sbjct  117  GVLGLDNFNQYYDPALKRARQKFLEKAGIFIVEGDINDKDLLQQLFDAVLFTHVMHLAA  175



>ref|XP_002509598.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50985.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=437

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP WE++V  SA P+S+SG +VLVTGAAGFVG+HVS+ALKRRGDGVLGLDNFN+YY+V L
Sbjct  76   GPLWEKKVAKSARPKSRSGLTVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNHYYDVSL  135

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ +L +SG+ +IEGDIND  LL K+ D V FTHVMHLAA
Sbjct  136  KRGRQKVLEKSGIFVIEGDINDMGLLNKIFDTVRFTHVMHLAA  178



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 111/174 (64%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      +   F ++  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIERS-------NTMNRQFHRCFTSTSTMFLWALFLVALTASYLS-FQSFVD  60

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE+ VR+SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+GL
Sbjct  61   SGSRYFSASWGGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGL  120

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LK+ARK+LL   GV +IEGDINDA LL KL DAVAFTHVMHLAA
Sbjct  121  DNFNNYYDPSLKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAFTHVMHLAA  174



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = +1

Query  265  PASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSL  444
            P +     RN +       +D  G  WE++VR S+ PR  +G SVLVTGAAGFVGSH S+
Sbjct  68   PGNHLHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVGSHCSM  127

Query  445  ALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTH  624
            ALK+RGDGVLGLDNFNNYY+  LKRAR+SLL +  + I+EGD+NDA LL KL D V FTH
Sbjct  128  ALKKRGDGVLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFDVVPFTH  187

Query  625  VMHLAA  642
            ++HLAA
Sbjct  188  ILHLAA  193



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 111/174 (64%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      +   F ++  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIERS-------NTMNRQFHRCFTSTSTMFLWALFLVALTASYLS-FQSFVD  60

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE+ VR+SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+GL
Sbjct  61   SGSRYFSASWGGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGL  120

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LK+ARK+LL   GV +IEGDINDA LL KL DAVAFTHVMHLAA
Sbjct  121  DNFNNYYDPSLKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAFTHVMHLAA  174



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP+WE+RV  SA  RS  G +VLVTGAAGFVG+HVS+ALKRRGDGVLGLDNFN+YYE  L
Sbjct  66   GPSWEKRVTRSAQRRSSHGLTVLVTGAAGFVGTHVSIALKRRGDGVLGLDNFNHYYEPRL  125

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ LL R+GV ++EGDIND+ LL+KL D VAF+H+MHLAA
Sbjct  126  KRDRQKLLERNGVFVVEGDINDSSLLKKLFDVVAFSHIMHLAA  168



>gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 113/177 (64%), Gaps = 14/177 (8%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAF---YrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRN  294
             PSTPGKFK E+ ++    +          + LW+   + + + +             ++
Sbjct  9    FPSTPGKFKIEQRSYGINRQFYRFFASTSTMFLWALFLIALTVSYLSF----------QS  58

Query  295  LIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGV  471
             +D  TR ++   G   WE++VR SA      G SVLVTGA+GFVG+HVSLALKRRGDGV
Sbjct  59   FVDSGTRYLSASWGGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRRGDGV  118

Query  472  LGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            +GLDNFNNYY+  LK+ARK+L+ R GV +IEGDINDA LL KL D VAFTHVMHLAA
Sbjct  119  VGLDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAFTHVMHLAA  175



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 113/177 (64%), Gaps = 14/177 (8%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAF---YrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRN  294
             PSTPGKFK E+ ++    +          + LW+   + + + +             ++
Sbjct  9    FPSTPGKFKIEQRSYGINRQFYRFFASTSTMFLWALFLIALTVSYLSF----------QS  58

Query  295  LIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGV  471
             +D  TR ++   G   WE++VR SA      G SVLVTGA+GFVG+HVSLALKRRGDGV
Sbjct  59   FVDSGTRYLSASWGGLQWEKQVRTSAEISRSGGMSVLVTGASGFVGTHVSLALKRRGDGV  118

Query  472  LGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            +GLDNFNNYY+  LK+ARK+L+ R GV +IEGDINDA LL KL D VAFTHVMHLAA
Sbjct  119  VGLDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAFTHVMHLAA  175



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  +   G   WE++VR SA P   +GFSVLVTGAAGFVGSHVSLALK+RGD
Sbjct  56   QSFVDSGSRYFSASWGGIQWEKQVRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARKSLL+  G+ I++GDIND  LL KL D V FTHVMHLAA
Sbjct  116  GVVGLDNFNSYYDPSLKKARKSLLSNHGIFIVDGDINDVRLLDKLFDVVVFTHVMHLAA  174



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 89/103 (86%), Gaps = 3/103 (3%)
 Frame = +1

Query  337  PNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            P WE+RV++SA  RS+SG F+VLVTGAAGFVGSHVS ALKRRGDGV+GLDNFN+YY+  L
Sbjct  50   PQWEKRVKSSA--RSRSGHFTVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSL  107

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL R+G+ +IEGDIND  LL+KL D VAFTHVMHLAA
Sbjct  108  KRARQKLLERNGIFVIEGDINDRHLLEKLFDVVAFTHVMHLAA  150



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 122/183 (67%), Gaps = 4/183 (2%)
 Frame = +1

Query  106  LSHFDSM-PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS  282
            +S  D M PS+PGKFK EKS++           +   +SF  + +I L F  SPP+   S
Sbjct  1    MSRLDEMIPSSPGKFKMEKSSYLHRLRFQSYLTKFAFFSFFLLCLISLLFLRSPPSVNPS  60

Query  283  NRRNLIDKQTRSVTDQLG-PNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLALK  453
               +    +    T   G P WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS ALK
Sbjct  61   PSSSSDPSRRSLRTSTYGGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALK  120

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHVMH
Sbjct  121  RRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMH  180

Query  634  LAA  642
            LAA
Sbjct  181  LAA  183



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  TR  +   G  +WE++VRAS   R   G +VLVTGAAGFVG+HVSLALK+RGD
Sbjct  56   QSFMDSSTRYFSTPWGGLHWEKQVRASCQTRRPGGLTVLVTGAAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            G++GLDNFN+YY+  LK+ARK++LAR G+ +IEGDINDA LL KL D VAFTHVMHLAA
Sbjct  116  GLVGLDNFNSYYDPSLKKARKAILARHGMFVIEGDINDARLLAKLFDIVAFTHVMHLAA  174



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  +   G   WE++VR SA P   +GFSVLVTGAAGFVGSHVSLALK+RGD
Sbjct  56   QSFVDSGSRYFSASWGGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARKSLL+  G+ +++GDIND  LL KL D V FTHVMHLAA
Sbjct  116  GVVGLDNFNSYYDPSLKKARKSLLSNHGIFVVDGDINDVRLLDKLFDVVVFTHVMHLAA  174



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  T   G  +WER++RASA  R + G +VLVTGAAGFVG+HVSLAL+RRGD
Sbjct  58   QSFVDTSSRYFTASWGGLHWERQIRASAAVRREDGIAVLVTGAAGFVGTHVSLALRRRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN YY+  LK+ARK+LLA  GV ++EGD+NDA LL KL D V FTHVMHLAA
Sbjct  118  GVVGLDNFNAYYDPSLKKARKALLASHGVFVVEGDVNDARLLAKLFDTVPFTHVMHLAA  176



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +GFSVLVTGAAGFVGSH SLALK+RGDGVLG+DNFN+YY+  L
Sbjct  88   GSAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGIDNFNDYYDPSL  147

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL++  V IIEGDIND+ LL KL D V FTHV+HLAA
Sbjct  148  KRARQKLLSKHQVFIIEGDINDSPLLSKLFDVVPFTHVLHLAA  190



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR ++GFSVLVTGAAGFVGSH SLALK+RGDGVLGLDNFNNYY+  L
Sbjct  86   GATWEKQVRHSATPRRQNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  + I++GD+ND  LL KL D V FTH++HLAA
Sbjct  146  KRARQALLSKHQIFIVDGDLNDGPLLYKLFDVVPFTHILHLAA  188



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R      G  +WE+++RASA PR   G SVLVTGAAGFVG+HVSLAL++RGD
Sbjct  56   QSFVDTSSRYFNASWGGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARK+LL   GV ++EGDINDA LL KL D V FTHVMHLAA
Sbjct  116  GVVGLDNFNSYYDPSLKKARKALLTSHGVFVVEGDINDARLLAKLFDVVPFTHVMHLAA  174



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +1

Query  334  GPNWERRVRASA-LPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVG  510
            GP WE+RVR+SA + R   GFSVLVTGAAGFVG+HVS ALK+RGDGVLGLD FN+YY+  
Sbjct  101  GPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKRGDGVLGLDCFNDYYDPS  160

Query  511  LKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LKRAR++LL R+GV ++EGD+NDA+LL+KL D V FTHVMHLAA
Sbjct  161  LKRARQALLQRAGVFVVEGDVNDALLLRKLFDVVPFTHVMHLAA  204



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE++VR S+ PR  SG SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFNNYY+  L
Sbjct  32   GASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSL  91

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL +  V I+EGDIND  LL KL D V FTH++HLAA
Sbjct  92   KRARQQLLLKHQVFIVEGDINDGQLLAKLFDVVPFTHILHLAA  134



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WER VR+SA PR  SG +VLVTGAAGFVG+H SLALK+RGDGV+GLDNFN+YY+  L
Sbjct  86   GAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHCSLALKKRGDGVVGLDNFNSYYDPSL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+SLL+R GV +++GDIND  LL KLLD V F+HV+HLAA
Sbjct  146  KRARQSLLSRHGVLVVDGDINDTPLLTKLLDVVPFSHVLHLAA  188



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 112/176 (64%), Gaps = 9/176 (5%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNL  297
            ++ PSTPGKFK E+S                 ++      +   F I+  AS  S  +  
Sbjct  7    ETFPSTPGKFKIERS-------HTMNRQLYRCFASTSTMFLWALFLIALTASYLS-FQGF  58

Query  298  IDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVL  474
            +D  +R ++   G   WE++VR SA    + G SVLVTGAAGFVGSHVSLALKRRGDGV+
Sbjct  59   VDSGSRYLSASWGGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVV  118

Query  475  GLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GLDNFN+YY+  LK+ARKSLL    V I+EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  119  GLDNFNDYYDPSLKKARKSLLNTHEVFIVEGDVNDAKLLAKLFDVVAFTHVMHLAA  174



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 123/184 (67%), Gaps = 5/184 (3%)
 Frame = +1

Query  106  LSHFDSM-PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGAS  282
            +S  D M PS+PGKFK EKS++           +   +SF  + +I L F  SPP+   S
Sbjct  1    MSRLDEMIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSVNTS  60

Query  283  NRRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLAL  450
               +  D   RS+      GP WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS AL
Sbjct  61   PSSSSSDPSRRSLRTNTYGGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAAL  120

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            KRRGDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V FTHVM
Sbjct  121  KRRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVTFTHVM  180

Query  631  HLAA  642
            HLAA
Sbjct  181  HLAA  184



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPA-SGASNRRNLI  300
            +PS+PGKFK +K   +   L    F     WS +F  VI   FF +P + S  ++RR+L 
Sbjct  3    IPSSPGKFKMDKRTRWHKSLPKLAF-----WSILFFGVIYFLFFRTPSSFSSDTSRRSL-  56

Query  301  DKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
                    +  G  WE++VR+SA   SK+G SVLVTGAAGFVGSHVS+ALKRRGDGV+G+
Sbjct  57   -----RTYNYGGAAWEKKVRSSAKVTSKNGVSVLVTGAAGFVGSHVSIALKRRGDGVVGI  111

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK  R++LL R+GV I+EGDIND  LL+KL + V FTHVMHLAA
Sbjct  112  DNFNDYYDPMLKLGRQALLERTGVFIVEGDINDPTLLKKLFEVVPFTHVMHLAA  165



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 124/185 (67%), Gaps = 6/185 (3%)
 Frame = +1

Query  106  LSHFDSM--PSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGA  279
            +S  D M  PS+PGKFK EKS++           +   +SF  + +I L F  SPP+   
Sbjct  1    MSRLDEMMIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSVNP  60

Query  280  SNRRNLIDKQTRSVTDQL--GPNWERRVRASALPRSKS--GFSVLVTGAAGFVGSHVSLA  447
            S   +  D   RS+      GP WE+R+R+SA  R+ +  G +VLVTGAAGFVG+HVS A
Sbjct  61   SPSSSSSDPSRRSLRTSTYGGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAA  120

Query  448  LKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHV  627
            LKRRGDGV+GLDNFN+YY+  LKRAR++LL RSG+ I+EGDIND  LL+KL   V+FTHV
Sbjct  121  LKRRGDGVIGLDNFNDYYDPSLKRARQALLERSGIFIVEGDINDVELLRKLFKIVSFTHV  180

Query  628  MHLAA  642
            MHLAA
Sbjct  181  MHLAA  185



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  +   G   WE++VR SA P   +GFSV+VTGAAGFVGSHVSLALK+RGD
Sbjct  56   QSFVDSGSRYFSASWGGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARKSLL+  G+ I++GDIND  LL KL D V FTHVMHLAA
Sbjct  116  GVVGLDNFNSYYDPSLKKARKSLLSNHGIFIVDGDINDVRLLDKLFDVVVFTHVMHLAA  174



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 113/174 (65%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E++     +L         ++ +    + L   ++S         +  +D
Sbjct  9    FPSTPGKFKIERAHHMNRQLYRCFASTSTMFLWALFLIALTASYLS--------FQGFVD  60

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R ++   G   WE++VR SA    + G SVLVTGAAGFVGSHVSLALKRRGDGV+GL
Sbjct  61   SGSRYLSASWGGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVGL  120

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+ARKSLLA+  V I++GD+NDA LL KL D VAFTHVMHLAA
Sbjct  121  DNFNDYYDPSLKKARKSLLAKHDVFIVDGDLNDAKLLAKLFDVVAFTHVMHLAA  174



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = +1

Query  106  LSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASN  285
            +S  D +PS+PGKFK +KS +           +L  +SF  + +IL+FF  SPP++ + +
Sbjct  1    MSRLDDIPSSPGKFKMDKSPYLHRARWHSSLTKLTFFSFFLLCLILVFFLRSPPSNSSPS  60

Query  286  RRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLALKRRG  462
              +    +  S     GP WE+RVRASA  R+ +G  +VLVTGAAGFVG+HVS ALKRRG
Sbjct  61   DPSRRSLRNYSYG---GPAWEKRVRASAQIRTSNGAMTVLVTGAAGFVGTHVSAALKRRG  117

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFN+YY+  LKRAR++LL RSGV I+EGDIND  LL++L   V FTHVMHLAA
Sbjct  118  DGVVGLDNFNDYYDPSLKRARQALLDRSGVFIVEGDINDVALLRELFRLVPFTHVMHLAA  177



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQL----GPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
            P AS  +N  N I   T ++        G +WE++VR SA P   +GFSVLVTGAAGFVG
Sbjct  57   PLASDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVG  116

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            SH SLALK+RGDGVLGLDNFN+YY+  LKRAR++LL++  + I+EGDIND  LL KL D 
Sbjct  117  SHSSLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDINDVELLNKLFDI  176

Query  610  VAFTHVMHLAA  642
            V FTH++HLAA
Sbjct  177  VPFTHILHLAA  187



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGA GFVGSH SLALK+RGDGVLGLDNFNNYY+  L
Sbjct  87   GAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSL  146

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  V I+EGD+ND  LL KL D V FTHV+HLAA
Sbjct  147  KRARQNLLSKHQVFIVEGDLNDGPLLTKLFDVVPFTHVLHLAA  189



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  T   G  +WER++RASA  R   G +VLVTGAAGFVG+HVSLAL+RRGD
Sbjct  58   QSFVDTSSRYFTASWGGLHWERQIRASAAVRRDDGIAVLVTGAAGFVGTHVSLALRRRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+G+DNFN YY+  LK+ARK+LLA  GV +++GDINDA LL+KL D V FTHVMHLAA
Sbjct  118  GVVGIDNFNAYYDPSLKKARKALLAGHGVFVVDGDINDARLLEKLFDTVPFTHVMHLAA  176



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGFVGSH SLALK+RGDGVLGLDNFNNYY+  L
Sbjct  87   GAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPSL  146

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  V I++GD+ND  LL KL D V FTHV+HLAA
Sbjct  147  KRARQNLLSKHQVFIVKGDLNDGPLLTKLFDVVPFTHVLHLAA  189



>ref|XP_009127808.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brassica rapa]
Length=429

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_006412706.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
 gb|ESQ54159.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
Length=449

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGF+GSH SLALK+RGDGVLGLDNFNNYY+  L
Sbjct  86   GAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNNYYDPSL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  + I+EGD+ND  LL KL D V FTHV+HLAA
Sbjct  146  KRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPFTHVLHLAA  188



>emb|CDY70926.1| BnaCnng70410D [Brassica napus]
 emb|CDY28188.1| BnaA01g06610D [Brassica napus]
Length=429

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP WE++VR S+ PR  +GFSVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  76   GPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVLGLDNFNDYYDPSL  135

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LLA+  + I++GDIN+A LL KL D V F+HV+HLAA
Sbjct  136  KRARQALLAKQSIFIVDGDINNAYLLAKLFDVVPFSHVLHLAA  178



>ref|XP_006282616.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
 gb|EOA15514.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
Length=429

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE+++R SA     +G SVLVTGAAGFVGSHVSLALK+RGDGV+G+DNFNNYY+  L
Sbjct  72   GIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSL  131

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRARKSLL   G+ I+EGDINDA L+ KL D VAFTHVMHLAA
Sbjct  132  KRARKSLLNNQGIFIVEGDINDARLIAKLFDTVAFTHVMHLAA  174



>ref|XP_010432987.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=429

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_010438178.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=430

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|NP_194773.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 ref|XP_002867348.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9M0B6.1|GAE1_ARATH RecName: Full=UDP-glucuronate 4-epimerase 1; AltName: Full=UDP-glucuronic 
acid epimerase 1; Short=AtUGlcAE3 [Arabidopsis 
thaliana]
 emb|CAB79762.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07152.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAM20706.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM62729.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN15627.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAT77233.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|EFH43607.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE85765.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 gb|AFI41204.1| UDP-D-glucuronate 4-epimerase 1, partial [Arabidopsis thaliana]
Length=429

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  171



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  T   G   WE+++R SA      G SVLVTGAAGFVGSHVSLALK+RGD
Sbjct  56   QSFVDSGSRYFTASWGGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+G+DNFNNYY+  LK+ARKSLL   G+ I+EGDINDA L+ KL D VAFTHVMHLAA
Sbjct  116  GVVGIDNFNNYYDPSLKKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAFTHVMHLAA  174



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R +T   G   WE++VR+S+      G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  58   QSFVDSGSRYLTASWGGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGD  117

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARKSLL   G+ +IEGD+NDA LL KL D VAFTHVMHLAA
Sbjct  118  GVVGLDNFNNYYDPSLKKARKSLLISHGILVIEGDLNDAKLLAKLFDVVAFTHVMHLAA  176



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  262  PPASGASNRR-NLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHV  438
            PP S A N   +  +    S     G  WE++VR SA PR  +GFSVLVTGAAGFVGSH 
Sbjct  64   PPLSSADNHHIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHC  123

Query  439  SLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAF  618
            SLALK+RGDGVLGLDNFN+YY+  LKRAR+ LL++  + ++EGDINDA LL KL D V F
Sbjct  124  SLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLSKHEIFVVEGDINDAELLNKLFDVVPF  183

Query  619  THVMHLAA  642
            +HV+HLAA
Sbjct  184  SHVLHLAA  191



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 119/183 (65%), Gaps = 15/183 (8%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYrlrlqprlflrlilW-----SfvfvfvillfffiSPPASGAS  282
            DS+PSTPGKFK EKS +   R +    +  +L+       VF+  ++        ++   
Sbjct  2    DSIPSTPGKFKMEKSPYSPFRHRFHSSVAKLLFISLLFLAVFLLFLIKPPPSPSLSNPTE  61

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALP---RSKSGFSVLVTGAAGFVGSHVSLALK  453
             RRNL        T   G  WE+RVR+S+ P   RSK    VLVTGAAGFVGSHVS ALK
Sbjct  62   ARRNL------HSTTWGGQAWEKRVRSSSRPKPHRSKP-LIVLVTGAAGFVGSHVSAALK  114

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            RRGDGVLGLDNFN+YY+V LKRAR+SLL   GV I+EGDIND+ LL+KL D  AFTH++H
Sbjct  115  RRGDGVLGLDNFNHYYDVSLKRARQSLLNSQGVFIVEGDINDSSLLRKLFDVAAFTHILH  174

Query  634  LAA  642
            LAA
Sbjct  175  LAA  177



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = +1

Query  337  PNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            P WE+RV++SA  RS+SG F++LVTG AGFVGSHVS ALKRRGDGV+GLDNFN+YY+  L
Sbjct  50   PQWEKRVKSSA--RSRSGHFTILVTGVAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSL  107

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL R+G+ +IEGDIND  LL+KL D VAFTHVMHLAA
Sbjct  108  KRARQKLLERNGIFVIEGDINDNHLLKKLFDIVAFTHVMHLAA  150



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            + ++D  +R ++   G   WE++VRASA    + G SVLVTGAAGF+GSHVSLALKRRGD
Sbjct  60   QGVVDSGSRYLSASWGGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRRGD  119

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARK+LL   GV I+ GD+NDA LL KL D VAFTHVMHLAA
Sbjct  120  GVVGLDNFNDYYDPSLKKARKALLQSRGVFIVHGDLNDAKLLAKLFDVVAFTHVMHLAA  178



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 8/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E++                 ++      +   F I+  AS  S  ++ +D
Sbjct  11   FPSTPGKFKIERN------HGMMNRQVYRCFASTSTMFLWALFLIALTASYLS-FQSFVD  63

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R ++   G   WE++VR SA    + G SVLVTG+A FVGSHVSLALKRRGDGV+GL
Sbjct  64   SGSRYLSASWGGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRRGDGVVGL  123

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+ARK+LL+  GV I+EGDINDA LL KL D VAFTHVMHLAA
Sbjct  124  DNFNDYYDPSLKKARKTLLSSHGVFIVEGDINDAKLLAKLFDVVAFTHVMHLAA  177



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 110/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIERS-------HAMNRQFHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  60

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+GL
Sbjct  61   SGSRYFSASWGGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGL  120

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LK+ARKS+L   G+ I+EGDIND+ LL KL D VAFTHVMHLAA
Sbjct  121  DNFNNYYDPSLKKARKSMLNGHGIFIVEGDINDSRLLDKLFDVVAFTHVMHLAA  174



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 113/175 (65%), Gaps = 12/175 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrli-lWSfvfvfvillfffiSPPASGASNRRNLI  300
            +PSTPGKFK    A +R   +       + LW+   V +   +             ++ +
Sbjct  11   LPSTPGKFKDRSHAMHRQFHRCFASTSTMFLWALFLVALTAAYLSF----------QSFV  60

Query  301  DKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLG  477
            D  +R  +   G   WE++VR+SA    ++GFSVLVTGAAGFVG+HVSLALK+RGDGV+G
Sbjct  61   DSGSRYFSTAWGGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKRGDGVVG  120

Query  478  LDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LDNFNNYY+  LKRAR+ LL+   V I+EGD+NDA +L KL + VAFTHVMHLAA
Sbjct  121  LDNFNNYYDPVLKRARRDLLSSHNVFIVEGDVNDARMLAKLFEIVAFTHVMHLAA  175



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGF+GSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  86   GAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNDYYDPSL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  + I+EGD+ND  LL KL D V FTHV+HLAA
Sbjct  146  KRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPFTHVLHLAA  188



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PP + +++R   +   +  ++   G  WE+++R S+ PR  +G +VLVTGAAGFVGSH S
Sbjct  52   PPLADSTHRH--LHAHSHFLSSAFGA-WEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCS  108

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            LALKRRGDGVLGLDNFN YY+  LKRAR+++LA+  V I+EGD+ND  LLQKL D VAFT
Sbjct  109  LALKRRGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFT  168

Query  622  HVMHLAA  642
            H++HLAA
Sbjct  169  HILHLAA  175



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  83   GAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSL  142

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL +  + ++EGD+NDA LL+KL D V FTH++HLAA
Sbjct  143  KRARRDLLTKHQIFVVEGDLNDAELLEKLFDIVPFTHILHLAA  185



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PP + +++R   +   +  ++   G  WE+++R S+ PR  +G +VLVTGAAGFVGSH S
Sbjct  52   PPLADSTHRH--LHAHSHFLSSAFGA-WEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCS  108

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            LALKRRGDGVLGLDNFN YY+  LKRAR+++LA+  V I+EGD+ND  LLQKL D VAFT
Sbjct  109  LALKRRGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFT  168

Query  622  HVMHLAA  642
            H++HLAA
Sbjct  169  HILHLAA  175



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
            PP + +++R   +   +  ++   G  WE+++R S+ PR  +G +VLVTGAAGFVGSH S
Sbjct  52   PPLADSTHRH--LHAHSHFLSSAFGA-WEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCS  108

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            LALKRRGDGVLGLDNFN YY+  LKRAR+++LA+  V I+EGD+ND  LLQKL D VAFT
Sbjct  109  LALKRRGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAFT  168

Query  622  HVMHLAA  642
            H++HLAA
Sbjct  169  HILHLAA  175



>ref|XP_010047879.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW79891.1| hypothetical protein EUGRSUZ_C01241 [Eucalyptus grandis]
Length=432

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ ID   R  T   G   WE+RVR SA      G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  57   QSFIDSGNRYFTASWGGIQWEKRVRDSAQVHRPDGLSVLVTGAAGFVGTHVSLALKKRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARK+LL   GV I+EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  117  GVVGLDNFNSYYDPSLKKARKALLQGHGVFIVEGDVNDARLLAKLFDVVAFTHVMHLAA  175



>gb|KFK29619.1| hypothetical protein AALP_AA7G157500 [Arabis alpina]
Length=430

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+ND  LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDGKLLSKLFDVVAFTHVMHLAA  171



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE+RVR S+ PR  +GFSVLVTGAAGFVGSH S+ALK+RGDGVLGLDNFN+YY+  L
Sbjct  90   GAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNDYYDPSL  149

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL +  V I+EGD+ND  LL KL D V FTHV+HLAA
Sbjct  150  KRARQNLLEKHQVFIVEGDLNDGPLLTKLFDVVPFTHVLHLAA  192



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++L+   +R  T   G   WE++VR SA  R   G SVLVTG AGFVG+HVSLALK+RGD
Sbjct  54   QSLVHSGSRYFTASWGGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGD  113

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARK+LL   G+ ++EGDINDA LL KL D VAFTHVMHLAA
Sbjct  114  GVVGLDNFNNYYDPSLKKARKALLNNHGIFVVEGDINDARLLAKLFDIVAFTHVMHLAA  172



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE+++R SA      G SVLVTGAAGFVGSHVSLALK+RGDGV+G+DNFNNYY+  L
Sbjct  72   GIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPSL  131

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARKSLL   G+ I+EGDINDA L+ KL D VAFTHVMHLAA
Sbjct  132  KKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAFTHVMHLAA  174



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ ID  +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  56   QSFIDSGSRYFSASWGGIQWEKQVRTSAQIHRTGGMSVLVTGAAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARKS+L   G+ I++GD+NDA LL KL D VAFTHVMHLAA
Sbjct  116  GVVGLDNFNNYYDPSLKKARKSMLNNQGIFIVDGDVNDARLLAKLFDVVAFTHVMHLAA  174



>ref|XP_010447717.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Camelina sativa]
Length=430

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  9    FPSTPGKFKIDRS----------NRQLHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  57

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  58   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  117

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR+SLL+  G+ ++EGD+ND  LL KL D VAFTHVMHLAA
Sbjct  118  DNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDGKLLAKLFDVVAFTHVMHLAA  171



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPN--WERRVRASALPRSKSGFSVLVTGAAGFVGSH  435
            PP S ++N        +  +T   G    WER VR SA+PR  +GF+VLVTGAAGFVGSH
Sbjct  56   PPLSDSTNHH--FHTHSHFLTSAFGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSH  113

Query  436  VSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVA  615
             SLALK+RGDGV+GLDNFN+YY+  LKRAR++LL +  + I+EGD+NDA LL KL D V 
Sbjct  114  CSLALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVP  173

Query  616  FTHVMHLAA  642
             TH++HLAA
Sbjct  174  ITHILHLAA  182



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 9/133 (7%)
 Frame = +1

Query  262  PPASGAS------NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGF  423
            PP S +S      +RR+ +     S     G  WE++VR S+ PR  +GFSVLVTGAAGF
Sbjct  56   PPLSSSSTSDHAPHRRSFLSSTFSSAG---GAAWEKQVRHSSTPRRPNGFSVLVTGAAGF  112

Query  424  VGSHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLL  603
            VGSH SLALK+RGDGVLGLDNFN+YY+  LKRAR++LL +  + I+EGD+ND  LL KL 
Sbjct  113  VGSHCSLALKKRGDGVLGLDNFNDYYDPSLKRARQALLQKHQIFIVEGDLNDGPLLTKLF  172

Query  604  DAVAFTHVMHLAA  642
            D V FTHV+HLAA
Sbjct  173  DVVPFTHVLHLAA  185



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPN--WERRVRASALPRSKSGFSVLVTGAAGFVGSH  435
            PP S ++N        +  +T   G    WER VR SA+PR  +GF+VLVTGAAGFVGSH
Sbjct  56   PPLSDSTNHH--FHTHSHFLTSAFGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSH  113

Query  436  VSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVA  615
             SLALK+RGDGV+GLDNFN+YY+  LKRAR++LL +  + I+EGD+NDA LL KL D V 
Sbjct  114  CSLALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVP  173

Query  616  FTHVMHLAA  642
             TH++HLAA
Sbjct  174  ITHILHLAA  182



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 113/182 (62%), Gaps = 14/182 (8%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAFYrlrlqprlflrlilW-SfvfvfvillfffiSPPASGASNRRN  294
            DS PSTPGK K ++S +        L  ++  W S     V    F ++  AS A  + +
Sbjct  7    DSFPSTPGKVKIDRSHY-------NLSRQINRWLSSSATLVFWSLFLLALTASFACLKTS  59

Query  295  LIDKQ------TRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKR  456
                Q      T +     GP WE+++R S   R  +   VLVTGAAGF+G+HVSLALK+
Sbjct  60   FTVPQSHARGATTAAASWGGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKK  119

Query  457  RGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHL  636
            RGDGVLGLDNFN+YY+  LKRAR+SLLAR G+ + EGDIND  LL KLLD V FTHVMHL
Sbjct  120  RGDGVLGLDNFNDYYDPSLKRARQSLLARHGIFVAEGDINDGALLSKLLDFVPFTHVMHL  179

Query  637  AA  642
            AA
Sbjct  180  AA  181



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  337  PNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            P WE+RVR SA  RS+SG  SVLVTGAAGFVGSHVS ALKRRGDGV+GLDNFN+YY+  L
Sbjct  50   PQWEKRVRLSA--RSRSGHLSVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSL  107

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL + GV +IEGDIND  LL+KL D V FTHVMHLAA
Sbjct  108  KRARQKLLEQKGVFVIEGDINDEKLLKKLFDIVEFTHVMHLAA  150



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  295  LIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVL  474
            L+    R +    G  WE+RV +SA PRS +G +VLVTGAAGF+GSHVS AL+ RGDGV+
Sbjct  39   LLSDNDRRLLRNRGKGWEQRVLSSASPRSSTGSTVLVTGAAGFIGSHVSAALRNRGDGVV  98

Query  475  GLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GLDNFNNYY+V LK  R+++L  SGV I++GDIND VLL+KL   V FTHVMHLAA
Sbjct  99   GLDNFNNYYDVSLKHDRRAMLESSGVFIVDGDINDQVLLKKLFSIVQFTHVMHLAA  154



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE++VR SA    ++GFSVLVTGAAGFVGSHVSLALK+RGDGV+GLDNFNNYY+  L
Sbjct  73   GIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDPSL  132

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARK LL    V I+EGD+NDA LL KL + VAFTHVMHLAA
Sbjct  133  KKARKHLLNSHNVFIVEGDVNDARLLAKLFEIVAFTHVMHLAA  175



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  TR ++   G  +WE++VR SA     +G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  56   QSFMDSGTRYLSSTWGSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARK+LL    + I+EGDINDA +L KL D VAFTHVMHLAA
Sbjct  116  GVVGLDNFNNYYDPSLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAFTHVMHLAA  174



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGFVG+H SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  83   GATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSL  142

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  + I++GD+NDA LL KL D V FTHV+HLAA
Sbjct  143  KRARQALLSKHEIFIVKGDLNDAPLLSKLFDVVPFTHVLHLAA  185



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGF+GSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  86   GAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCSLALKKRGDGVLGLDNFNDYYDPSL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL++  + I+EGD+ND  LL KL D V FTHV+HLAA
Sbjct  146  KRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPFTHVLHLAA  188



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 113/184 (61%), Gaps = 10/184 (5%)
 Frame = +1

Query  94   PKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPAS  273
            P +VL   D  PSTPGK K E+S ++                 +   ++LL        S
Sbjct  2    PPSVL---DEFPSTPGKVKMERSNYFGRVGSRWHSSVSAKLLCLTSILLLLTISAFFWVS  58

Query  274  GASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLAL  450
             A      ID Q R  T Q    WE+RVR S LPR +     VLVTGAAGFVGSHVSLAL
Sbjct  59   SAG-----IDSQ-RPPTFQRSHEWEKRVRQSCLPRREDNPLVVLVTGAAGFVGSHVSLAL  112

Query  451  KRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVM  630
            ++RGDGV+GLDNFN+YYEV LKRAR+ LLA+  V +I+GDIND  +++ +L+AV  THVM
Sbjct  113  RKRGDGVVGLDNFNSYYEVSLKRARQELLAKHSVFVIDGDINDKFIIESILEAVPITHVM  172

Query  631  HLAA  642
            HLAA
Sbjct  173  HLAA  176



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  100  GAEWEKQVRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSL  159

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL +  V I+EGD+NDA LL KL D V FTHV+HLAA
Sbjct  160  KRARQKLLQKHQVFIVEGDLNDAPLLTKLFDVVPFTHVLHLAA  202



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQL----GPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
            P AS   N  N I   T ++        G +WE++VR S+ P   +GFSVLVTGAAGFVG
Sbjct  57   PLASDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVG  116

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            SH SLALK+RGDGVLGLDNFN+YY+  LKRAR++LL++  + I+EGD+ND  LL+KL D 
Sbjct  117  SHSSLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDLNDVELLRKLFDI  176

Query  610  VAFTHVMHLAA  642
            V FTHV+HLAA
Sbjct  177  VPFTHVLHLAA  187



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  100  GAEWEKQVRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSL  159

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL +  V I+EGD+NDA LL KL D V FTHV+HLAA
Sbjct  160  KRARQKLLQKHQVFIVEGDLNDAPLLTKLFDVVPFTHVLHLAA  202



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  100  GAEWEKQVRHSATPRRPNGMTVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSL  159

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL +  V I+EGD+NDA LL KL D V FTHV+HLAA
Sbjct  160  KRARQKLLQKHQVFIVEGDLNDAPLLTKLFDVVPFTHVLHLAA  202



>emb|CDX72242.1| BnaC07g42640D [Brassica napus]
Length=430

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 109/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  10   FPSTPGKFKIDRS----------NRQLNRCFASTSTMFLWALFLIALTASYLS-FQSFVD  58

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  59   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  118

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR SLL+  G+ ++EGD+ND  LL KL D VAFTHVMHLAA
Sbjct  119  DNFNNYYDPSLKRARMSLLSSRGIFVVEGDLNDGKLLSKLFDVVAFTHVMHLAA  172



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ P+ ++G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  85   GAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPTL  144

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL R  V I+EGD+NDA LL+KL D V FTH++HLAA
Sbjct  145  KRARQKLLLRHEVFIVEGDLNDASLLRKLFDVVPFTHILHLAA  187



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE++VR S+ PR  +GFSVLVTGA GFVG+H SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  80   GASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKRGDGVLGLDNFNDYYDPSL  139

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+++L++  + I+EGD+NDA LL KL D V FTH++HLAA
Sbjct  140  KRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVPFTHILHLAA  182



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  TR ++   G  +WE++VR SA     +G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  56   QSFMDSGTRYLSSTWGSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARK+LL    + I+EGDINDA +L KL D VAFTHVMHLAA
Sbjct  116  GVVGLDNFNNYYDPTLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAFTHVMHLAA  174



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ P+ ++G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  86   GAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPTL  145

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL R  V I+EGD+NDA LL+KL D V FTH++HLAA
Sbjct  146  KRARQKLLLRHEVFIVEGDLNDASLLRKLFDVVPFTHILHLAA  188



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFSVLVTGAAGFVG+H +LALK+RGDGVLGLDNFN+YY+  L
Sbjct  82   GATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHCALALKKRGDGVLGLDNFNSYYDPSL  141

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+SLL++  + ++E D+NDA LL KL D V FTHV+HLAA
Sbjct  142  KRARQSLLSKHQIFVVEADLNDAPLLSKLFDVVPFTHVLHLAA  184



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  ++  T   G   WE++VR SA      G SVLVTGAAGFVGSHVSLALK+RGD
Sbjct  59   QSFVDTSSKYFTASWGGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGSHVSLALKKRGD  118

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LKRARK+LL   G+ I+E DIND  +L KL D VAFTHVMHLAA
Sbjct  119  GVVGLDNFNNYYDPSLKRARKNLLESHGITILEADINDVKILAKLFDTVAFTHVMHLAA  177



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WER+VR SA PR  +GF+VLVTGAAGFVGSH SLALK+RGDGV+GLDNFNNYY+  L
Sbjct  80   GGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCSLALKKRGDGVIGLDNFNNYYDPSL  139

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL++  + I+EGD+ND  LL KL D V  TH++HLAA
Sbjct  140  KRARQDLLSQHQIFIVEGDLNDGPLLSKLFDVVPITHILHLAA  182



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA      G SVLVTGAAGFVGSHVSLALK+RGDG +GLDNFNNYY+  L
Sbjct  69   GIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKRGDGAVGLDNFNNYYDPSL  128

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+SLL+  G+ ++EGD+ND+ LL KL D VAFTHVMHLAA
Sbjct  129  KRARRSLLSSRGIFVVEGDLNDSKLLAKLFDVVAFTHVMHLAA  171



>emb|CDY39205.1| BnaA03g50170D [Brassica napus]
Length=430

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 109/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK ++S                 ++      +   F I+  AS  S  ++ +D
Sbjct  10   FPSTPGKFKIDRS----------NRQLNRCFASTSTMFLWALFLIALTASYLS-FQSFVD  58

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R +T   G   WE++VR SA      G SVLVTGA GFVGSHVSLAL++RGDGV+GL
Sbjct  59   SGSRYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGL  118

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFNNYY+  LKRAR SLL+  G+ ++EGD+ND  L+ KL D VAFTHVMHLAA
Sbjct  119  DNFNNYYDPSLKRARMSLLSSRGIFVVEGDLNDGKLMSKLFDVVAFTHVMHLAA  172



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP WE +VR SALPR   G SVLVTGAAGFVGSH SL+LK+RGDGVLGLDNFN+YY+  L
Sbjct  127  GPAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCSLSLKKRGDGVLGLDNFNSYYDPSL  186

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LLA+  + IIE D+NDA LL K+ D V+F+HV+HLAA
Sbjct  187  KRARQHLLAKHQILIIEADLNDAPLLAKIFDVVSFSHVLHLAA  229



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+GLDNFNNYY+  L
Sbjct  72   GIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPSL  131

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARKSLL   G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  132  KKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  174



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE++VR S+ PR  +GFSVLVTGA GFVG+H SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  80   GASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKRGDGVLGLDNFNDYYDPSL  139

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+++L++  + I+EGD+NDA LL KL D V FTH++HLAA
Sbjct  140  KRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVPFTHILHLAA  182



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGD
Sbjct  56   QSFVDSGSRYFSASWGGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFNNYY+  LK+ARKSLL   G+ ++EGD+NDA LL KL D VAFTHVMHLAA
Sbjct  116  GVVGLDNFNNYYDPSLKKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAFTHVMHLAA  174



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  337  PNWERRVRASALPRSKSG-FSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            P WE+RVR SA  RS+SG  SVLVTGAAGFVGSHVS ALKRRGDGV+GLDNFN+YY+  L
Sbjct  50   PQWEKRVRLSA--RSRSGHLSVLVTGAAGFVGSHVSAALKRRGDGVVGLDNFNSYYDPSL  107

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL + GV ++EGDIND  LL+KL D V FTHVMHLAA
Sbjct  108  KRARQKLLEQKGVFVMEGDINDEKLLKKLFDIVEFTHVMHLAA  150



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +1

Query  283  NRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRG  462
            N R+L+     S     G  WER VR SA PRS SG +VLVTGAAGFVG+H SLALK+RG
Sbjct  75   NHRSLLS----SAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGTHCSLALKKRG  130

Query  463  DGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DGV+GLDNFN+YY   LKRAR+SLL+R GV +++ DIND  LL KL D V F+HV+HLAA
Sbjct  131  DGVVGLDNFNSYYNPSLKRARQSLLSRHGVLVLDADINDTPLLTKLFDVVPFSHVLHLAA  190



>ref|XP_004985001.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Setaria italica]
Length=500

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  304  KQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLD  483
            KQ  S+T + G   E++VRASA  R   G+SVLVTGAAGFVG H + AL+RRGDGVLGLD
Sbjct  106  KQITSITIEPGVEVEKKVRASARVRRPRGYSVLVTGAAGFVGCHAAAALRRRGDGVLGLD  165

Query  484  NFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            NFN+YY+  LKR R +LLARSGV++++GDI DA LL KL D V FTHV+HLAA
Sbjct  166  NFNDYYDTALKRGRAALLARSGVYVVDGDIADAELLAKLFDVVPFTHVLHLAA  218



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 111/176 (63%), Gaps = 8/176 (5%)
 Frame = +1

Query  118  DSMPSTPGKFKPEKSAF-YrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRN  294
            ++ PSTPGK KP+K    +R+      +  + +    F+  +L   F  PP S  + RR 
Sbjct  8    ETTPSTPGKLKPDKPHHRFRIHPPHSRYTFICILLSAFLVFLLFSTFNPPPPSTTAPRRV  67

Query  295  LIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVL  474
            L D          G +WER V  S    S S   VLVTG+AGFVGSHV+LALKRRGDGVL
Sbjct  68   LGDSWG-------GSHWERLVSKSTRRNSASNKIVLVTGSAGFVGSHVALALKRRGDGVL  120

Query  475  GLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            G+DNFN YY+V LK AR+ LL R+G+ ++EGDIND  LL+KL D V FTHVMHLAA
Sbjct  121  GIDNFNRYYDVNLKHARQKLLERAGIFVVEGDINDGTLLKKLFDVVPFTHVMHLAA  176



>ref|XP_010053408.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW77692.1| hypothetical protein EUGRSUZ_D01992 [Eucalyptus grandis]
Length=437

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 125/187 (67%), Gaps = 7/187 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEK-SAFYrlrlqprlflrlilWSfvfvfvillfffiS  261
            M QPK + SHFD  PSTPGK KP++ SA+           +L + S +F+ +++      
Sbjct  1    MSQPKAI-SHFDLAPSTPGKLKPDRLSAYIHRLRFQAPLFKLTIGSALFLGLVVFLVVSC  59

Query  262  PPASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVS  441
             P++        I   +R      G  WERRVR+SA  R+ +G  VLVTGA+GFVG+HV 
Sbjct  60   SPSAPPPPSPRRILGDSRG-----GSYWERRVRSSARARAHAGHVVLVTGASGFVGTHVC  114

Query  442  LALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFT  621
            L LKRRGDGV+GLDNFN+YY+V LKRAR++LL R+GV ++EGDIND  L++KL D VAFT
Sbjct  115  LHLKRRGDGVVGLDNFNDYYDVELKRARQTLLGRAGVFVVEGDINDRELMEKLFDMVAFT  174

Query  622  HVMHLAA  642
            HVMHLAA
Sbjct  175  HVMHLAA  181



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +1

Query  334  GPNWERRVRASA-LPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVG  510
            G  WE++VR SA + R   G SVLVTGAAGFVG+HVSLALK+RGDGV+GLDNFNNYY+  
Sbjct  73   GLQWEKQVRNSAQIHRPSGGVSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPS  132

Query  511  LKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LK+ARKSLL   GV I+EGD+NDA LL KL D VAF+HVMHLAA
Sbjct  133  LKKARKSLLNSHGVFIVEGDVNDARLLAKLFDVVAFSHVMHLAA  176



>ref|XP_002468173.1| hypothetical protein SORBIDRAFT_01g041030 [Sorghum bicolor]
 gb|EER95171.1| hypothetical protein SORBIDRAFT_01g041030 [Sorghum bicolor]
Length=480

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VRASA  R   G SVLVTGAAGFVG H + AL+RRGDGVLGLDNFN+YY+ GL
Sbjct  96   GAAWEKKVRASARVRRSMGHSVLVTGAAGFVGCHAAAALRRRGDGVLGLDNFNDYYDTGL  155

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R +LLARSGV++++GDI DA LL KL D V FTHV+HLAA
Sbjct  156  KRGRAALLARSGVYVVDGDIADAELLAKLFDVVPFTHVLHLAA  198



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +G SVLVTGAAGFVGSH S+ALK+RGDGVLG+DNFN+YY+  L
Sbjct  84   GAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPSL  143

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ LLA+  + I+EGDINDA LL KL D V FTHV+HLAA
Sbjct  144  KRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPFTHVLHLAA  186



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WE+++RASA  R   G SVLVTGAAGFVGSHVSLAL++RGDGV+GLDNFN YY+  L
Sbjct  72   GLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNTYYDPSL  131

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            K+ARKSLL   G+ ++EGDIND  LL KL D V FTHVMHLAA
Sbjct  132  KKARKSLLVSHGIVVVEGDINDGRLLAKLFDVVPFTHVMHLAA  174



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +G SVLVTGAAGFVGSH S+ALK+RGDGVLG+DNFN+YY+  L
Sbjct  88   GAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPSL  147

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ LLA+  V I+EGDINDA LL KL D V FTHV+HLAA
Sbjct  148  KRGRQKLLAQHEVFIVEGDINDAELLSKLFDIVPFTHVLHLAA  190



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  TR ++   G  +WE++VR SA     +G SVLVTGAAGFVGSHVS+ALK+RGD
Sbjct  56   QSFMDSGTRYLSSTWGSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+G+DNFNNYY+  LK+ARK+LL    V +IEGDIND  LL KL D VAFTHVMHLAA
Sbjct  116  GVVGIDNFNNYYDPSLKKARKNLLNLQNVFVIEGDINDVHLLAKLFDIVAFTHVMHLAA  174



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 130/186 (70%), Gaps = 8/186 (4%)
 Frame = +1

Query  85   MIQPKTVLSHFDSMPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSP  264
            M Q K  ++H D+ P TPGKFKP    +           +L LWS VF+ +ILLFFF S 
Sbjct  1    MTQLKQ-MAHLDNGPPTPGKFKP----YIHRVRWQSSLAKLSLWSLVFLALILLFFFRS-  54

Query  265  PASGASNRRNLIDKQTRSVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSL  444
                +S+  +   +++    +  GP WE+RVR+S+  RS++G SVLVTGAAGFVG+HVS 
Sbjct  55   --PSSSSVPSDPSRRSLRTYNWGGPAWEKRVRSSSRVRSRNGMSVLVTGAAGFVGTHVSA  112

Query  445  ALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTH  624
            ALKRRGDGVLGLD+FN+YY+  LKRAR++LL RSGV I+EGDIND  LL KL + VAFTH
Sbjct  113  ALKRRGDGVLGLDSFNDYYDPSLKRARQALLERSGVFIVEGDINDMALLSKLFEVVAFTH  172

Query  625  VMHLAA  642
            VMHLAA
Sbjct  173  VMHLAA  178



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WER+VR SA PR  +GFSVLVTGAAGFVGSH SLALK+RGDGV+GLDNFN YY+  L
Sbjct  80   GGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKRGDGVVGLDNFNTYYDPSL  139

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR++LL +  + I EGD+ND  LL KL D V FTH++HLAA
Sbjct  140  KRARQALLTQHQIFIAEGDLNDTPLLTKLFDLVPFTHILHLAA  182



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 110/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      + + F I+  AS  S  ++ +D
Sbjct  10   FPSTPGKFKIERS-------HAMNRQFHRCFASTSTMFLWVLFLIALTASYLS-FQSFVD  61

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+G+
Sbjct  62   SGSRYFSASWGGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGI  121

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+AR+SLL   GV I+EGDIND  LL KL D VAFTHVMHLAA
Sbjct  122  DNFNSYYDPSLKKARRSLLETHGVFIVEGDINDNRLLDKLFDTVAFTHVMHLAA  175



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  331  LGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVG  510
            L   WE +VR SALPR  +G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YY+  
Sbjct  51   LSSAWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNPYYDPS  110

Query  511  LKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LKRAR+ LLA+  + IIE D+NDA LL KL D V+F+HV+HLAA
Sbjct  111  LKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSFSHVLHLAA  154



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ P+  +G SVLVTGAAGFVGSH S+ALK+RGDGVLGLDNFN+YY+  L
Sbjct  85   GDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNSYYDPSL  144

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL ++ V I+EGD+NDA LL KL D V FTH++HLAA
Sbjct  145  KRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPFTHILHLAA  187



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            GP+WE++VR S   + ++G  VLVTGAAGFVGSHVSLALK+RGDGVLG+DNFNNYY+  L
Sbjct  71   GPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVSLALKKRGDGVLGIDNFNNYYDPSL  130

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR+R+ +L   G+ I+EGDIND  LL+KL D V F+HVMHLAA
Sbjct  131  KRSRQRVLENHGIFIVEGDINDRYLLKKLFDVVPFSHVMHLAA  173



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 118/183 (64%), Gaps = 6/183 (3%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlfl---rlilWSfvfvfvillfffiSPPASGAS  282
            H  S PSTPGK K E+S ++             +++ W    + ++++  F    + G  
Sbjct  7    HDCSFPSTPGKVKMERSNYFGRVASRWQSFGPGKIVFWCVALLALLVVAVFFYATSPGVH  66

Query  283  N--RRNLIDKQTRS-VTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
            N   ++L  ++ ++ V    G  WE+ VR SA  + ++G  VLVTGAAGFVG+HVSLALK
Sbjct  67   NSFEQSLSLREAKNDVVSWGGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALK  126

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            +RGDGV+GLDNFN+YY+  LKRAR+ LL + GV ++EGDIN+  LL+KL D + FTHVMH
Sbjct  127  KRGDGVIGLDNFNSYYDPFLKRARQGLLEKQGVFVVEGDINNIALLRKLFDVITFTHVMH  186

Query  634  LAA  642
            LAA
Sbjct  187  LAA  189



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  343  WERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGLKRA  522
            WE+++R SA     +G SVLVTGAAGFVGSHVSLALK+RGDGV+G+DNFNNYY+  LKRA
Sbjct  75   WEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPLLKRA  134

Query  523  RKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            RKSLL   G+ I+EGDINDA L+  L D VAFTHVMHLAA
Sbjct  135  RKSLLNNQGIFIVEGDINDARLIAMLFDTVAFTHVMHLAA  174



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 118/183 (64%), Gaps = 6/183 (3%)
 Frame = +1

Query  112  HFDSMPSTPGKFKPEKSAFYrlrlqprlfl---rlilWSfvfvfvillfffiSPPASGAS  282
            H  S PSTPGK K E+S ++             +++ W    + ++++  F    + G  
Sbjct  7    HDCSFPSTPGKVKMERSNYFGRVASRWQSFGPGKIVFWCVALLALLVVAVFFYATSPGVH  66

Query  283  N--RRNLIDKQTRS-VTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALK  453
            N   ++L  ++ ++ V    G  WE+ VR SA  + ++G  VLVTGAAGFVG+HVSLALK
Sbjct  67   NSFEQSLSLREAKNDVVSWGGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALK  126

Query  454  RRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMH  633
            +RGDGV+GLDNFN+YY+  LKRAR+ LL + GV ++EGDIN+  LL+KL D + FTHVMH
Sbjct  127  KRGDGVIGLDNFNSYYDPFLKRARQGLLEKQGVFVVEGDINNIALLRKLFDVITFTHVMH  186

Query  634  LAA  642
            LAA
Sbjct  187  LAA  189



>ref|XP_003611251.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES94209.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=430

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSG--FSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEV  507
            GP WE+RV  S    S SG   +VLVTGA+GFVG HVSLALKRRGDGVLG+DNFN YY++
Sbjct  69   GPEWEKRVTKSTRHNSPSGSPLTVLVTGASGFVGMHVSLALKRRGDGVLGIDNFNRYYDI  128

Query  508  GLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
             LKR R  +L+R+GV ++EGDIND  LL+KL D VAFTHVMHLAA
Sbjct  129  NLKRTRAKVLSRAGVFVVEGDINDVHLLRKLFDVVAFTHVMHLAA  173



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  ++ ++   G  +WE+++R SA  R   G SVLVTGAAGFVGSHVS+AL +RGD
Sbjct  56   QSFVDTSSKYLSASWGGLHWEKQIRVSAEVRRAHGISVLVTGAAGFVGSHVSIALHKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+ARKSLLA  G+ ++EGDIND  LL KL D V FTHVMHLAA
Sbjct  116  GVVGLDNFNSYYDPSLKKARKSLLASHGIFVVEGDINDGRLLSKLFDVVPFTHVMHLAA  174



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ I+  TR ++   G  +WE++VR SA     +G SVLVTGAAGFVGSHVS+ALK+RGD
Sbjct  56   QSFINSGTRYLSSTWGSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGD  115

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+G+DNFNNYY+  LK+ARK LL    V++IEGDIND  L+ KL D VAFTHVMHLAA
Sbjct  116  GVVGIDNFNNYYDPSLKKARKDLLNLQNVYLIEGDINDVHLISKLFDIVAFTHVMHLAA  174



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 109/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      +   F I+  AS  S  ++ +D
Sbjct  10   FPSTPGKFKIERS-------HGMNRQFHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  61

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+G+
Sbjct  62   SGSRYFSASWGGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGI  121

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+AR+SLL   GV I+EGDIND  LL KL D VAFTHVMHLAA
Sbjct  122  DNFNSYYDPSLKKARRSLLKSHGVFIVEGDINDNRLLDKLFDTVAFTHVMHLAA  175



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 109/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  124  MPSTPGKFKPEKSAFYrlrlqprlflrlilWSfvfvfvillfffiSPPASGASNRRNLID  303
             PSTPGKFK E+S                 ++      +   F I+  AS  S  ++ +D
Sbjct  10   FPSTPGKFKIERS-------HGMNRQFHRCFASTSTMFLWALFLIALTASYLS-FQSFVD  61

Query  304  KQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGL  480
              +R  +   G   WE++VR SA      G SVLVTGAAGFVG+HVSLALK+RGDGV+G+
Sbjct  62   SGSRYFSASWGGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGI  121

Query  481  DNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            DNFN+YY+  LK+AR+SLL   GV I+EGDIND  LL KL D VAFTHVMHLAA
Sbjct  122  DNFNSYYDPSLKKARRSLLKSHGVFIVEGDINDNRLLDKLFDTVAFTHVMHLAA  175



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  331  LGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVG  510
            L   WE +VR SALPR  +G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YY+  
Sbjct  51   LSSAWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNPYYDPS  110

Query  511  LKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            LKRAR+ LLA+  + IIE D+NDA LL KL D V+F+HV+HLAA
Sbjct  111  LKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSFSHVLHLAA  154



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLGP-NWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R      G  +WE+++RASA  R   G SVLVTGAAGFVG+HVSLAL++RGD
Sbjct  57   QSFVDTSSRYFNASWGGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+GLDNFN+YY+  LK+AR++LL   GV ++EGDI+DA LL KL D V FTHVMHLAA
Sbjct  117  GVVGLDNFNSYYDPSLKKAREALLESHGVFVVEGDIDDARLLAKLFDVVPFTHVMHLAA  175



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +GFS+LVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YY+  L
Sbjct  83   GATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCSIALKKRGDGVLGLDNFNRYYDPSL  142

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL+R  + I+E D+ND  +L KL D V FTHV+HLAA
Sbjct  143  KRARQKLLSRQQIFIVEADLNDNPMLMKLFDIVPFTHVLHLAA  185



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ P+  +G SVLVTGAAGFVGSH S+ALK+RGDGVLGLDNFN+YY+  L
Sbjct  85   GDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKRGDGVLGLDNFNSYYDPSL  144

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRAR+ LL ++ V I+EGD+NDA LL KL D V FTH++HLAA
Sbjct  145  KRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPFTHILHLAA  187



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G +WER+VRASA  R ++GFSVLVTGAAGFVGSHVSLALK+RGDGV+GLDNFN+YY+  L
Sbjct  71   GGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPSL  130

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KRARK +L    + ++EGDIND  +L KL +   FTHVMHLAA
Sbjct  131  KRARKRILNSREIFVVEGDINDGRMLAKLFEIADFTHVMHLAA  173



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR S+ PR  +G SVLVTGAAGFVGSH S+ALK+RGDGVLG+DNFN+YY+  L
Sbjct  84   GAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKRGDGVLGIDNFNSYYDPLL  143

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR R+ LLA+  + I+EGDINDA LL KL D V FTHV+HLAA
Sbjct  144  KRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPFTHVLHLAA  186



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  289  RNLIDKQTRSVTDQLG-PNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGD  465
            ++ +D  +R  +   G  +WE++V++SA     +GFSVLVTGAAGFVGSHVSLALK+RGD
Sbjct  57   QSFVDSGSRYFSSAWGGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKRGD  116

Query  466  GVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            GV+G DNFNNYY+  LK+ARK+LL    V I+EGD+NDA L+ KL D V FTHVMHLAA
Sbjct  117  GVVGFDNFNNYYDPLLKKARKALLNSHNVFIVEGDVNDAKLIAKLFDIVEFTHVMHLAA  175



>ref|XP_008660337.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Zea mays]
 gb|AFW88969.1| hypothetical protein ZEAMMB73_845050 [Zea mays]
Length=479

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  316  SVTDQLGPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNN  495
            S T   G  WE++VRASA  R   G SVLVTGAAGFVG H + AL+RRGDGVLGLDNFN+
Sbjct  89   STTSWGGAAWEKKVRASARIRRSGGHSVLVTGAAGFVGCHAAAALRRRGDGVLGLDNFND  148

Query  496  YYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            YY+  LKR R +LLARSGV+++ GDI DA LL KL D V FTHV+HLAA
Sbjct  149  YYDTALKRGRAALLARSGVYVVHGDIADAELLAKLFDVVPFTHVLHLAA  197



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +1

Query  262  PPASGASNRRNLIDKQTRSVTDQL----GPNWERRVRASALPRSKSGFSVLVTGAAGFVG  429
            PP +   +  N I   T ++        G +WE++VR S+ P   +G SVLVTGAAGFVG
Sbjct  60   PPLTSEKSFNNNIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVG  119

Query  430  SHVSLALKRRGDGVLGLDNFNNYYEVGLKRARKSLLARSGVHIIEGDINDAVLLQKLLDA  609
            SH SLALK+RGDGVLGLDNFN+YY+  LKRAR+  L++  + I+EGDIND  LL+KL D 
Sbjct  120  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQDQLSKHQIFIVEGDINDTELLKKLFDI  179

Query  610  VAFTHVMHLAA  642
            V FTH++HLAA
Sbjct  180  VPFTHILHLAA  190



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  334  GPNWERRVRASALPRSKSGFSVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNNYYEVGL  513
            G  WE++VR SA PR  +G SVLVTGAAGFVGSH SLALK+RGDGVLGLDNFN+YY+  L
Sbjct  91   GTAWEKQVRKSATPRRPNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSL  150

Query  514  KRARKSLLARSGVHIIEGDINDAVLLQKLLDAVAFTHVMHLAA  642
            KR+R++LL +  V ++EGD+ND  LL KL D V FTH++HLAA
Sbjct  151  KRSRQALLKKHEVFVVEGDLNDEPLLTKLFDVVPFTHILHLAA  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375