BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF023A14

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339846.1|  PREDICTED: transcription factor MYB44-like         272   2e-86   
ref|XP_010315996.1|  PREDICTED: transcription factor MYB44-like         272   2e-86   Solanum lycopersicum
gb|AAG08959.1|AF122051_1  tuber-specific and sucrose-responsive e...    266   2e-84   Solanum tuberosum [potatoes]
ref|XP_009588514.1|  PREDICTED: transcription factor MYB44              266   2e-84   Nicotiana tomentosiformis
ref|XP_009798591.1|  PREDICTED: transcription factor MYB44              265   6e-84   Nicotiana sylvestris
ref|XP_007155887.1|  hypothetical protein PHAVU_003G240200g             255   5e-81   Phaseolus vulgaris [French bean]
gb|AEO27498.1|  MYB2                                                    256   6e-81   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011099313.1|  PREDICTED: transcription factor MYB44-like         256   2e-80   Sesamum indicum [beniseed]
ref|XP_010244270.1|  PREDICTED: transcription factor MYB44              255   2e-80   Nelumbo nucifera [Indian lotus]
gb|AIK01747.1|  MYB                                                     254   3e-80   Chrysanthemum indicum var. aromaticum
ref|XP_004511885.1|  PREDICTED: transcription factor MYB44-like         254   4e-80   Cicer arietinum [garbanzo]
ref|XP_003524661.1|  PREDICTED: transcription factor MYB44              253   6e-80   Glycine max [soybeans]
gb|AHB59606.1|  putative MYB-related protein 20                         254   9e-80   Arachis hypogaea [goober]
ref|XP_010271172.1|  PREDICTED: transcription factor MYB44-like         253   1e-79   Nelumbo nucifera [Indian lotus]
gb|ACJ85153.1|  unknown                                                 248   2e-79   Medicago truncatula
gb|AFK47194.1|  unknown                                                 252   2e-79   Medicago truncatula
gb|ABN11121.1|  MYB transcription factor                                253   2e-79   Capsicum annuum
ref|NP_001235731.1|  MYB transcription factor MYB178                    245   1e-78   Glycine max [soybeans]
gb|ABQ10818.1|  putative R2R3-Myb transcription factor                  249   2e-78   Citrus sinensis [apfelsine]
ref|XP_004287994.1|  PREDICTED: transcription factor MYB44-like         249   3e-78   Fragaria vesca subsp. vesca
gb|KDP31997.1|  hypothetical protein JCGZ_12458                         249   5e-78   Jatropha curcas
ref|XP_006425988.1|  hypothetical protein CICLE_v10026107mg             248   6e-78   Citrus clementina [clementine]
gb|ABQ10819.1|  putative R2R3-Myb transcription factor                  248   6e-78   Citrus sinensis [apfelsine]
ref|NP_001275856.1|  putative R2R3-Myb transcription factor             248   7e-78   Citrus sinensis [apfelsine]
ref|XP_002310702.1|  hypothetical protein POPTR_0007s10490g             248   8e-78   Populus trichocarpa [western balsam poplar]
ref|XP_011006987.1|  PREDICTED: transcription factor MYB44-like         248   8e-78   Populus euphratica
gb|KDO79069.1|  hypothetical protein CISIN_1g021071mg                   246   1e-77   Citrus sinensis [apfelsine]
emb|CDP02540.1|  unnamed protein product                                249   1e-77   Coffea canephora [robusta coffee]
ref|XP_002285015.1|  PREDICTED: transcription factor MYB44-like         246   2e-77   Vitis vinifera
ref|XP_011010210.1|  PREDICTED: transcription factor MYB44-like         247   3e-77   Populus euphratica
ref|XP_008360495.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    242   4e-77   
ref|XP_006374871.1|  hypothetical protein POPTR_0014s02260g             246   5e-77   Populus trichocarpa [western balsam poplar]
gb|AFH03065.1|  R2R3-MYB transcription factor MYB13                     246   7e-77   Epimedium sagittatum
ref|XP_011097391.1|  PREDICTED: transcription factor MYB44              248   8e-77   
gb|KDP41681.1|  hypothetical protein JCGZ_16088                         245   9e-77   Jatropha curcas
ref|XP_003611666.1|  R2R3-MYB transcription factor                      245   9e-77   
ref|NP_001235688.1|  MYB transcription factor MYB61                     245   9e-77   Glycine max [soybeans]
ref|XP_009795719.1|  PREDICTED: transcription factor MYB44-like         246   1e-76   Nicotiana sylvestris
ref|XP_008391509.1|  PREDICTED: transcription factor MYB44-like         244   1e-76   
emb|CAN75196.1|  hypothetical protein VITISV_014739                     244   1e-76   Vitis vinifera
ref|XP_011029247.1|  PREDICTED: transcription factor MYB44-like         244   1e-76   Populus euphratica
ref|XP_002302428.2|  hypothetical protein POPTR_0002s12410g             244   2e-76   
ref|XP_011017151.1|  PREDICTED: transcription factor MYB44-like         243   3e-76   Populus euphratica
ref|XP_004141899.1|  PREDICTED: transcription factor MYB44-like         243   3e-76   Cucumis sativus [cucumbers]
ref|XP_002306488.2|  hypothetical protein POPTR_0005s18620g             245   3e-76   
ref|NP_001268121.1|  sucrose responsive element binding protein         243   5e-76   Vitis vinifera
gb|AGN52031.1|  MYB-related transcription factor                        243   6e-76   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004238123.1|  PREDICTED: transcription factor MYB44-like         243   6e-76   Solanum lycopersicum
ref|XP_008351390.1|  PREDICTED: transcription factor MYB44-like         241   6e-76   
ref|XP_009367649.1|  PREDICTED: transcription factor MYB44              243   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_009372447.1|  PREDICTED: transcription factor MYB44-like         243   7e-76   Pyrus x bretschneideri [bai li]
emb|CDY22442.1|  BnaC03g61550D                                          241   8e-76   Brassica napus [oilseed rape]
gb|AFK46950.1|  unknown                                                 242   1e-75   Medicago truncatula
gb|KJB43824.1|  hypothetical protein B456_007G218100                    242   1e-75   Gossypium raimondii
gb|AHN19845.1|  MYB6                                                    242   1e-75   Malus hybrid cultivar
ref|XP_008440323.1|  PREDICTED: transcription factor MYB44              242   1e-75   Cucumis melo [Oriental melon]
ref|XP_006411909.1|  hypothetical protein EUTSA_v10025742mg             242   2e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010095320.1|  Transcription factor                               241   2e-75   
ref|XP_006367421.1|  PREDICTED: transcription factor MYB44-like         242   2e-75   Solanum tuberosum [potatoes]
ref|NP_001238087.1|  MYB transcription factor MYB50                     241   2e-75   Glycine max [soybeans]
gb|AAZ20429.1|  MYB6                                                    241   3e-75   Malus domestica [apple tree]
ref|XP_008338349.1|  PREDICTED: transcription factor MYB44-like         241   4e-75   
ref|XP_002524926.1|  r2r3-myb transcription factor, putative            241   5e-75   Ricinus communis
ref|XP_009109365.1|  PREDICTED: transcription factor MYB44-like         240   5e-75   Brassica rapa
gb|KJB40285.1|  hypothetical protein B456_007G055600                    241   5e-75   Gossypium raimondii
emb|CDY44045.1|  BnaA08g15610D                                          239   5e-75   Brassica napus [oilseed rape]
ref|XP_007156759.1|  hypothetical protein PHAVU_002G015100g             240   6e-75   Phaseolus vulgaris [French bean]
ref|XP_007047395.1|  Myb domain protein 73, putative                    240   7e-75   
gb|AHN19846.1|  MYB6                                                    240   9e-75   Malus hybrid cultivar
ref|XP_011074411.1|  PREDICTED: transcription factor MYB44-like         240   1e-74   Sesamum indicum [beniseed]
gb|AHB59592.1|  putative R2R3 MYB protein 4                             239   2e-74   Arachis hypogaea [goober]
ref|XP_010679545.1|  PREDICTED: transcription factor MYB44              239   3e-74   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAC53938.1|  Myb-like protein                                       239   3e-74   Nicotiana tabacum [American tobacco]
ref|XP_009586849.1|  PREDICTED: transcription factor MYB44-like         239   4e-74   Nicotiana tomentosiformis
gb|ADL36764.1|  MYB domain class transcription factor                   238   4e-74   Malus domestica [apple tree]
ref|XP_007205522.1|  hypothetical protein PRUPE_ppa008450mg             238   7e-74   
ref|NP_001235142.1|  MYB transcription factor MYB112                    237   9e-74   
ref|XP_010531261.1|  PREDICTED: transcription factor MYB44              237   2e-73   Tarenaya hassleriana [spider flower]
emb|CAN81361.1|  hypothetical protein VITISV_028904                     236   2e-73   Vitis vinifera
gb|EYU25477.1|  hypothetical protein MIMGU_mgv1a010338mg                236   3e-73   Erythranthe guttata [common monkey flower]
ref|XP_010059753.1|  PREDICTED: transcription factor MYB44-like         236   4e-73   Eucalyptus grandis [rose gum]
ref|XP_004291065.1|  PREDICTED: transcription factor MYB44-like         236   5e-73   Fragaria vesca subsp. vesca
gb|KJB63910.1|  hypothetical protein B456_010G023500                    234   5e-73   Gossypium raimondii
emb|CDP01282.1|  unnamed protein product                                236   5e-73   Coffea canephora [robusta coffee]
emb|CDX69287.1|  BnaC01g01660D                                          235   6e-73   
ref|XP_010556427.1|  PREDICTED: transcription factor MYB44-like         235   6e-73   Tarenaya hassleriana [spider flower]
emb|CDX75635.1|  BnaA01g00670D                                          234   8e-73   
gb|AGN52088.1|  MYB-related transcription factor                        234   8e-73   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009137661.1|  PREDICTED: transcription factor MYB44              235   1e-72   Brassica rapa
gb|KDO84060.1|  hypothetical protein CISIN_1g022144mg                   234   1e-72   Citrus sinensis [apfelsine]
ref|NP_195443.1|  myb domain protein 73                                 234   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437245.1|  PREDICTED: transcription factor MYB44-like         234   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006434697.1|  hypothetical protein CICLE_v10001979mg             234   1e-72   Citrus clementina [clementine]
ref|NP_001275798.1|  putative R2R3-MYB transcription factor             234   2e-72   Citrus sinensis [apfelsine]
ref|XP_010432074.1|  PREDICTED: transcription factor MYB44-like         234   2e-72   Camelina sativa [gold-of-pleasure]
gb|AGN52056.1|  MYB-related transcription factor                        232   2e-72   Salvia miltiorrhiza [Chinese salvia]
gb|AFV73403.1|  R2R3-MYB transcription factor                           234   3e-72   Jatropha curcas
ref|XP_008351984.1|  PREDICTED: transcription factor MYB44-like         234   3e-72   
emb|CBI19466.3|  unnamed protein product                                232   3e-72   Vitis vinifera
gb|ADL36765.1|  MYB domain class transcription factor                   233   4e-72   Malus domestica [apple tree]
ref|XP_008367655.1|  PREDICTED: transcription factor MYB44-like         233   5e-72   
ref|XP_010070607.1|  PREDICTED: transcription factor MYB44-like         233   6e-72   Eucalyptus grandis [rose gum]
ref|XP_010417080.1|  PREDICTED: transcription factor MYB44-like         232   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010446682.1|  PREDICTED: transcription factor MYB44-like         232   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006404809.1|  hypothetical protein EUTSA_v10000438mg             231   1e-71   Eutrema salsugineum [saltwater cress]
ref|XP_009360105.1|  PREDICTED: transcription factor MYB44-like         231   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_002510155.1|  r2r3-myb transcription factor, putative            230   4e-71   Ricinus communis
ref|XP_010548433.1|  PREDICTED: transcription factor MYB44 isofor...    231   4e-71   
ref|XP_010548432.1|  PREDICTED: transcription factor MYB44 isofor...    231   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_006286095.1|  hypothetical protein CARUB_v10007638mg             230   6e-71   Capsella rubella
ref|XP_008220277.1|  PREDICTED: transcription factor MYB44-like         229   1e-70   Prunus mume [ume]
ref|XP_002880492.1|  hypothetical protein ARALYDRAFT_481200             229   1e-70   
ref|XP_010101670.1|  Transcription factor                               229   1e-70   Morus notabilis
dbj|BAJ40867.1|  transcriptional factor MYB-1                           229   1e-70   Coptis japonica
ref|XP_007227715.1|  hypothetical protein PRUPE_ppa008979mg             229   1e-70   Prunus persica
gb|AAG08960.1|AF122052_1  tuber-specific and sucrose-responsive e...    228   3e-70   Solanum tuberosum [potatoes]
emb|CDX72621.1|  BnaC07g46430D                                          226   4e-70   
ref|XP_007160886.1|  hypothetical protein PHAVU_001G025200g             226   8e-70   Phaseolus vulgaris [French bean]
ref|XP_009398678.1|  PREDICTED: transcription factor MYB44-like         229   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58575.1|  hypothetical protein B456_009G215900                    226   8e-70   Gossypium raimondii
gb|KJB59854.1|  hypothetical protein B456_009G276400                    226   9e-70   Gossypium raimondii
gb|ADN33728.1|  MYB transcription factor                                223   2e-69   Cucumis melo subsp. melo
gb|ABV02031.1|  sucrose responsive element binding factor 1             225   2e-69   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_010429274.1|  PREDICTED: transcription factor MYB44-like         226   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008462845.1|  PREDICTED: transcription factor MYB44-like         226   2e-69   Cucumis melo [Oriental melon]
gb|KEH31491.1|  myb transcription factor                                224   3e-69   Medicago truncatula
gb|ABR28330.1|  MYB transcription factor MYB8                           224   3e-69   Medicago truncatula
gb|AGL76985.1|  MYB transcription factor                                225   4e-69   Cucumis melo [Oriental melon]
ref|XP_008444592.1|  PREDICTED: transcription factor MYB44-like         225   5e-69   
ref|XP_010943207.1|  PREDICTED: transcription factor MYB44-like         226   7e-69   Elaeis guineensis
ref|XP_009587267.1|  PREDICTED: transcription factor MYB44-like         223   8e-69   
gb|AAM65553.1|  putative MYB family transcription factor                224   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138487.1|  PREDICTED: transcription factor MYB44-like         223   1e-68   Brassica rapa
gb|EYU34554.1|  hypothetical protein MIMGU_mgv1a011398mg                223   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_004142878.1|  PREDICTED: transcription factor MYB44-like         223   3e-68   Cucumis sativus [cucumbers]
gb|AHB59591.1|  putative R2R3 MYB protein 3                             221   3e-68   Arachis hypogaea [goober]
ref|NP_179910.1|  myb domain protein 70                                 223   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472329.1|  PREDICTED: transcription factor MYB44-like         222   5e-68   Camelina sativa [gold-of-pleasure]
gb|AFK48638.1|  unknown                                                 221   6e-68   Medicago truncatula
gb|KFK30351.1|  hypothetical protein AALP_AA7G250300                    222   6e-68   Arabis alpina [alpine rockcress]
ref|XP_004151866.1|  PREDICTED: transcription factor MYB44-like         221   1e-67   
ref|XP_010928389.1|  PREDICTED: transcription factor MYB44-like         223   2e-67   Elaeis guineensis
gb|AFS65096.1|  sucrose responsive element-binding protein              223   2e-67   Elaeis guineensis
ref|XP_008799576.1|  PREDICTED: transcription factor MYB44-like         223   2e-67   Phoenix dactylifera
ref|XP_006294656.1|  hypothetical protein CARUB_v10023692mg             221   3e-67   
ref|NP_001287808.1|  transcription factor MYB44-like                    220   7e-67   Malus domestica [apple tree]
ref|XP_009354151.1|  PREDICTED: transcription factor MYB44-like         219   1e-66   Pyrus x bretschneideri [bai li]
gb|EYU36318.1|  hypothetical protein MIMGU_mgv1a022221mg                218   2e-66   Erythranthe guttata [common monkey flower]
emb|CDY38933.1|  BnaA04g13540D                                          216   6e-66   Brassica napus [oilseed rape]
ref|XP_006844027.1|  hypothetical protein AMTR_s00006p00225600          217   6e-66   
ref|NP_001062562.1|  Os09g0106700                                       217   8e-66   
dbj|BAD34048.1|  myb-related transcription factor-like                  217   8e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08096.1|  hypothetical protein OsI_30362                          217   8e-66   Oryza sativa Indica Group [Indian rice]
emb|CDX89554.1|  BnaC04g35730D                                          216   9e-66   
ref|XP_008811216.1|  PREDICTED: transcription factor MYB44-like         218   1e-65   Phoenix dactylifera
ref|XP_009140453.1|  PREDICTED: transcription factor MYB44              216   1e-65   Brassica rapa
ref|XP_007042527.1|  Myb domain protein 73, putative                    213   5e-65   
ref|XP_009418521.1|  PREDICTED: transcription factor MYB44-like         215   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392116.1|  PREDICTED: transcription factor MYB44-like         216   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279745.1|  hypothetical protein CARUB_v10027659mg             214   9e-65   Capsella rubella
ref|NP_001237693.1|  MYB transcription factor MYB70                     213   9e-65   
ref|XP_006660414.1|  PREDICTED: transcription factor MYB44-like         213   2e-64   Oryza brachyantha
ref|XP_007136715.1|  hypothetical protein PHAVU_009G068000g             212   2e-64   Phaseolus vulgaris [French bean]
ref|XP_007199299.1|  hypothetical protein PRUPE_ppa023154mg             212   3e-64   
emb|CAA90809.1|  MYB-related protein                                    213   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444669.1|  PREDICTED: transcription factor MYB44-like         213   4e-64   Camelina sativa [gold-of-pleasure]
ref|NP_201531.1|  transcription factor MYB44                            212   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64847.1|  myb-related protein, 33.3K                              212   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96490.1|  AT5g67300/K8K14_2                                       212   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305954.1|  PREDICTED: transcription factor MYB44-like         211   5e-64   Fragaria vesca subsp. vesca
ref|XP_009418325.1|  PREDICTED: transcription factor MYB44-like         214   5e-64   
ref|XP_008373085.1|  PREDICTED: transcription factor MYB44-like         212   5e-64   
ref|XP_002866710.1|  AtMYB44/AtMYBr1                                    212   6e-64   Arabidopsis lyrata subsp. lyrata
emb|CCU64171.1|  ScMYB19 protein                                        209   8e-64   Saccharum hybrid cultivar Co 86032
ref|NP_001237709.1|  MYB transcription factor MYB81                     211   8e-64   
ref|XP_009385523.1|  PREDICTED: transcription factor MYB44-like         213   8e-64   
dbj|BAJ86460.1|  predicted protein                                      212   9e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008236375.1|  PREDICTED: transcription factor MYB44-like         211   1e-63   Prunus mume [ume]
ref|XP_004163238.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   1e-63   
ref|XP_004141275.1|  PREDICTED: transcription factor MYB44-like         209   2e-63   Cucumis sativus [cucumbers]
ref|XP_008452606.1|  PREDICTED: transcription factor MYB44-like         209   2e-63   Cucumis melo [Oriental melon]
ref|XP_010484518.1|  PREDICTED: transcription factor MYB44-like         211   2e-63   Camelina sativa [gold-of-pleasure]
gb|KFK28404.1|  hypothetical protein AALP_AA8G510400                    210   2e-63   Arabis alpina [alpine rockcress]
ref|XP_010464243.1|  PREDICTED: transcription factor MYB44              210   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006393928.1|  hypothetical protein EUTSA_v10004676mg             209   5e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009103434.1|  PREDICTED: transcription factor MYB44              209   5e-63   Brassica rapa
gb|AAR83899.1|  tuber-specific protein                                  211   5e-63   Capsicum annuum
gb|ADL36760.1|  MYB domain class transcription factor                   209   6e-63   Malus domestica [apple tree]
gb|AHN50422.1|  R2R3-type MYB transcription factor                      208   6e-63   Salicornia brachiata
gb|AHN60125.1|  MYB transcription factor 44                             209   6e-63   Brassica napus [oilseed rape]
gb|KDP45901.1|  hypothetical protein JCGZ_15461                         208   6e-63   Jatropha curcas
ref|XP_002462029.1|  hypothetical protein SORBIDRAFT_02g013010          211   7e-63   Sorghum bicolor [broomcorn]
gb|EPS70032.1|  myb-like protein                                        203   1e-62   Genlisea aurea
ref|NP_001235715.1|  MYB transcription factor MYB68                     207   1e-62   Glycine max [soybeans]
ref|NP_001151336.1|  sucrose responsive element binding protein         209   2e-62   Zea mays [maize]
ref|XP_010547530.1|  PREDICTED: transcription factor MYB44-like         208   2e-62   Tarenaya hassleriana [spider flower]
gb|ADX60118.1|  MYB-RELATED transcription factor                        209   2e-62   Zea mays [maize]
ref|XP_010558924.1|  PREDICTED: transcription factor MYB44-like i...    207   4e-62   Tarenaya hassleriana [spider flower]
gb|AFH03055.1|  R2R3-MYB transcription factor MYB3                      207   4e-62   Epimedium sagittatum
ref|XP_009394543.1|  PREDICTED: transcription factor MYB44-like         207   4e-62   
ref|XP_009415461.1|  PREDICTED: transcription factor MYB44-like         209   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01420.1|  BnaA07g11930D                                          206   5e-62   
ref|XP_009395856.1|  PREDICTED: transcription factor MYB44-like         208   6e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003575562.1|  PREDICTED: transcription factor MYB44-like         207   6e-62   Brachypodium distachyon [annual false brome]
emb|CDY12830.1|  BnaC07g16030D                                          204   1e-61   Brassica napus [oilseed rape]
ref|XP_006293134.1|  hypothetical protein CARUB_v10019440mg             204   4e-61   Capsella rubella
ref|XP_011088207.1|  PREDICTED: transcription factor MYB44-like         203   7e-61   
ref|XP_002313145.1|  hypothetical protein POPTR_0009s09890g             202   7e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010057256.1|  PREDICTED: transcription factor MYB44-like         204   8e-61   Eucalyptus grandis [rose gum]
ref|XP_002518677.1|  r2r3-myb transcription factor, putative            202   8e-61   Ricinus communis
ref|XP_011001142.1|  PREDICTED: transcription factor MYB44-like         202   9e-61   Populus euphratica
ref|XP_002877726.1|  myb family transcription factor                    203   1e-60   
ref|XP_010691674.1|  PREDICTED: transcription factor MYB44-like         202   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001183628.1|  putative MYB DNA-binding domain superfamily ...    202   2e-60   Zea mays [maize]
ref|XP_010096284.1|  Transcription factor                               202   2e-60   
gb|ABL97967.1|  R2R3-MYB transcription factor                           201   3e-60   Brassica rapa
gb|AHN60131.1|  MYB transcription factor 77                             201   3e-60   Brassica napus [oilseed rape]
gb|ABD60291.2|  R2R3-MYB transcription factor MYB6                      200   4e-60   Picea glauca
ref|XP_006404067.1|  hypothetical protein EUTSA_v10010581mg             202   5e-60   Eutrema salsugineum [saltwater cress]
gb|KJB77654.1|  hypothetical protein B456_012G149000                    200   5e-60   Gossypium raimondii
ref|NP_190575.1|  myb domain protein 77                                 201   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006487005.1|  PREDICTED: transcription factor MYB44-like         200   6e-60   Citrus sinensis [apfelsine]
gb|KDO59816.1|  hypothetical protein CISIN_1g040502mg                   200   6e-60   Citrus sinensis [apfelsine]
ref|XP_006422932.1|  hypothetical protein CICLE_v10029124mg             200   7e-60   Citrus clementina [clementine]
ref|XP_010092183.1|  Transcription factor                               201   7e-60   
emb|CAA74604.1|  R2R3-MYB transcription factor                          201   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB32313.1|  hypothetical protein B456_005G234900                    199   9e-60   Gossypium raimondii
ref|XP_008239060.1|  PREDICTED: transcription factor MYB44              201   1e-59   Prunus mume [ume]
ref|XP_009396365.1|  PREDICTED: transcription factor MYB44-like         203   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA90810.1|  MYB-related protein                                    201   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932223.1|  PREDICTED: transcription factor MYB44-like         199   1e-59   Elaeis guineensis
ref|XP_009396271.1|  PREDICTED: transcription factor MYB44-like         201   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550347.1|  PREDICTED: transcription factor MYB44-like         200   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010547980.1|  PREDICTED: transcription factor MYB44-like         200   4e-59   Tarenaya hassleriana [spider flower]
emb|CDY30608.1|  BnaAnng03830D                                          198   4e-59   Brassica napus [oilseed rape]
emb|CDY57355.1|  BnaC08g48630D                                          197   9e-59   Brassica napus [oilseed rape]
ref|XP_010426549.1|  PREDICTED: transcription factor MYB44-like         198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009115687.1|  PREDICTED: transcription factor MYB44-like         197   2e-58   Brassica rapa
gb|KJB12279.1|  hypothetical protein B456_002G009300                    196   2e-58   Gossypium raimondii
ref|XP_010515371.1|  PREDICTED: transcription factor MYB44-like         197   3e-58   Camelina sativa [gold-of-pleasure]
gb|ABQ51222.1|  R2R3-MYB transcription factor MYB6                      198   5e-58   Picea glauca
gb|ABD60281.1|  R2R3-MYB transcription factor MYB7                      198   7e-58   Pinus taeda
gb|KFK34266.1|  hypothetical protein AALP_AA5G122700                    196   9e-58   Arabis alpina [alpine rockcress]
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...    207   2e-57   Medicago truncatula
ref|XP_002451692.1|  hypothetical protein SORBIDRAFT_04g005940          196   2e-57   Sorghum bicolor [broomcorn]
ref|XP_002285389.1|  PREDICTED: transcription factor MYB44              194   4e-57   Vitis vinifera
ref|XP_008796508.1|  PREDICTED: transcription factor MYB44-like         193   4e-57   Phoenix dactylifera
emb|CDY23023.1|  BnaC07g31640D                                          193   5e-57   Brassica napus [oilseed rape]
ref|XP_004501595.1|  PREDICTED: transcriptional activator Myb-like      192   6e-57   Cicer arietinum [garbanzo]
emb|CDY02098.1|  BnaA03g40690D                                          192   1e-56   
ref|XP_001753593.1|  predicted protein                                  186   3e-56   
ref|XP_002975777.1|  hypothetical protein SELMODRAFT_103999             186   5e-56   
gb|ABD60290.2|  R2R3-MYB transcription factor MYB7                      189   1e-55   Picea glauca
gb|EYU37627.1|  hypothetical protein MIMGU_mgv1a026376mg                190   2e-55   Erythranthe guttata [common monkey flower]
emb|CDX83109.1|  BnaA01g21090D                                          185   2e-55   
ref|XP_009136534.1|  PREDICTED: transcription factor MYB44-like         189   2e-55   Brassica rapa
gb|ABQ51223.1|  R2R3-MYB transcription factor MYB7                      191   3e-55   Picea glauca
gb|ABD60288.2|  R2R3-MYB transcription factor MYB9                      188   3e-55   Picea glauca
gb|ABR16702.1|  unknown                                                 192   5e-55   Picea sitchensis
gb|ABQ51225.1|  R2R3-MYB transcription factor MYB9                      192   5e-55   Picea glauca
ref|XP_009101651.1|  PREDICTED: transcription factor MYB44-like         189   7e-55   
ref|XP_002298748.1|  hypothetical protein POPTR_0001s30750g             186   7e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002973727.1|  hypothetical protein SELMODRAFT_99462              182   1e-54   
ref|NP_001147631.1|  LOC100281240                                       187   2e-54   Zea mays [maize]
ref|XP_011030396.1|  PREDICTED: transcription factor MYB44-like         185   3e-54   Populus euphratica
ref|XP_009387830.1|  PREDICTED: transcription factor MYB44-like         184   6e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268609.1|  PREDICTED: transcriptional activator Myb-like      183   8e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002961364.1|  hypothetical protein SELMODRAFT_77255              179   9e-54   
ref|XP_011030579.1|  PREDICTED: transcription factor MYB44-like         184   1e-53   Populus euphratica
ref|XP_007221111.1|  hypothetical protein PRUPE_ppa017892mg             183   1e-53   
emb|CCU64155.1|  ScMYB3 protein                                         184   1e-53   Saccharum hybrid cultivar Co 86032
emb|CCU64175.1|  ScMYB23 protein                                        180   1e-53   Saccharum hybrid cultivar Co 86032
ref|XP_001753678.1|  predicted protein                                  178   2e-53   
emb|CDP07617.1|  unnamed protein product                                183   3e-53   Coffea canephora [robusta coffee]
ref|XP_004951630.1|  PREDICTED: transcription factor MYB44-like         184   3e-53   Setaria italica
ref|XP_007136655.1|  hypothetical protein PHAVU_009G062700g             181   4e-53   Phaseolus vulgaris [French bean]
gb|KJB59839.1|  hypothetical protein B456_009G275100                    181   4e-53   Gossypium raimondii
gb|KDP38397.1|  hypothetical protein JCGZ_04322                         182   4e-53   Jatropha curcas
ref|XP_006374997.1|  hypothetical protein POPTR_0014s03440g             182   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006578007.1|  PREDICTED: transcription factor MYB44-like         181   5e-53   
ref|NP_001235925.1|  MYB transcription factor MYB124                    181   5e-53   
ref|XP_008234066.1|  PREDICTED: transcriptional activator Myb-like      181   7e-53   
dbj|BAK08030.1|  predicted protein                                      183   7e-53   
ref|XP_002510273.1|  r2r3-myb transcription factor, putative            181   7e-53   
ref|XP_010031187.1|  PREDICTED: myb-related protein A-like              182   8e-53   
gb|EAZ22021.1|  hypothetical protein OsJ_05678                          183   9e-53   
ref|NP_001046131.1|  Os02g0187700                                       183   9e-53   
ref|XP_003603000.1|  Myb transcription factor                           180   1e-52   
gb|KDP44734.1|  hypothetical protein JCGZ_01234                         181   1e-52   
gb|ABC86569.1|  MYB transcription factor TaMYB1                         182   1e-52   
ref|XP_010061776.1|  PREDICTED: transcription factor MYB44-like         181   1e-52   
ref|XP_006434842.1|  hypothetical protein CICLE_v10002239mg             181   1e-52   
ref|XP_010268711.1|  PREDICTED: transcription factor MYB44-like         180   2e-52   
ref|XP_010098722.1|  Transcription factor                               180   2e-52   
ref|XP_011017241.1|  PREDICTED: transcriptional activator Myb-like      180   2e-52   
ref|XP_010526144.1|  PREDICTED: transcriptional activator Myb-like      179   3e-52   
ref|NP_001058148.1|  Os06g0637500                                       182   3e-52   
gb|KJB58408.1|  hypothetical protein B456_009G208900                    179   6e-52   
ref|XP_009370160.1|  PREDICTED: transcriptional activator Myb-like      179   6e-52   
ref|XP_008444647.1|  PREDICTED: transcription factor MYB44-like         179   7e-52   
ref|XP_002438718.1|  hypothetical protein SORBIDRAFT_10g024950          181   7e-52   
ref|XP_009367403.1|  PREDICTED: transcriptional activator Myb-like      179   7e-52   
ref|XP_004169452.1|  PREDICTED: transcriptional activator Myb-like      179   7e-52   
ref|XP_004152727.1|  PREDICTED: transcriptional activator Myb-like      179   8e-52   
emb|CDX68566.1|  BnaC01g26440D                                          181   8e-52   
ref|XP_002301201.1|  hypothetical protein POPTR_0002s13030g             178   9e-52   
ref|XP_007223827.1|  hypothetical protein PRUPE_ppa010735mg             178   1e-51   
ref|XP_008220156.1|  PREDICTED: transcription factor MYB44-like         178   1e-51   
ref|NP_001159044.1|  MYB transcription factor TaMYB1                    180   1e-51   
ref|XP_008452503.1|  PREDICTED: transcriptional activator Myb-like      177   1e-51   
ref|XP_008378059.1|  PREDICTED: transcriptional activator Myb-like      179   1e-51   
ref|XP_011000247.1|  PREDICTED: transcription factor MYB44-like         178   2e-51   
ref|XP_004141241.1|  PREDICTED: myb-related protein A-like              177   2e-51   
ref|XP_010253806.1|  PREDICTED: transcription factor MYB44-like         178   2e-51   
gb|EAZ37752.1|  hypothetical protein OsJ_22090                          180   2e-51   
ref|XP_010920799.1|  PREDICTED: transcription factor MYB44-like         178   2e-51   
ref|XP_008352004.1|  PREDICTED: transcription factor MYB44-like         177   3e-51   
ref|XP_007008918.1|  Myb domain protein 73                              177   4e-51   
ref|XP_002528315.1|  r2r3-myb transcription factor, putative            177   4e-51   
gb|KJB76222.1|  hypothetical protein B456_012G078200                    176   4e-51   
ref|XP_002311241.1|  hypothetical protein POPTR_0008s07100g             177   5e-51   
ref|XP_009412621.1|  PREDICTED: transcription factor MYB44-like         177   5e-51   
ref|XP_009345765.1|  PREDICTED: transcription factor MYB44-like         176   5e-51   
ref|XP_009780273.1|  PREDICTED: transcription factor MYB44-like         177   6e-51   
gb|KDO68919.1|  hypothetical protein CISIN_1g046570mg                   177   7e-51   
ref|XP_007017355.1|  Myb domain protein 77                              176   7e-51   
ref|XP_010059771.1|  PREDICTED: transcription factor MYB44-like         176   7e-51   
ref|XP_004173919.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    176   8e-51   
ref|XP_004238184.1|  PREDICTED: transcription factor MYB44-like         176   1e-50   
ref|XP_002272706.1|  PREDICTED: myb-related protein B                   176   1e-50   
ref|XP_006354921.1|  PREDICTED: transcription factor MYB44-like         176   1e-50   
gb|EPS60436.1|  hypothetical protein M569_14368                         177   1e-50   
ref|XP_006435772.1|  hypothetical protein CICLE_v10032317mg             177   1e-50   
ref|XP_008792655.1|  PREDICTED: transcription factor MYB44-like         176   1e-50   
emb|CCA29104.1|  putative MYB transcription factor                      176   1e-50   
gb|AAG08961.1|AF122053_1  tuber-specific and sucrose-responsive e...    176   2e-50   
ref|XP_011470630.1|  PREDICTED: transcription factor MYB44-like         173   2e-50   
emb|CCA29118.1|  putative MYB transcription factor                      176   2e-50   
ref|XP_007141751.1|  hypothetical protein PHAVU_008G222600g             175   2e-50   
gb|AGN52029.1|  MYB-related transcription factor                        174   2e-50   
ref|XP_004965791.1|  PREDICTED: transcription factor MYB44-like         177   2e-50   
ref|XP_008374172.1|  PREDICTED: transcriptional activator Myb-like      176   2e-50   
ref|XP_009400144.1|  PREDICTED: transcription factor MYB44-like         176   2e-50   
ref|XP_011074463.1|  PREDICTED: transcription factor MYB44-like         174   2e-50   
ref|XP_009620130.1|  PREDICTED: transcription factor MYB44-like         175   3e-50   
ref|XP_010105436.1|  Transcription factor                               175   3e-50   
gb|AHB59589.1|  putative R2R3 MYB protein 1                             174   3e-50   
ref|XP_009785340.1|  PREDICTED: myb protein-like                        174   4e-50   
ref|XP_011083803.1|  PREDICTED: transcription factor MYB44-like         173   7e-50   
ref|XP_010937896.1|  PREDICTED: transcription factor MYB44-like         175   8e-50   
ref|XP_002439611.1|  hypothetical protein SORBIDRAFT_09g016570          176   1e-49   
ref|XP_004291141.1|  PREDICTED: transcription factor MYB44-like         173   1e-49   
ref|XP_004491024.1|  PREDICTED: transcription factor MYB44-like         174   1e-49   
gb|EYU36282.1|  hypothetical protein MIMGU_mgv1a013600mg                172   1e-49   
ref|XP_006843647.1|  hypothetical protein AMTR_s00007p00169630          174   1e-49   
gb|AGN52077.1|  MYB-related transcription factor                        177   1e-49   
ref|XP_004157388.1|  PREDICTED: transcription factor MYB44-like         170   2e-49   
ref|XP_006595859.1|  PREDICTED: transcription factor MYB44-like         172   2e-49   
ref|XP_011094946.1|  PREDICTED: uncharacterized protein LOC105174515    177   2e-49   
ref|NP_001132112.1|  uncharacterized protein LOC100193529               174   2e-49   
ref|XP_004140809.1|  PREDICTED: transcription factor MYB44-like         171   2e-49   
ref|XP_002284237.1|  PREDICTED: transcription factor MYB44              171   3e-49   
ref|XP_004246368.1|  PREDICTED: myb-related protein 315                 176   3e-49   
ref|XP_010666145.1|  PREDICTED: myb protein-like                        172   4e-49   
ref|XP_004148201.1|  PREDICTED: uncharacterized protein LOC101207929    172   6e-49   
ref|XP_008805112.1|  PREDICTED: myb-related protein B-like              171   6e-49   
gb|KJB63797.1|  hypothetical protein B456_010G016800                    170   7e-49   
emb|CDP06538.1|  unnamed protein product                                175   8e-49   
ref|XP_001762255.1|  predicted protein                                  167   8e-49   
dbj|BAJ95362.1|  predicted protein                                      172   1e-48   
ref|XP_001765018.1|  predicted protein                                  167   1e-48   
ref|XP_006363093.1|  PREDICTED: myb-like protein AA-like                174   1e-48   
ref|XP_008789179.1|  PREDICTED: transcription factor MYB44-like         171   1e-48   
ref|XP_010553060.1|  PREDICTED: transcription factor MYB44              174   1e-48   
ref|XP_009407576.1|  PREDICTED: myb-like protein AA                     174   2e-48   
gb|ACF87327.1|  unknown                                                 172   2e-48   
ref|XP_010486483.1|  PREDICTED: myb protein-like                        174   2e-48   
ref|XP_010464561.1|  PREDICTED: myb-related protein B-like              174   2e-48   
ref|XP_009600873.1|  PREDICTED: transcription factor MYB44-like         172   2e-48   
gb|EMS67867.1|  Transcription factor MYB44                              171   2e-48   
ref|XP_008649548.1|  PREDICTED: transcription factor MYB48-like         173   2e-48   
ref|XP_003518439.1|  PREDICTED: transcription factor MYB44              170   2e-48   
ref|XP_010922579.1|  PREDICTED: transcription factor MYB44-like         170   2e-48   
gb|AIB05744.1|  MYB transcription factor                                172   2e-48   
ref|XP_009402306.1|  PREDICTED: myb-like protein AA                     173   2e-48   
gb|EYU41812.1|  hypothetical protein MIMGU_mgv1a023010mg                174   2e-48   
ref|XP_008785463.1|  PREDICTED: myb-like protein Q                      174   2e-48   
ref|XP_010558349.1|  PREDICTED: myb-like protein Q                      174   3e-48   
ref|XP_009783755.1|  PREDICTED: myb-related protein B-like              173   3e-48   
ref|XP_009613649.1|  PREDICTED: myb-related protein B                   173   3e-48   
ref|XP_010931159.1|  PREDICTED: trichome differentiation protein ...    173   4e-48   
ref|XP_010037759.1|  PREDICTED: myb-related protein A                   172   4e-48   
ref|XP_008448879.1|  PREDICTED: transcription factor MYB86              172   6e-48   
ref|XP_004147900.1|  PREDICTED: uncharacterized protein LOC101212170    172   6e-48   
ref|XP_002276341.1|  PREDICTED: transcription factor RAX1               172   6e-48   
ref|XP_004162756.1|  PREDICTED: uncharacterized LOC101212170            172   6e-48   
ref|XP_004963854.1|  PREDICTED: transcription factor MYB44-like         172   7e-48   
ref|XP_003549412.2|  PREDICTED: myb-like protein A-like                 168   8e-48   
gb|EYU40230.1|  hypothetical protein MIMGU_mgv1a021015mg                164   9e-48   
ref|XP_006848033.1|  hypothetical protein AMTR_s00029p00183640          172   9e-48   
ref|XP_010470301.1|  PREDICTED: myb-related protein B-like              172   1e-47   
ref|XP_007205315.1|  hypothetical protein PRUPE_ppa006851mg             172   1e-47   
ref|XP_011084888.1|  PREDICTED: transcriptional activator Myb-like      168   1e-47   
ref|XP_008369404.1|  PREDICTED: transcription factor MYB23-like         168   1e-47   
ref|XP_003545242.1|  PREDICTED: myb-related protein 306-like            172   1e-47   
ref|XP_009416214.1|  PREDICTED: myb-related protein 315-like            172   1e-47   
ref|XP_007026835.1|  R2r3-myb transcription factor, putative            172   2e-47   
gb|KHN20881.1|  Transcription factor MYB44                              172   2e-47   
ref|XP_008239931.1|  PREDICTED: uncharacterized protein LOC103338495    172   2e-47   
ref|XP_008674458.1|  PREDICTED: transcription factor MYB44-like         168   2e-47   
ref|XP_010256736.1|  PREDICTED: uncharacterized protein LOC104597...    172   2e-47   
ref|XP_010923173.1|  PREDICTED: myb-like protein Q                      171   3e-47   
ref|XP_004964242.1|  PREDICTED: transcriptional activator Myb-like      167   5e-47   
ref|XP_002276375.1|  PREDICTED: uncharacterized protein LOC100256309    171   5e-47   
gb|EYU43428.1|  hypothetical protein MIMGU_mgv1a012392mg                166   5e-47   
ref|NP_001055277.1|  Os05g0350900                                       167   9e-47   
ref|XP_010101850.1|  Transcription factor                               169   1e-46   
ref|XP_010533876.1|  PREDICTED: myb-related protein Myb4-like           168   2e-46   
gb|KDP44844.1|  hypothetical protein JCGZ_01344                         170   2e-46   
gb|KFK38309.1|  hypothetical protein AALP_AA3G097200                    168   2e-46   
ref|XP_010262707.1|  PREDICTED: uncharacterized protein LOC104601164    169   2e-46   
ref|XP_006645018.1|  PREDICTED: uncharacterized protein LOC102712209    169   3e-46   
ref|NP_001044814.1|  Os01g0850400                                       168   4e-46   
gb|EAY76504.1|  hypothetical protein OsI_04445                          168   4e-46   
ref|XP_007009127.1|  Myb domain protein 25, putative                    168   5e-46   
ref|XP_006407701.1|  hypothetical protein EUTSA_v10021963mg             168   5e-46   
gb|EPS67829.1|  hypothetical protein M569_06945                         162   5e-46   
ref|XP_002882609.1|  ATMYB1                                             167   6e-46   
emb|CBI19574.3|  unnamed protein product                                169   6e-46   
ref|XP_002489094.1|  hypothetical protein SORBIDRAFT_0088s002210        166   6e-46   
ref|XP_006297844.1|  hypothetical protein CARUB_v10013882mg             167   6e-46   
gb|AHB59593.1|  putative R2R3 MYB protein 5                             166   9e-46   
ref|XP_008233695.1|  PREDICTED: transcription factor RAX2-like          168   9e-46   
ref|XP_010648804.1|  PREDICTED: transcription factor MYB44-like         164   1e-45   
gb|AGN52047.1|  MYB-related transcription factor                        167   1e-45   
ref|XP_010517362.1|  PREDICTED: uncharacterized protein LOC104792825    166   1e-45   
gb|EYU25387.1|  hypothetical protein MIMGU_mgv1a013005mg                162   1e-45   
gb|KJB74193.1|  hypothetical protein B456_011G278500                    167   2e-45   
ref|XP_003566355.1|  PREDICTED: transcription factor MYB44-like         164   2e-45   
ref|XP_010239722.1|  PREDICTED: transcription factor MYB44-like         163   2e-45   
gb|KHG29583.1|  Transcription factor MYB44 -like protein                167   2e-45   
ref|XP_010505683.1|  PREDICTED: uncharacterized protein LOC104782447    166   2e-45   
ref|XP_008388098.1|  PREDICTED: transcription factor MYB44-like         166   2e-45   
ref|XP_010543715.1|  PREDICTED: transcription factor MYB44-like         160   2e-45   
emb|CDP14078.1|  unnamed protein product                                166   3e-45   
ref|XP_010031265.1|  PREDICTED: myb-related protein B                   166   3e-45   
ref|XP_003616662.1|  Myb transcription factor                           163   4e-45   
gb|KJB36867.1|  hypothetical protein B456_006G179700                    166   4e-45   
ref|XP_009346994.1|  PREDICTED: myb-related protein 306-like            165   4e-45   
gb|ADE92933.1|  transcription factor MYB6                               159   4e-45   
ref|XP_002315183.2|  hypothetical protein POPTR_0010s20220g             166   4e-45   
gb|KHG04525.1|  Transcription factor MYB44 -like protein                165   4e-45   
ref|XP_011036027.1|  PREDICTED: transcription factor MYB76-like         166   4e-45   
ref|XP_004970585.1|  PREDICTED: myb-related protein 306-like            166   4e-45   
ref|XP_002527890.1|  r2r3-myb transcription factor, putative            165   5e-45   
ref|XP_011038690.1|  PREDICTED: transcriptional activator Myb-like      166   5e-45   
ref|NP_001141619.2|  MYB transcription factor                           165   5e-45   
emb|CBH32525.1|  Myb-like DNA-binding domain containing protein,e...    166   6e-45   
ref|XP_007160819.1|  hypothetical protein PHAVU_001G019200g             159   9e-45   
gb|ADL36766.1|  MYB domain class transcription factor                   164   9e-45   
ref|XP_008370028.1|  PREDICTED: transcription factor MYB59-like         164   1e-44   
ref|XP_008345508.1|  PREDICTED: transcription factor MYB59-like         164   1e-44   
gb|KDP24518.1|  hypothetical protein JCGZ_25082                         164   1e-44   
ref|XP_008392894.1|  PREDICTED: myb-related protein 306-like            164   1e-44   
ref|XP_010508952.1|  PREDICTED: uncharacterized protein LOC104785436    164   1e-44   
ref|XP_002458769.1|  hypothetical protein SORBIDRAFT_03g039950          164   1e-44   
gb|AAZ20427.1|  MYB2                                                    164   2e-44   
ref|XP_009615291.1|  PREDICTED: transcription factor MYB122-like        164   2e-44   
ref|XP_010690407.1|  PREDICTED: uncharacterized protein LOC104903953    164   2e-44   
ref|XP_010534544.1|  PREDICTED: transcription factor MYB86-like         162   2e-44   
ref|XP_009351142.1|  PREDICTED: myb-related protein 306-like            164   2e-44   
gb|EEC79030.1|  hypothetical protein OsI_19572                          160   2e-44   
ref|XP_010106095.1|  Transcription factor                               164   2e-44   
ref|XP_009781248.1|  PREDICTED: transcription factor MYB122-like        163   2e-44   
gb|KDO58018.1|  hypothetical protein CISIN_1g017566mg                   162   2e-44   
ref|XP_006480929.1|  PREDICTED: myb-related protein B-like              162   3e-44   
gb|KFK36882.1|  hypothetical protein AALP_AA4G184000                    162   3e-44   
ref|XP_006429252.1|  hypothetical protein CICLE_v10012003mg             162   3e-44   
ref|XP_010232563.1|  PREDICTED: uncharacterized protein LOC100827463    164   3e-44   
ref|NP_191132.1|  myb domain protein 109                                163   4e-44   
gb|AAS10070.1|  MYB transcription factor                                163   4e-44   
ref|XP_009123435.1|  PREDICTED: myb protein-like                        162   5e-44   
ref|XP_009116273.1|  PREDICTED: uncharacterized protein LOC103841480    162   5e-44   
ref|XP_003520943.1|  PREDICTED: transcription factor MYB44-like         161   5e-44   
ref|XP_002881682.1|  predicted protein                                  162   5e-44   
emb|CDY27271.1|  BnaA09g35310D                                          162   6e-44   
gb|KEH28952.1|  myb transcription factor                                161   6e-44   
ref|XP_003516915.1|  PREDICTED: myb protein-like                        161   7e-44   
ref|XP_009344337.1|  PREDICTED: transcription factor MYB86-like         162   8e-44   
gb|AEI89704.1|  transcription factor MYB1 protein                       162   9e-44   
ref|NP_001288045.1|  transcription factor MYB86-like                    162   9e-44   
ref|XP_006486452.1|  PREDICTED: uncharacterized protein LOC102618168    163   1e-43   
gb|KDO69257.1|  hypothetical protein CISIN_1g012494mg                   163   1e-43   
ref|XP_006435568.1|  hypothetical protein CICLE_v10031463mg             163   1e-43   
emb|CDX72208.1|  BnaC08g26660D                                          161   1e-43   
gb|KCW50449.1|  hypothetical protein EUGRSUZ_J00189                     156   1e-43   
ref|XP_010256737.1|  PREDICTED: uncharacterized protein LOC104597...    162   2e-43   
ref|XP_006403424.1|  hypothetical protein EUTSA_v10010431mg             161   2e-43   
gb|AGN52092.1|  MYB-related transcription factor                        160   2e-43   
ref|XP_010504436.1|  PREDICTED: myb-related protein B-like              160   3e-43   



>ref|XP_006339846.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=371

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 141/149 (95%), Gaps = 4/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS S++DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SKRDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+SAD
Sbjct  60   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSAD  119

Query  488  EGNDLADRL---QHQPLKRSVSAGAAVTL  565
            EGN+LAD++   Q  PLKRSVSAG+A+ +
Sbjct  120  EGNELADQIFENQQPPLKRSVSAGSAMPV  148



>ref|XP_010315996.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=372

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 3/145 (2%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            S++DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    SKRDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+SADEGN+
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSADEGNE  127

Query  500  LADRL---QHQPLKRSVSAGAAVTL  565
            LAD+L   Q  PLKRSVSAG+A+ +
Sbjct  128  LADQLFENQQPPLKRSVSAGSAMPV  152



>gb|AAG08959.1|AF122051_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=364

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 3/141 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+SADEGN+LAD+
Sbjct  61   TPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSADEGNELADQ  120

Query  512  L---QHQPLKRSVSAGAAVTL  565
            +   Q  PLKRSVSAG+A+ +
Sbjct  121  IFENQQPPLKRSVSAGSAMPV  141



>ref|XP_009588514.1| PREDICTED: transcription factor MYB44 [Nicotiana tomentosiformis]
Length=361

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 136/145 (94%), Gaps = 3/145 (2%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            S+KDMDRVKGPWSPEEDELLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    SKKDMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK SS+SADEGN+
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSLSADEGNE  127

Query  500  LADRL---QHQPLKRSVSAGAAVTL  565
            LAD++   +  PLKRSVSAG+A+ +
Sbjct  128  LADQIFQNEQPPLKRSVSAGSAMPV  152



>ref|XP_009798591.1| PREDICTED: transcription factor MYB44 [Nicotiana sylvestris]
Length=357

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 138/148 (93%), Gaps = 3/148 (2%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
            ++ S+KDMDRVKGPWSPEEDELLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  5    SNCSKKDMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  64

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK SS+SADE
Sbjct  65   QVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSLSADE  124

Query  491  GNDLADRL---QHQPLKRSVSAGAAVTL  565
            GN+LAD++   +  PLKRSVSAG+A+ +
Sbjct  125  GNELADQIFQNEQPPLKRSVSAGSAMPV  152



>ref|XP_007155887.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
 gb|ESW27881.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
Length=289

 Score =   255 bits (651),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M ++SRKDMDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MMAVSRKDMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS-MSA  484
            PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS M+A
Sbjct  61   PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMNA  120

Query  485  DEGNDLADRLQHQPLKRSVSAGAAV  559
            ++    A     QPLKRSVSAGAA+
Sbjct  121  EDPAAAAAGYSPQPLKRSVSAGAAL  145



>gb|AEO27498.1| MYB2 [Chrysanthemum x morifolium]
Length=315

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 135/146 (92%), Gaps = 2/146 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MA++S+KDMDR+KGPWSP+EDE+L  LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATVSKKDMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAFTPEED+TI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSM+ +
Sbjct  61   PEVEHRAFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTNE  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTL  565
            E N+L  ++Q   LKRSVSAG+ V +
Sbjct  121  EFNEL--QVQQPMLKRSVSAGSGVPI  144



>ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=360

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 7/173 (4%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            + DMDR+KGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  12   KMDMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  71

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG---  493
            RAFTPEED+TIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+S+S+DEG   
Sbjct  72   RAFTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASLSSDEGNFN  131

Query  494  -NDLADRLQHQPLKRSVSAGAAVT---LHLNpgspsgsdvsesslpvMSPSHV  640
             N+       +PLKRSVSAG+ V    L+L+PGSPSGSDVS+SSLPVMS SHV
Sbjct  132  DNNEFGSQTERPLKRSVSAGSGVPVSGLYLSPGSPSGSDVSDSSLPVMSASHV  184



>ref|XP_010244270.1| PREDICTED: transcription factor MYB44 [Nelumbo nucifera]
Length=330

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+S SRKD DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSSRKDQDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHRAFTPEED+TIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSM+ D
Sbjct  61   PQVEHRAFTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMT-D  119

Query  488  EGNDLADRLQHQPLKRSVSAGAAV  559
            EG+   D   +QPLKRSVSAGAA+
Sbjct  120  EGS--VDGHVNQPLKRSVSAGAAI  141



>gb|AIK01747.1| MYB [Chrysanthemum indicum var. aromaticum]
Length=315

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 134/146 (92%), Gaps = 2/146 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS+S+KDMDR+KGPWSP+EDE+L  LV+KHGPRNWSLISKSIPGRSGKSCRLRWCN+LS
Sbjct  1    MASVSKKDMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNRLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P VEHRAFTPEED+TI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSM+ +
Sbjct  61   PDVEHRAFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTNE  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTL  565
            E N+L  ++Q   LKRSVSAG+ V +
Sbjct  121  EFNEL--QVQQPMLKRSVSAGSGVPI  144



>ref|XP_004511885.1| PREDICTED: transcription factor MYB44-like [Cicer arietinum]
Length=323

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
             +I+RK+MDR+KGPWSPEEDE LQ LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  3    TTITRKEMDRIKGPWSPEEDEALQNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  62

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHRAFTPEEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+  DE
Sbjct  63   QVEHRAFTPEEDDTIVRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDE  122

Query  491  GNDLADRLQHQPLKRSVSAGAAVTL  565
                      QPLKRSVSAGAA+ +
Sbjct  123  S---------QPLKRSVSAGAAIPV  138



>ref|XP_003524661.1| PREDICTED: transcription factor MYB44 [Glycine max]
Length=295

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 6/173 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M +++RKDMDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MIAVARKDMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS--MS  481
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+S  M+
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMMA  120

Query  482  ADEGNDLADRLQHQPLKRSVSAGAAVTLHLNpgspsgsdvsesslpvMSPSHV  640
             DE   ++ R    PLKRS SAGAAV    +P     S+ S   +  +SPSHV
Sbjct  121  GDEAVAVSPR----PLKRSFSAGAAVPPPGSPSGSDFSESSAPGVVSVSPSHV  169



>gb|AHB59606.1| putative MYB-related protein 20 [Arachis hypogaea]
Length=352

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 5/144 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +++RKDMDR+KGPWSPEED+ LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  9    AVTRKDMDRIKGPWSPEEDDALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  68

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+SM   + 
Sbjct  69   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASMGPIDD  128

Query  494  NDLADRLQHQPLKRSVSAGAAVTL  565
               A     QPLKRSVSAGAAV +
Sbjct  129  PHFA-----QPLKRSVSAGAAVPV  147



>ref|XP_010271172.1| PREDICTED: transcription factor MYB44-like [Nelumbo nucifera]
Length=329

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            S SRKD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    SSSRKDVDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+TII+AHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS++ D G
Sbjct  62   VEHRAFTPEEDETIIKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSVTEDSG  121

Query  494  NDLADRLQHQPLKRSVSAGAAV  559
                D    QPLKRSVSAGAA+
Sbjct  122  ---VDGHASQPLKRSVSAGAAI  140



>gb|ACJ85153.1| unknown [Medicago truncatula]
Length=199

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 7/143 (5%)
 Frame = +2

Query  137  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  316
            I+RK+MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQV
Sbjct  6    INRKEMDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQV  65

Query  317  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN  496
            EHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+  D+  
Sbjct  66   EHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDS-  124

Query  497  DLADRLQHQPLKRSVSAGAAVTL  565
                  +  PLKRSVSAGAA+ +
Sbjct  125  ------ESPPLKRSVSAGAAIPV  141



>gb|AFK47194.1| unknown [Medicago truncatula]
Length=326

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 7/143 (5%)
 Frame = +2

Query  137  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  316
            I+RK+MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQV
Sbjct  6    INRKEMDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQV  65

Query  317  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN  496
            EHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+  D+  
Sbjct  66   EHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDS-  124

Query  497  DLADRLQHQPLKRSVSAGAAVTL  565
                  +  PLKRSVSAGAA+ +
Sbjct  125  ------ESPPLKRSVSAGAAIPV  141



>gb|ABN11121.1| MYB transcription factor [Capsicum annuum]
Length=345

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 3/141 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ SPQVEHR  
Sbjct  1    MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQSSPQVEHRPL  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEEDDTIIR HARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC S+SADEG +LAD+
Sbjct  61   TPEEDDTIIRPHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCCSLSADEGRELADQ  120

Query  512  L--QHQ-PLKRSVSAGAAVTL  565
            +   HQ PLKRSVSAG+A+ +
Sbjct  121  IFENHQPPLKRSVSAGSAMPV  141



>ref|NP_001235731.1| MYB transcription factor MYB178 [Glycine max]
 gb|ABH02834.1| MYB transcription factor MYB178 [Glycine max]
Length=178

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 3/145 (2%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M +++RK+MDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MMAVARKEMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS-MSA  484
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+S M+A
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMTA  120

Query  485  DEGNDLADRLQHQPLKRSVSAGAAV  559
            DE    A     +PLKRS SAG AV
Sbjct  121  DEA--AAGGFSPRPLKRSFSAGTAV  143



>gb|ABQ10818.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM  + G
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENG  121

Query  494  ---------NDLADRLQHQP--LKRSVSAGAAVTL  565
                      D  D +Q QP  LKRSVSAG++V +
Sbjct  122  IFLNCNGYDADFGDSIQQQPLKLKRSVSAGSSVPV  156



>ref|XP_004287994.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=309

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 8/171 (5%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEED+ LQ LVQKHGPRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  11   MDRIKGPWSPEEDDALQSLVQKHGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRAF  70

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD-EGNDL--  502
            TPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSMS D  GN +  
Sbjct  71   TPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDDGNGNGVGY  130

Query  503  -ADRLQHQPLKRSVSAGAAV----TLHLNpgspsgsdvsesslpvMSPSHV  640
              +  +  PLKRSVSAG+ V     L +NPGSPSGSD+S+SS+ VMSPSHV
Sbjct  131  DGNFHEQPPLKRSVSAGSGVPVSTELFMNPGSPSGSDLSDSSVQVMSPSHV  181



>gb|KDP31997.1| hypothetical protein JCGZ_12458 [Jatropha curcas]
 gb|AIT52201.1| MYB family protein [Jatropha curcas]
Length=326

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +++ KD+DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVTNKDVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM+ D G
Sbjct  62   VEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMAEDGG  121

Query  494  NDLADRLQHQPLKRSVSAGAAVTL  565
               A     QPLKRSVSAG+ + +
Sbjct  122  ---AFDGNCQPLKRSVSAGSGMAV  142



>ref|XP_006425988.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
 gb|ABQ10816.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ESR39228.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
Length=317

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM  + G
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENG  121

Query  494  ---------NDLADRLQHQP--LKRSVSAGAAVTL  565
                      D  + +Q QP  LKRSVSAG++V +
Sbjct  122  IFLNCNGYDADFGNSIQQQPLKLKRSVSAGSSVPV  156



>gb|ABQ10819.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM  + G
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENG  121

Query  494  ---------NDLADRLQHQP--LKRSVSAGAAVTL  565
                      D  + +Q QP  LKRSVSAG++V +
Sbjct  122  IFLNCNGYDADFGNSIQQQPLKLKRSVSAGSSVPV  156



>ref|NP_001275856.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ABQ10817.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|KDO79070.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=317

 Score =   248 bits (633),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM  + G
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENG  121

Query  494  ---------NDLADRLQHQP--LKRSVSAGAAVTL  565
                      D  + +Q QP  LKRSVSAG++V +
Sbjct  122  IFLNCNGYDADFGNSIQQQPLKLKRSVSAGSSVPV  156



>ref|XP_002310702.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
 gb|EEE91152.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
Length=330

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 130/151 (86%), Gaps = 7/151 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +I+RK+MDR+KGPWSPEEDE LQ+LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AITRKEMDRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD--  487
            VEHR FTP+EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM+ D  
Sbjct  62   VEHRPFTPDEDDTIIRAHARFGNKWATIARLLYGRTDNAIKNHWNSTLKRKCSSMAEDGN  121

Query  488  ----EGNDL-ADRLQHQPLKRSVSAGAAVTL  565
                EG D   D    QPLKRSVSAG+ V +
Sbjct  122  FCNREGYDGNLDGDNTQPLKRSVSAGSGVPV  152



>ref|XP_011006987.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=330

 Score =   248 bits (634),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 130/151 (86%), Gaps = 7/151 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +I+RK+MDR+KGPWSPEEDE LQ+LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AITRKEMDRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD--  487
            VEHR FTP+EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM+ D  
Sbjct  62   VEHRPFTPDEDDTIIRAHARFGNKWATIARLLYGRTDNAIKNHWNSTLKRKCSSMAEDGN  121

Query  488  ----EGNDL-ADRLQHQPLKRSVSAGAAVTL  565
                EG D   D    QPLKRSVSAG+ V +
Sbjct  122  FCNREGYDGNLDGDNTQPLKRSVSAGSGVPV  152



>gb|KDO79069.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=278

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM  + G
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENG  121

Query  494  ---------NDLADRLQHQP--LKRSVSAGAAVTL  565
                      D  + +Q QP  LKRSVSAG++V +
Sbjct  122  IFLNCNGYDADFGNSIQQQPLKLKRSVSAGSSVPV  156



>emb|CDP02540.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 126/140 (90%), Gaps = 2/140 (1%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            RKD DR+KGPWSPEED+LLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  17   RKDADRIKGPWSPEEDDLLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  76

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-SADEG-N  496
            RAFTPEEDD IIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+ S+DE  N
Sbjct  77   RAFTPEEDDAIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSITSSDEATN  136

Query  497  DLADRLQHQPLKRSVSAGAA  556
            D      HQPLKR+ S G+ 
Sbjct  137  DFPLHHHHQPLKRTASTGSG  156



>ref|XP_002285015.1| PREDICTED: transcription factor MYB44-like [Vitis vinifera]
Length=313

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 128/146 (88%), Gaps = 4/146 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS S+KD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SKKDLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHRAFTPEED TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS++ D
Sbjct  60   PQVEHRAFTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSSITED  119

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTL  565
                +AD     PLKRS S GA  T+
Sbjct  120  M---IADGHAQPPLKRSASVGAGTTV  142



>ref|XP_011010210.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=335

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 130/152 (86%), Gaps = 9/152 (6%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +RK+MDR+KGPWSPEEDE LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ATTRKEMDRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM AD+G
Sbjct  62   VEHRAFTPEEDDKIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM-ADDG  120

Query  494  N--------DLADRLQHQPLKRSVSAGAAVTL  565
            N           D   +QP KRSVSAGA V L
Sbjct  121  NFSNLDGYDGNLDVDGNQPSKRSVSAGAGVPL  152



>ref|XP_008360495.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like, 
partial [Malus domestica]
Length=199

 Score =   242 bits (617),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA---  484
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS +     
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGGVVL  121

Query  485  DEGNDLADRLQHQ--PLKRSVSAGAAVTL  565
            + G D    L H+  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHYLLDHEQPPLKRSVSAGSGVPV  150



>ref|XP_006374871.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
 gb|ERP52668.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
Length=311

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 128/149 (86%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS SRKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+ EEDDTIIRAHAR GNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM   
Sbjct  60   PEVEHRPFSAEEDDTIIRAHARIGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMF--  117

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
              +DL D  Q QPLKRS S GA   LHLN
Sbjct  118  --DDLNDDAQQQPLKRSASLGAGSGLHLN  144



>gb|AFH03065.1| R2R3-MYB transcription factor MYB13 [Epimedium sagittatum]
Length=350

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 131/145 (90%), Gaps = 6/145 (4%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
            +S SRKDMDR+KGPWSPEED+ L +LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  3    SSSSRKDMDRIKGPWSPEEDDSLTKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  62

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHRAFTPEEDDTIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS S  +
Sbjct  63   QVEHRAFTPEEDDTIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSSSMAD  122

Query  491  GNDLADRLQHQPLKRSVSAGAAVTL  565
             +DL       PLKRSVSAGAAVT+
Sbjct  123  DDDLP------PLKRSVSAGAAVTV  141



>ref|XP_011097391.1| PREDICTED: transcription factor MYB44 [Sesamum indicum]
Length=385

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 4/143 (3%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            + D+DR+KGPWSPEED+LLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  11   KMDVDRIKGPWSPEEDDLLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  70

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN-D  499
            RAFTPEED+TIIRAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC+S+S+DEGN D
Sbjct  71   RAFTPEEDETIIRAHAKFGNKWATIARLLPGRTDNAVKNHWNSTLKRKCTSLSSDEGNFD  130

Query  500  LADRLQHQ---PLKRSVSAGAAV  559
              +    Q   PLKRSVSAG+ V
Sbjct  131  DKNEFLSQSERPLKRSVSAGSGV  153



>gb|KDP41681.1| hypothetical protein JCGZ_16088 [Jatropha curcas]
 gb|AIT52202.1| MYB family protein [Jatropha curcas]
Length=313

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 129/152 (85%), Gaps = 8/152 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASAARKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT +EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+S D
Sbjct  61   PEVEHRPFTADEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSDD  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT---LHLN  574
              +D+      QPLKRS S GA      LHLN
Sbjct  121  LNDDV-----QQPLKRSASVGAGTNISGLHLN  147



>ref|XP_003611666.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES94624.1| myb transcription factor [Medicago truncatula]
Length=316

 Score =   245 bits (626),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 124/138 (90%), Gaps = 7/138 (5%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+  D+       
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDS------  114

Query  512  LQHQPLKRSVSAGAAVTL  565
             +  PLKRSVSAGAA+ +
Sbjct  115  -ESPPLKRSVSAGAAIPV  131



>ref|NP_001235688.1| MYB transcription factor MYB61 [Glycine max]
 gb|ABH02829.1| MYB transcription factor MYB61 [Glycine max]
Length=305

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 6/146 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M +++RKDMDR+KGPWSPEEDE L +LV++HGPRNWSLIS+SIPGRSGKSC LRWCNQLS
Sbjct  1    MIAVARKDMDRIKGPWSPEEDEALHKLVERHGPRNWSLISRSIPGRSGKSCMLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS--MS  481
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+S  M+
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMMA  120

Query  482  ADEGNDLADRLQHQPLKRSVSAGAAV  559
             DE   ++ R    PLKRS SAGAAV
Sbjct  121  GDEAVAVSPR----PLKRSFSAGAAV  142



>ref|XP_009795719.1| PREDICTED: transcription factor MYB44-like [Nicotiana sylvestris]
Length=332

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 130/152 (86%), Gaps = 7/152 (5%)
 Frame = +2

Query  128  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQL  60

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHRAFTPEED+TIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS 
Sbjct  61   SPQVEHRAFTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSMS-  119

Query  485  DEGNDLADRLQHQPLKRSVSAGAAVTL--HLN  574
                DL+     QPLKRS S G +     H+N
Sbjct  120  ---EDLSFETPQQPLKRSSSVGPSTNFSSHMN  148



>ref|XP_008391509.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=313

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA---  484
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS +     
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGGVVL  121

Query  485  DEGNDLADRLQHQ--PLKRSVSAGAAVTL  565
            + G D    L H+  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHYLLDHEQPPLKRSVSAGSGVPV  150



>emb|CAN75196.1| hypothetical protein VITISV_014739 [Vitis vinifera]
Length=301

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RKD+DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  4    TRKDVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  63

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFT EEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCS+++ D G+ 
Sbjct  64   HRAFTSEEDDTIMRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSAITED-GSF  122

Query  500  LADRLQHQPLKRSVSAGAAVTL  565
              D   H PLKRSVSAGAA  +
Sbjct  123  GGDYPPH-PLKRSVSAGAAAPV  143



>ref|XP_011029247.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=311

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 128/149 (86%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+ EEDDTIIRAHAR GNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM   
Sbjct  60   PEVEHRPFSAEEDDTIIRAHARIGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMF--  117

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
              +DL D  Q QPLKRS S GA   LHLN
Sbjct  118  --DDLNDDAQQQPLKRSASLGAGSGLHLN  144



>ref|XP_002302428.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
 gb|EEE81701.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
Length=321

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 127/149 (85%), Gaps = 4/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            ++ I RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  18   LSYILRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  77

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+ EEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS  
Sbjct  78   PEVEHRPFSAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMS--  135

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
              +DL D    QPLKRS S GA   L+LN
Sbjct  136  --DDLNDDAHQQPLKRSASLGAGSGLYLN  162



>ref|XP_011017151.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=305

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 127/149 (85%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+ EEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS  
Sbjct  60   PEVEHRPFSAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMS--  117

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
              +D  D    QPLKRS S GA   L+LN
Sbjct  118  --DDFNDDTHQQPLKRSASLGAGSGLYLN  144



>ref|XP_004141899.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004157164.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN48557.1| Sucrose responsive element binding protein [Cucumis sativus]
Length=301

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +++RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALTRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHR F+PEED+TIIRAHA FGN+WATIARLL GRTDNA+KNHWNSTLKRKCS M  +EG
Sbjct  62   VEHRPFSPEEDETIIRAHANFGNRWATIARLLTGRTDNAVKNHWNSTLKRKCSLM-MNEG  120

Query  494  NDLADRLQHQPLKRSVSAGAAV  559
             ++   +  QP+K+SVSAGAAV
Sbjct  121  YEVDPNV--QPMKKSVSAGAAV  140



>ref|XP_002306488.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
 gb|EEE93484.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
Length=351

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 131/155 (85%), Gaps = 15/155 (10%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            + +RK+MDR+KGPWSPEEDE L++LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ATTRKEMDRIKGPWSPEEDEALKKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM AD+G
Sbjct  62   VEHRAFTPEEDDRIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM-ADDG  120

Query  494  N-----------DLADRLQHQPLKRSVSAGAAVTL  565
            N           D+ D    QP KRSVSAG+ V L
Sbjct  121  NLSNLEGYDGNLDVDD---TQPSKRSVSAGSGVPL  152



>ref|NP_001268121.1| sucrose responsive element binding protein [Vitis vinifera]
 gb|AAY28930.1| sucrose responsive element binding protein [Vitis vinifera]
Length=312

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RKD DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  4    TRKDADRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  63

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFT EEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCS+++ D G+ 
Sbjct  64   HRAFTSEEDDTIMRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSAITED-GSF  122

Query  500  LADRLQHQPLKRSVSAGAAVTL  565
              D   H PLKRSVSAGAA  +
Sbjct  123  GGDYPPH-PLKRSVSAGAAAPV  143



>gb|AGN52031.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52141.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=317

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +R + DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    ARSEADRIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFTPEED+TIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS +E ND
Sbjct  63   HRAFTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCVSMS-EEFND  121

Query  500  LADRLQHQPLKRSVSAGAAVTL  565
              D    QPLKRS S G    +
Sbjct  122  F-DPEARQPLKRSASVGPGTNI  142



>ref|XP_004238123.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=328

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 125/147 (85%), Gaps = 5/147 (3%)
 Frame = +2

Query  128  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQL  60

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHRAFTPEEDDTIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS 
Sbjct  61   SPQVEHRAFTPEEDDTIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMS-  119

Query  485  DEGNDLADRLQHQPLKRSVSAGAAVTL  565
                DL+      PLKRS S G     
Sbjct  120  ---EDLSFETPQPPLKRSSSVGPCTNF  143



>ref|XP_008351390.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=255

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA---  484
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS +     
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGGVVL  121

Query  485  DEGNDLADRLQHQ--PLKRSVSAGAAVTL  565
            + G D    L H+  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHYLLDHEQPPLKRSVSAGSGVPV  150



>ref|XP_009367649.1| PREDICTED: transcription factor MYB44 [Pyrus x bretschneideri]
Length=323

 Score =   243 bits (621),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS---SMSA  484
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS    +  
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVVL  121

Query  485  DEGNDLADRLQHQ--PLKRSVSAGAAVTL  565
            + G D    L H+  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHFLLDHEQPPLKRSVSAGSGVPV  150



>ref|XP_009372447.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=316

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 129/150 (86%), Gaps = 7/150 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-----  478
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS       
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDL  121

Query  479  -SADEGNDLADRLQHQPLKRSVSAGAAVTL  565
              A +G+ L D  Q  PLKRSVSAG+ V +
Sbjct  122  NGAYDGHVLHDHEQ-PPLKRSVSAGSGVPV  150



>emb|CDY22442.1| BnaC03g61550D [Brassica napus]
Length=275

 Score =   241 bits (616),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEED+TI+RAHARFGNKWATI+RLL+GRTDNAIKNHWNSTLKRKCS++++D
Sbjct  61   PEVEHRGFSPEEDETIVRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCSAVTSD  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT  562
             G D  +  + QPLKR+ S G   T
Sbjct  121  -GYD-GNIGEEQPLKRTASGGGVST  143



>gb|AFK46950.1| unknown [Medicago truncatula]
Length=316

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 123/138 (89%), Gaps = 7/138 (5%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+K GPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKRGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+  D+       
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDS------  114

Query  512  LQHQPLKRSVSAGAAVTL  565
             +  PLKRSVSAGAA+ +
Sbjct  115  -ESPPLKRSVSAGAAIPV  131



>gb|KJB43824.1| hypothetical protein B456_007G218100 [Gossypium raimondii]
Length=310

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 9/144 (6%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            RK+MDR+KGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  9    RKEMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  68

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDL  502
            RAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC  +  +E N +
Sbjct  69   RAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCLPV-GEECNFV  127

Query  503  AD--------RLQHQPLKRSVSAG  550
            A+          + QPLKRSVSAG
Sbjct  128  ANGGYDGNLGGEERQPLKRSVSAG  151



>gb|AHN19845.1| MYB6 [Malus hybrid cultivar]
Length=310

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 128/150 (85%), Gaps = 7/150 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-----  478
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS       
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDL  121

Query  479  -SADEGNDLADRLQHQPLKRSVSAGAAVTL  565
                +G+ L D  Q  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHFLRDHEQ-PPLKRSVSAGSGVPV  150



>ref|XP_008440323.1| PREDICTED: transcription factor MYB44 [Cucumis melo]
Length=303

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +++RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALTRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHR F+PEED+TIIRAHA FGN+WATIARLL GRTDNA+KNHWNSTLKRKCS M  +EG
Sbjct  62   VEHRPFSPEEDETIIRAHANFGNRWATIARLLTGRTDNAVKNHWNSTLKRKCSLM-MNEG  120

Query  494  NDLADRLQHQPLKRSVSAGAAV  559
             ++   +  QP+K+S+SAGAAV
Sbjct  121  YEVDPNV--QPMKKSLSAGAAV  140



>ref|XP_006411909.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
 gb|ESQ53362.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
Length=321

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 5/153 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAF+PEED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS++++D
Sbjct  61   PEVEHRAFSPEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAVASD  120

Query  488  -----EGNDLADRLQHQPLKRSVSAGAAVTLHL  571
                  G    +  + QPLKR+ S G  V+  L
Sbjct  121  GDFGGNGGYDGNLGEEQPLKRTASGGGGVSTGL  153



>ref|XP_010095320.1| Transcription factor [Morus notabilis]
 gb|EXB59531.1| Transcription factor [Morus notabilis]
Length=304

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD---EGNDL  502
            TP+ED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS+M  D    G D 
Sbjct  61   TPDEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSTMFDDCNGHGYDG  120

Query  503  ADRLQHQPLKRSVSAGAAVTL  565
            +   Q QPLKRSVSAG+A+ +
Sbjct  121  SFAAQ-QPLKRSVSAGSAMPV  140



>ref|XP_006367421.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=320

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 125/147 (85%), Gaps = 5/147 (3%)
 Frame = +2

Query  128  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQL  60

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHRAFTPEEDDTIIRAHA++GNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS 
Sbjct  61   SPQVEHRAFTPEEDDTIIRAHAKYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMS-  119

Query  485  DEGNDLADRLQHQPLKRSVSAGAAVTL  565
                DL+      PLKRS S G     
Sbjct  120  ---EDLSFETPQPPLKRSSSVGPCTNF  143



>ref|NP_001238087.1| MYB transcription factor MYB50 [Glycine max]
 gb|ABH02824.1| MYB transcription factor MYB50 [Glycine max]
 gb|KHN12962.1| Transcription factor MYB44 [Glycine soja]
Length=297

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 121/138 (88%), Gaps = 8/138 (6%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            T EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS   D+       
Sbjct  61   TAEEDDTIIRAHARFGNKWATIARLLHGRTDNAIKNHWNSTLKRKCSSTMIDDNT-----  115

Query  512  LQHQPLKRSVSAGAAVTL  565
               QPLKRSVSAGAA+ +
Sbjct  116  ---QPLKRSVSAGAAIPV  130



>gb|AAZ20429.1| MYB6 [Malus domestica]
 gb|ADL36770.1| MYB domain class transcription factor [Malus domestica]
Length=312

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 128/150 (85%), Gaps = 7/150 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-----  478
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS       
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDL  121

Query  479  -SADEGNDLADRLQHQPLKRSVSAGAAVTL  565
                +G+ L D  Q  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHFLRDHEQ-PPLKRSVSAGSGVPV  150



>ref|XP_008338349.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=312

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 127/150 (85%), Gaps = 7/150 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SRKDMDR+KGPWSPEED+ LQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQXLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-----  478
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS       
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDL  121

Query  479  -SADEGNDLADRLQHQPLKRSVSAGAAVTL  565
                +G+ L D  Q  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHFLRDHEQ-PPLKRSVSAGSGVPV  150



>ref|XP_002524926.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF37423.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=339

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 130/156 (83%), Gaps = 14/156 (9%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            +++ K++DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVTGKEVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC S+  DEG
Sbjct  62   VEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCCSL--DEG  119

Query  494  ND-----------LADRL-QHQPLKRSVSAGAAVTL  565
             D             D L   QPLKRSVSAG+ V +
Sbjct  120  YDGNLCCSNNNNNNNDSLINTQPLKRSVSAGSGVPV  155



>ref|XP_009109365.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=305

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEED+TIIRAHARFGNKWATI+RLL+GRTDNAIKNHWNSTLKRKC+ +++D
Sbjct  61   PEVEHRGFSPEEDETIIRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCNGVASD  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT  562
             G D  +  + QPLKR+ S G   T
Sbjct  121  -GYD-GNIGEEQPLKRTASGGGVST  143



>gb|KJB40285.1| hypothetical protein B456_007G055600 [Gossypium raimondii]
Length=314

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 10/145 (7%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            +K+MDR+KGPWSPEED+LLQ+LVQK+GPRNWSL+SKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  9    KKEMDRIKGPWSPEEDDLLQKLVQKYGPRNWSLVSKSIPGRSGKSCRLRWCNQLSPQVEH  68

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD-----  487
            RAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC S+  +     
Sbjct  69   RAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCLSVGEESYFIT  128

Query  488  ----EGNDLADRLQHQPLKRSVSAG  550
                +GN L    + QPLKRSVSAG
Sbjct  129  HGGYDGN-LGGEGEQQPLKRSVSAG  152



>emb|CDY44045.1| BnaA08g15610D [Brassica napus]
Length=285

 Score =   239 bits (611),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEED+TIIRAHARFGNKWATI+RLL+GRTDNAIKNHWNSTLKRKC+ +++D
Sbjct  61   PEVEHRGFSPEEDETIIRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCNGVASD  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT  562
             G D  +  + QPLKR+ S G   T
Sbjct  121  -GYD-GNIGEEQPLKRTASGGGVST  143



>ref|XP_007156759.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
 gb|ESW28753.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
Length=300

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 8/138 (6%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEEDDTI+RAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC+S   D+       
Sbjct  61   TPEEDDTIVRAHARFGNKWATIARLLQGRTDNAIKNHWNSTLKRKCASTMMDD-------  113

Query  512  LQHQPLKRSVSAGAAVTL  565
                PLKRSVSAGAA+ +
Sbjct  114  -HPPPLKRSVSAGAAIPV  130



>ref|XP_007047395.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX91552.1| Myb domain protein 73, putative [Theobroma cacao]
Length=312

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 11/146 (8%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK+MDR+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    NRKEMDRIKGPWSPEEDDLLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD----  487
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC S+  +    
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCLSVGEECNFI  127

Query  488  -----EGNDLADRLQHQPLKRSVSAG  550
                 +GN   +  + QPLKRSVSAG
Sbjct  128  TNGGYDGNLRGE--EQQPLKRSVSAG  151



>gb|AHN19846.1| MYB6 [Malus hybrid cultivar]
Length=312

 Score =   240 bits (612),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 7/150 (5%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++S KDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSTKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-----  478
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS       
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDL  121

Query  479  -SADEGNDLADRLQHQPLKRSVSAGAAVTL  565
                +G+ L D  Q  PLKRSVSAG+ V +
Sbjct  122  NGGYDGHFLRDHEQ-PPLKRSVSAGSGVPV  150



>ref|XP_011074411.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=327

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 128/150 (85%), Gaps = 3/150 (2%)
 Frame = +2

Query  128  MASI-SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            MAS   +K+ DR+KGPWSPEED+LLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  1    MASTDQKKETDRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  60

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHRAFTPEEDDTII+AHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS 
Sbjct  61   SPQVEHRAFTPEEDDTIIKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCLSMSE  120

Query  485  DEGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
            +  N   D   H PLKRS S G    + ++
Sbjct  121  EFSN--FDPEAHPPLKRSASVGPGTNISVS  148



>gb|AHB59592.1| putative R2R3 MYB protein 4 [Arachis hypogaea]
Length=316

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SR++MDR+KGPWSPEEDE LQ+LV++HGPRNW+LISK IPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AMSRREMDRIKGPWSPEEDEALQRLVERHGPRNWTLISKYIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE-  490
            VEHR FTP+ED+TIIRAHARFGNKWATIARLL+GRTDNA+KNHWNSTLKRKCSSM  DE 
Sbjct  62   VEHRGFTPDEDETIIRAHARFGNKWATIARLLSGRTDNAVKNHWNSTLKRKCSSMMIDEP  121

Query  491  ---GNDLADRLQHQPLKRSVSAGAAVTL  565
                 D       +P KRS SAGA + L
Sbjct  122  ATGPADFDGGYYLRPAKRSASAGATMPL  149



>ref|XP_010679545.1| PREDICTED: transcription factor MYB44 [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK++DR+KGPWSPEEDE L +LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  14   NRKEVDRIKGPWSPEEDEALTRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  73

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCS+M +   ++
Sbjct  74   HRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSAMLSSPSDE  133

Query  500  LADRLQHQPLKRSVSAGAAVTL  565
                    PLKR++S GA V L
Sbjct  134  FPGDYP-PPLKRAMSDGADVIL  154



>dbj|BAC53938.1| Myb-like protein [Nicotiana tabacum]
Length=329

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
            A+  RK+ DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQLSP
Sbjct  3    ANTQRKESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSP  62

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHRAFT EED+TIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS   
Sbjct  63   QVEHRAFTSEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSMS---  119

Query  491  GNDLADRLQHQPLKRSVSAGAAVTL  565
              DL+     QPLKRS S G +   
Sbjct  120  -EDLSFETPQQPLKRSSSVGPSTNF  143



>ref|XP_009586849.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=329

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
            A+  RK+ DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQLSP
Sbjct  3    ANTQRKESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSP  62

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHRAFT EED+TIIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS   
Sbjct  63   QVEHRAFTSEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSMS---  119

Query  491  GNDLADRLQHQPLKRSVSAGAAVTL  565
              DL+     QPLKRS S G +   
Sbjct  120  -EDLSFETPQQPLKRSSSVGPSTNF  143



>gb|ADL36764.1| MYB domain class transcription factor [Malus domestica]
Length=306

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA---DEGNDL  502
            TPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS +     + G D 
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGGVVLNGGYDG  120

Query  503  ADRLQHQ--PLKRSVSAGAAVTL  565
               L H+  PLKRSVSAG+ V +
Sbjct  121  HYLLDHEQPPLKRSVSAGSGVPV  143



>ref|XP_007205522.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
 gb|EMJ06721.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
Length=331

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 125/155 (81%), Gaps = 11/155 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALSRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS +     
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDIGVVFP  121

Query  494  NDLADRL-----------QHQPLKRSVSAGAAVTL  565
                              +  PLKRSVSAG+ + +
Sbjct  122  GGGVGGSGGYDGHFLHDHEQPPLKRSVSAGSGMPV  156



>ref|NP_001235142.1| MYB transcription factor MYB112 [Glycine max]
 gb|ABH02852.1| MYB transcription factor MYB112 [Glycine max]
Length=305

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 7/138 (5%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            T EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC+S   D+ N     
Sbjct  61   THEEDDTIIRAHARFGNKWATIARLLHGRTDNAIKNHWNSTLKRKCTSTMIDDDNT----  116

Query  512  LQHQPLKRSVSAGAAVTL  565
                PLKRS+SAGAA+ +
Sbjct  117  ---PPLKRSLSAGAAIPV  131



>ref|XP_010531261.1| PREDICTED: transcription factor MYB44 [Tarenaya hassleriana]
Length=326

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 129/161 (80%), Gaps = 12/161 (7%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SR++M+R+KGPWSPEED+LLQ+LV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDDLLQKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-SA  484
            P+VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC +M S 
Sbjct  61   PEVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCVTMVSG  120

Query  485  DEGNDL---------ADRLQHQPLKRSVSAGAAVT--LHLN  574
             EG             +     PLKR+ S G  V+  L++N
Sbjct  121  GEGQSYDFVSNGGYDGNLTAEHPLKRTASGGGVVSTGLYMN  161



>emb|CAN81361.1| hypothetical protein VITISV_028904 [Vitis vinifera]
Length=309

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +2

Query  158  RVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  337
            R+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP
Sbjct  6    RIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  65

Query  338  EEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRLQ  517
            EED TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS++ D    +AD   
Sbjct  66   EEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSSITEDM---IADGHA  122

Query  518  HQPLKRSVSAGAAVTL  565
              PLKRS S GA  T+
Sbjct  123  QPPLKRSASVGAGTTV  138



>gb|EYU25477.1| hypothetical protein MIMGU_mgv1a010338mg [Erythranthe guttata]
Length=315

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            R D DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  4    RNDSDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  63

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDL  502
            RAF+PEED+TI+RAHA+FGNKWATIAR+L GRTDNAIKNHWNSTLKRKC SMS +E N+ 
Sbjct  64   RAFSPEEDETIVRAHAKFGNKWATIARMLCGRTDNAIKNHWNSTLKRKCVSMS-EEFNNF  122

Query  503  ADRLQHQPLKRSVSAGAAVT  562
             D     PLKRS S G A +
Sbjct  123  -DPEAQPPLKRSASLGPATS  141



>ref|XP_010059753.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW66164.1| hypothetical protein EUGRSUZ_F000021 [Eucalyptus grandis]
Length=339

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            RKD DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  11   RKDADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  70

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDL  502
            R FTPEED+ I+RAHARFGNKWATIARLL GRTDNA+KNHWNSTLKRKCSS  +  G+D 
Sbjct  71   RPFTPEEDEAIVRAHARFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSSACSAGGDDA  130

Query  503  ADRLQHQPLKRSVSAG  550
                + QPLKRS S G
Sbjct  131  DALAEQQPLKRSASLG  146



>ref|XP_004291065.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 126/154 (82%), Gaps = 11/154 (7%)
 Frame = +2

Query  128  MASISRKDM--DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  301
            MAS S K    DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MASSSTKKAAADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQ  60

Query  302  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS  481
            LSP+VEHR FTPEEDDTIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRK SSMS
Sbjct  61   LSPEVEHRPFTPEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKFSSMS  120

Query  482  ADEGNDLADRLQHQPLKRSVSAGAAVT---LHLN  574
             D         +HQPLKRS S GA  T   L+LN
Sbjct  121  DDMSP------EHQPLKRSASVGAGTTVSGLYLN  148



>gb|KJB63910.1| hypothetical protein B456_010G023500 [Gossypium raimondii]
Length=273

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 121/143 (85%), Gaps = 6/143 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS +RKDMDR+KGPWSPEEDE LQ+LVQ +GPRNW+LISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDMDRIKGPWSPEEDEALQRLVQTYGPRNWTLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FTPEEDDTIIRAHAR GNKWATIARLL GRTDNAIKNHWNSTLKRKC SM+  
Sbjct  60   PEVEHRPFTPEEDDTIIRAHARVGNKWATIARLLNGRTDNAIKNHWNSTLKRKCLSMTEG  119

Query  488  EGNDLADRLQHQPLKRSVSAGAA  556
              +D       QPLKRS S G  
Sbjct  120  FNDD-----SPQPLKRSASVGTG  137



>emb|CDP01282.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  128  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            M +I+ RK+ DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  1    MGTIAHRKESDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  60

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHRAFT +ED+ IIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKR+CSSMS 
Sbjct  61   SPQVEHRAFTADEDEKIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRRCSSMS-  119

Query  485  DEGNDLADRLQHQPLKRSVSAGAAVTL  565
               +D    +  QPLKRS S G    +
Sbjct  120  ---DDFNFEVPQQPLKRSASVGPGTNV  143



>emb|CDX69287.1| BnaC01g01660D [Brassica napus]
Length=306

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 125/153 (82%), Gaps = 8/153 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS  +++
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSGFTSE  120

Query  488  --------EGNDLADRLQHQPLKRSVSAGAAVT  562
                     G    +  + QPLKR+ S G   T
Sbjct  121  GQSCDFGGNGGYDGNLGEEQPLKRTASGGGVST  153



>ref|XP_010556427.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=316

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KD DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  10   KDTDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  69

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSM AD G+  A
Sbjct  70   PFTAEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM-ADGGSSDA  128

Query  506  DRLQHQPLKRSVSAGAAVTL  565
            D    QPLKRS S GA   L
Sbjct  129  D--LEQPLKRSASLGAGTNL  146



>emb|CDX75635.1| BnaA01g00670D [Brassica napus]
Length=299

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 126/153 (82%), Gaps = 8/153 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS+ +++
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAFTSE  120

Query  488  --------EGNDLADRLQHQPLKRSVSAGAAVT  562
                     G    +  + QPLKR+ S G   T
Sbjct  121  GQSCDFGGNGGYDGNLGEEQPLKRTASGGGVST  153



>gb|AGN52088.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52198.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=305

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 115/116 (99%), Gaps = 0/116 (0%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            + D+DR+KGPWSPEED+LLQQLVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  3    KTDIDRIKGPWSPEEDDLLQQLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  62

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            RAFTPEEDDTIIRAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS+++D+
Sbjct  63   RAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSLTSDD  118



>ref|XP_009137661.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
 gb|AHN60130.1| MYB transcription factor 73 [Brassica napus]
Length=328

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 126/153 (82%), Gaps = 8/153 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS+ +++
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAFTSE  120

Query  488  --------EGNDLADRLQHQPLKRSVSAGAAVT  562
                     G    +  + QPLKR+ S G   T
Sbjct  121  GQSCDFGGNGGYDGNLGEEQPLKRTASGGGVST  153



>gb|KDO84060.1| hypothetical protein CISIN_1g022144mg [Citrus sinensis]
Length=302

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMS-D  118

Query  488  EGNDLADRLQHQPLKRSVSAGAA  556
            E     D +   PLKR+ S G +
Sbjct  119  ESQ--VDAINPLPLKRANSVGPS  139



>ref|NP_195443.1| myb domain protein 73 [Arabidopsis thaliana]
 emb|CAB16756.1| myb-related protein [Arabidopsis thaliana]
 emb|CAB80392.1| myb-related protein [Arabidopsis thaliana]
 gb|AAL36268.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAM14206.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAS10083.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86774.1| myb domain protein 73 [Arabidopsis thaliana]
Length=320

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 5/153 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M++ +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSNPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS--SMS  481
            P+VEHRAF+ EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS    S
Sbjct  61   PEVEHRAFSQEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQS  120

Query  482  ADEGNDL---ADRLQHQPLKRSVSAGAAVTLHL  571
             D G +     +  + QPLKR+ S G  V+  L
Sbjct  121  CDFGGNGGYDGNLGEEQPLKRTASGGGGVSTGL  153



>ref|XP_010437245.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=312

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 6/145 (4%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS      G  
Sbjct  66   HRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCS------GGY  119

Query  500  LADRLQHQPLKRSVSAGAAVTLHLN  574
              +  + QPLKR+ S G +  L+++
Sbjct  120  DGNLGEEQPLKRTASGGVSTGLYMS  144



>ref|XP_006434697.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
 gb|ESR47937.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
Length=302

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSMS +
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDE  119

Query  488  EGNDLADRLQHQPLKRSVSAGAA  556
               D  + L   PLKR+ S G +
Sbjct  120  SQVDAINPL---PLKRANSVGPS  139



>ref|NP_001275798.1| putative R2R3-MYB transcription factor [Citrus sinensis]
 gb|AEK32395.1| putative R2R3-MYB transcription factor [Citrus sinensis]
Length=302

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMS-D  118

Query  488  EGNDLADRLQHQPLKRSVSAGAA  556
            E     D +   PLKR+ S G +
Sbjct  119  ESQ--VDAINPLPLKRANSVGPS  139



>ref|XP_010432074.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=322

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 5/149 (3%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS--SMSADEG  493
            HRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS    S D G
Sbjct  66   HRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFG  125

Query  494  NDL---ADRLQHQPLKRSVSAGAAVTLHL  571
             +     +  + QPLKR+ S G +  L++
Sbjct  126  GNGGYDGNLGEEQPLKRTASGGVSTGLYM  154



>gb|AGN52056.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52166.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=257

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEED+LLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            T EEDDTII+AHA+FGNKWATIAR L+GRTDNAIKNHWNSTLKRKC SMS +E  D  D 
Sbjct  61   TAEEDDTIIKAHAKFGNKWATIARFLSGRTDNAIKNHWNSTLKRKCFSMS-EELTDF-DP  118

Query  512  LQHQPLKRSVSAG  550
              H PLKRS SAG
Sbjct  119  EVHHPLKRSASAG  131



>gb|AFV73403.1| R2R3-MYB transcription factor [Jatropha curcas]
Length=313

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 125/152 (82%), Gaps = 8/152 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS +RKD+   K PWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASAARKDVIGSKVPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT +EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+S D
Sbjct  61   PEVEHRPFTADEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSDD  120

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT---LHLN  574
              +D+      QPLKRS S GA      LHLN
Sbjct  121  LNDDV-----QQPLKRSASVGAGTNISGLHLN  147



>ref|XP_008351984.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 126/151 (83%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDT IRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPEEDDTJIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+ D   H P KRS S GA     L+ N
Sbjct  120  LCSDVHD---HPPHKRSASVGAVSGTGLYFN  147



>emb|CBI19466.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 8/144 (6%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS S+KD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  12   MAS-SKKDLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  70

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC--SSMS  481
            PQVEHRAFTPEED TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC  SS S
Sbjct  71   PQVEHRAFTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSPSSPS  130

Query  482  ADEGND-----LADRLQHQPLKRS  538
              E +D     +A  L ++P+ R+
Sbjct  131  GSEFSDSSAPGMASSLVYRPVPRT  154



>gb|ADL36765.1| MYB domain class transcription factor [Malus domestica]
Length=317

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 126/151 (83%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS + K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TEKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+ D   H P KRS S GA     L+ N
Sbjct  120  LCSDVHD---HPPHKRSASVGAVSGTGLYFN  147



>ref|XP_008367655.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDT+IRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPEEDDTLIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+ D   H P KRS S GA     L+ N
Sbjct  120  LCSDVHD---HPPHKRSASVGAVSGTGLYFN  147



>ref|XP_010070607.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW59483.1| hypothetical protein EUGRSUZ_H02226 [Eucalyptus grandis]
Length=339

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 128/160 (80%), Gaps = 21/160 (13%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            SRK++DR+KGPWSPEEDE L+ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    SRKEVDRIKGPWSPEEDEALRLLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS---SMSADE  490
            HRAFTPEEDD I+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCS   S  A+E
Sbjct  63   HRAFTPEEDDIIVRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSPPLSPLAEE  122

Query  491  GN----------------DLADRLQHQPLKRSVSAGAAVT  562
            GN                DL+ R   +P KRS SAG  ++
Sbjct  123  GNNRAFDAAAAAAAGYDGDLSPR--ERPAKRSASAGPCLS  160



>ref|XP_010417080.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+MDR+KGPWSPEED+LLQ LV+KHGPRNWSLI+KS+PGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQTLVEKHGPRNWSLITKSVPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGQRGG  120

Query  488  EGNDLADRLQHQPLKRSVS  544
                L D    QPLKR+ S
Sbjct  121  YDGSLTD---EQPLKRTAS  136



>ref|XP_010446682.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=319

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 5/147 (3%)
 Frame = +2

Query  137  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  316
            ++RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+V
Sbjct  5    MTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEV  64

Query  317  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS--SMSADE  490
            EHRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS    S D 
Sbjct  65   EHRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDF  124

Query  491  GNDL---ADRLQHQPLKRSVSAGAAVT  562
            G +     +  + QPLKR+ S G   T
Sbjct  125  GGNGGYDGNLGEEQPLKRTASGGGVST  151



>ref|XP_006404809.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
 gb|ESQ46262.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
Length=296

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 123/155 (79%), Gaps = 10/155 (6%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-SA  484
            P+VEHRAF+ EEDDTI+RAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS   ++
Sbjct  61   PEVEHRAFSAEEDDTILRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGWTS  120

Query  485  DEGNDL---------ADRLQHQPLKRSVSAGAAVT  562
            DEG             +    QPLKR+ S G    
Sbjct  121  DEGQSCDFGGNGGYDGNLTDEQPLKRTASGGGGAV  155



>ref|XP_009360105.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=315

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 126/151 (83%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEELQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+     H P KRS S GA     L+ N
Sbjct  120  LSSDVH---AHPPHKRSASVGAVSGTGLYFN  147



>ref|XP_002510155.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF52342.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=295

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 121/143 (85%), Gaps = 10/143 (7%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
            S +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+
Sbjct  6    STARKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPE  65

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VEHR FTPEED+TI+RAH+RFGNKWATIARLL GRTDNAIKNHWNSTLKRKC        
Sbjct  66   VEHRPFTPEEDETIMRAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCY-------  118

Query  494  NDLADRLQH--QPLKRSVSAGAA  556
             DL D + H  QPLKRS S GA 
Sbjct  119  -DLNDDVAHNPQPLKRSASLGAG  140



>ref|XP_010548433.1| PREDICTED: transcription factor MYB44 isoform X2 [Tarenaya hassleriana]
 ref|XP_010548434.1| PREDICTED: transcription factor MYB44 isoform X3 [Tarenaya hassleriana]
Length=328

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 10/147 (7%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SR++M+R+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS--  481
            P+VEHRAFT EED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC +M   
Sbjct  61   PEVEHRAFTSEEDETIIRAHARFGNKWATIARLLTGRTDNAIKNHWNSTLKRKCVAMVPG  120

Query  482  --------ADEGNDLADRLQHQPLKRS  538
                    A  G    D    QPLKR+
Sbjct  121  GEGQNCDFATNGGYDCDLTAEQPLKRT  147



>ref|XP_010548432.1| PREDICTED: transcription factor MYB44 isoform X1 [Tarenaya hassleriana]
Length=328

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 10/147 (7%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SR++M+R+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS--  481
            P+VEHRAFT EED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC +M   
Sbjct  61   PEVEHRAFTSEEDETIIRAHARFGNKWATIARLLTGRTDNAIKNHWNSTLKRKCVAMVPG  120

Query  482  --------ADEGNDLADRLQHQPLKRS  538
                    A  G    D    QPLKR+
Sbjct  121  GEGQNCDFATNGGYDCDLTAEQPLKRT  147



>ref|XP_006286095.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
 gb|EOA18993.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
Length=319

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS--SMSADEG  493
            HRAF+ EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCS    S D G
Sbjct  66   HRAFSQEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFG  125

Query  494  NDL---ADRLQHQPLKRSVSAGAAVT  562
             +     +  + QPLKR+ S G   T
Sbjct  126  GNGGYDGNLGEEQPLKRTASGGGVST  151



>ref|XP_008220277.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=312

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 7/152 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K  DR+KGPWSPEEDE LQ+LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+P+EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPDEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT---LHLN  574
               D+     H   KRS S GA      L+LN
Sbjct  120  LTPDVHSHPAH---KRSASVGAVTAVSGLYLN  148



>ref|XP_002880492.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56751.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 121/155 (78%), Gaps = 12/155 (8%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MA  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAGSTRKEMDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-----  472
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGG  120

Query  473  ----SMSADEGNDL---ADRLQHQPLKRSVSAGAA  556
                  S D G +     +    +PLKR+ S G  
Sbjct  121  GGEEGQSCDFGGNGGYDGNLTDEKPLKRTASGGGG  155



>ref|XP_010101670.1| Transcription factor [Morus notabilis]
 gb|EXB89236.1| Transcription factor [Morus notabilis]
Length=303

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 120/139 (86%), Gaps = 3/139 (2%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK++DR+KGPWSPEEDE L++LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  4    TRKNLDRIKGPWSPEEDEALRRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  63

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HR F+PEEDDTIIRAHA +GNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+S D   +
Sbjct  64   HRPFSPEEDDTIIRAHATYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSEDFNGE  123

Query  500  LADRLQHQPLKRSVSAGAA  556
              D     PLKRS S GA 
Sbjct  124  PND---CPPLKRSASLGAG  139



>dbj|BAJ40867.1| transcriptional factor MYB-1 [Coptis japonica]
Length=312

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 121/145 (83%), Gaps = 8/145 (6%)
 Frame = +2

Query  128  MASIS--RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  301
            MASIS  R+D+DR+KGPWSPEED+LL +LV KHGPRNWSLISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MASISSSRRDLDRIKGPWSPEEDDLLTKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  60

Query  302  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS  481
            LSPQVEHRAF+ EEDDTIIRAHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRK S   
Sbjct  61   LSPQVEHRAFSSEEDDTIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKAS---  117

Query  482  ADEGNDLADRLQHQPLKRSVSAGAA  556
               G D+      +P KRS S GA 
Sbjct  118  ---GEDIFIDGLTRPFKRSASVGAV  139



>ref|XP_007227715.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
 gb|EMJ28914.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
Length=312

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 7/152 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K  DR+KGPWSPEEDE LQ+LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKLADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+P+EDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSSMS D
Sbjct  60   PEVEHRPFSPDEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGAAVT---LHLN  574
               D+     H   KRS S GA      L+LN
Sbjct  120  LTPDVHSHPAH---KRSASVGAVTAVSGLYLN  148



>gb|AAG08960.1|AF122052_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=306

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = +2

Query  158  RVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  337
            R+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+P RSGKSCRLRWCNQLSPQVEHRAFTP
Sbjct  1    RIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPRRSGKSCRLRWCNQLSPQVEHRAFTP  60

Query  338  EEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRLQ  517
            EEDDTIIRAHA++GNKWATIARLL+GRTDNAIKNHWNSTLKRKC SMS     DL+    
Sbjct  61   EEDDTIIRAHAKYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMS----EDLSFETP  116

Query  518  HQPLKRSVSAGAAVTL  565
              PLKRS S G     
Sbjct  117  QPPLKRSSSVGPCTNF  132



>emb|CDX72621.1| BnaC07g46430D [Brassica napus]
Length=265

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+M+R+KGPWSPEED+LLQ+LV+KHGP+NWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPTRKNMERIKGPWSPEEDDLLQKLVEKHGPKNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEED+ I+RAHAR+GNKWAT++RLL+GRTDNA+KNHWNSTLKRKC+     
Sbjct  61   PEVEHRGFSPEEDEMIVRAHARYGNKWATVSRLLSGRTDNAVKNHWNSTLKRKCTP----  116

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
            EG+D  +  + QP KR+ S G    L+++
Sbjct  117  EGHD-GNLGEEQPSKRAASGGVCTGLYMS  144



>ref|XP_007160886.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
 gb|ESW32880.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
Length=276

 Score =   226 bits (576),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 121/143 (85%), Gaps = 8/143 (6%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS SR DMDRVKGPWSPEEDE LQ+LVQ  GPRNW++ISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASGSR-DMDRVKGPWSPEEDEALQRLVQALGPRNWTVISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDD I+RAH RFGNKWATIARLL GRTDNA+KNHWNSTLKRKCS++S  
Sbjct  60   PEVEHRPFSPEEDDAIVRAHGRFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSAVSL-  118

Query  488  EGNDLADRLQHQPLKRSVSAGAA  556
               D+ DR    PLKRS S GA 
Sbjct  119  ---DVTDR---PPLKRSASVGAG  135



>ref|XP_009398678.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 5/144 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KD+DR+KGPWSPEEDE LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  11   KDVDRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  70

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK-CSSMSADEG---  493
             FTPEED+TIIRAH RFGNKWATIARLL+GRTDNA+KNHWNSTLKR+ C+S SA +G   
Sbjct  71   PFTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAVKNHWNSTLKRRYCASSSAGDGGFR  130

Query  494  -NDLADRLQHQPLKRSVSAGAAVT  562
             +   D +  +PLKR+ S G A++
Sbjct  131  HHPDDDVVAARPLKRTSSDGPAIS  154



>gb|KJB58575.1| hypothetical protein B456_009G215900 [Gossypium raimondii]
Length=293

 Score =   226 bits (577),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 5/140 (4%)
 Frame = +2

Query  137  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  316
            I  KD+DR+KGPWSP EDE LQ+LV  +GP+NWSLISKSIPGRSGKSCRLRWCNQLSP+V
Sbjct  22   IYVKDLDRIKGPWSPGEDEALQRLVHTYGPKNWSLISKSIPGRSGKSCRLRWCNQLSPEV  81

Query  317  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN  496
            +HR FTPEEDDTII+AHA+FGNKWA IARLL GRTDNAIKNHWNSTLKRKCSSM+ D  +
Sbjct  82   QHRPFTPEEDDTIIQAHAQFGNKWAIIARLLNGRTDNAIKNHWNSTLKRKCSSMTQDFND  141

Query  497  DLADRLQHQPLKRSVSAGAA  556
            D       QP+KRS S GAA
Sbjct  142  D-----SPQPIKRSASLGAA  156



>gb|KJB59854.1| hypothetical protein B456_009G276400 [Gossypium raimondii]
Length=284

 Score =   226 bits (576),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 115/135 (85%), Gaps = 5/135 (4%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RKD+DR+KGPWSPEEDE L++LVQ +G RNWSL+SKSIPGRSGKSCRLRWCNQLSP VE
Sbjct  4    TRKDIDRIKGPWSPEEDEALKRLVQTYGSRNWSLVSKSIPGRSGKSCRLRWCNQLSPDVE  63

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HR FTPEEDDTI RAH RFGNKWATIAR L GRTDNAIKNHWNSTLKRKCSSM+ D  +D
Sbjct  64   HRPFTPEEDDTIARAHTRFGNKWATIARFLNGRTDNAIKNHWNSTLKRKCSSMTDDMNDD  123

Query  500  LADRLQHQPLKRSVS  544
                   QPLK+S S
Sbjct  124  -----SPQPLKKSAS  133



>gb|ADN33728.1| MYB transcription factor [Cucumis melo subsp. melo]
Length=211

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EEDD IIRAHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRKCS+M    G+D  
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM----GDDFN  121

Query  506  DRLQHQPLKRSVSAGAA  556
            D   H P KRS S G +
Sbjct  122  DPDLHHPPKRSASVGPS  138



>gb|ABV02031.1| sucrose responsive element binding factor 1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=282

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 5/143 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K+  R+KGPW+PEEDELLQ+LV++HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  5    KETGRIKGPWNPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  64

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED+TI++AHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKC S S    +DL+
Sbjct  65   PFTAEEDETILKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSTS----DDLS  120

Query  506  DRLQHQPLKRSVSAGAAVTLHLN  574
                 QPLKRS S G   T+ +N
Sbjct  121  FETPQQPLKRSSSIGPG-TMSMN  142



>ref|XP_010429274.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=306

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+MDR+KGPWSPEED+LLQ LV+KHGPRNWSLISKSIPGR GKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRPGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGEEG  120

Query  488  EGNDLADRL-QHQPLKRSVS  544
            +       L   QPLKR+ S
Sbjct  121  QSGGYDGSLTDEQPLKRTAS  140



>ref|XP_008462845.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=301

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 118/135 (87%), Gaps = 3/135 (2%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K +DR+KGPWSPEED+ LQ+LV K+GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  3    KQIDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
            AFTPEED+TII A A +GNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSM+ + G   A
Sbjct  63   AFTPEEDETIINAQALYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMADESGGCDA  122

Query  506  DRLQHQPLKRSVSAG  550
                  PLKRS+SAG
Sbjct  123  ---TSPPLKRSLSAG  134



>gb|KEH31491.1| myb transcription factor [Medicago truncatula]
Length=271

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            +PEED+ IIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS    +  D    
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRD----  116

Query  512  LQHQPLKRSVSAGA  553
               QPLKRS S GA
Sbjct  117  FNPQPLKRSASVGA  130



>gb|ABR28330.1| MYB transcription factor MYB8 [Medicago truncatula]
Length=269

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            +PEED+ IIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS    +  D    
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRD----  116

Query  512  LQHQPLKRSVSAGA  553
               QPLKRS S GA
Sbjct  117  FNPQPLKRSASVGA  130



>gb|AGL76985.1| MYB transcription factor [Cucumis melo]
Length=294

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EEDD IIRAHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRKCS+M    G+D  
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM----GDDFN  121

Query  506  DRLQHQPLKRSVSAGAA  556
            D   H P KRS S G +
Sbjct  122  DPDLHHPPKRSASVGPS  138



>ref|XP_008444592.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=296

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EEDD IIRAHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRKCS+M    G+D  
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM----GDDFN  121

Query  506  DRLQHQPLKRSVSAGAA  556
            D   H P KRS S G +
Sbjct  122  DPDLHHPPKRSASVGPS  138



>ref|XP_010943207.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=370

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA-----DE  490
             FTPEEDDTIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS +      D 
Sbjct  70   PFTPEEDDTIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSAAVAPAIDDA  129

Query  491  GNDLADRLQHQPLKRSVSAGAAVT  562
                AD    +PLKRS S G  ++
Sbjct  130  ALVAADDAAARPLKRSSSVGPVLS  153



>ref|XP_009587267.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=269

 Score =   223 bits (569),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (84%), Gaps = 5/143 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K+  R+KGPWSPEEDELLQ+LV++HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  5    KETGRIKGPWSPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  64

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED+TI++AHA+ GNKWATIAR L+GRTDNAIKNHWNSTLKRKC S S    +DL+
Sbjct  65   PFTAEEDETILKAHAKLGNKWATIARFLSGRTDNAIKNHWNSTLKRKCPSTS----DDLS  120

Query  506  DRLQHQPLKRSVSAGAAVTLHLN  574
                 QPLKRS S G   T+ +N
Sbjct  121  FETPQQPLKRSSSIGPG-TISMN  142



>gb|AAM65553.1| putative MYB family transcription factor [Arabidopsis thaliana]
Length=309

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 120/150 (80%), Gaps = 11/150 (7%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-----  472
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGG  120

Query  473  ---SMSADEGNDL---ADRLQHQPLKRSVS  544
                 S D G +     +    +PLKR+ S
Sbjct  121  GEEGQSCDFGGNGGYDGNLTDEKPLKRTAS  150



>ref|XP_009138487.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
 emb|CDY29542.1| BnaA03g53870D [Brassica napus]
Length=265

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 126/149 (85%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  SRK+M+R+KGPWSPEED+LLQ++V++HGPRNWSLISKSIP RSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQKVVEEHGPRNWSLISKSIPARSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+ EED+TI+RAHAR+GNKWATI+RLL+GRTDNA+KNHWNSTLKRKC+     
Sbjct  61   PEVEHRGFSAEEDETIVRAHARYGNKWATISRLLSGRTDNAVKNHWNSTLKRKCTP----  116

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
            EG D  +  + QP KR+ S G    L+++
Sbjct  117  EGYD-GNLGEGQPSKRAASGGVCTGLYIS  144



>gb|EYU34554.1| hypothetical protein MIMGU_mgv1a011398mg [Erythranthe guttata]
Length=283

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            +MDR+KGPWSPEED+LLQ LVQ+HGPRNW+LIS+SIPGRSGKSCRLRWCNQL P VEHR 
Sbjct  4    NMDRIKGPWSPEEDDLLQSLVQRHGPRNWTLISRSIPGRSGKSCRLRWCNQLCPHVEHRP  63

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLAD  508
            FTPEEDD IIRAH+RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK +S+S         
Sbjct  64   FTPEEDDAIIRAHSRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKSASLSFSSDGGGGG  123

Query  509  RLQHQPLKRSVSAGAAVTL  565
                +PLKRSVSAG+ + +
Sbjct  124  VGSERPLKRSVSAGSGLPV  142



>ref|XP_004142878.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156374.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN62477.1| hypothetical protein Csa_2G355030 [Cucumis sativus]
Length=290

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             F+ EEDD IIRAHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRKCS+M    G+D  
Sbjct  66   PFSAEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM----GDDFN  121

Query  506  DRLQHQPLKRSVSAGAA  556
            D   H P KRS S G +
Sbjct  122  DPDLHHPPKRSASLGPS  138



>gb|AHB59591.1| putative R2R3 MYB protein 3 [Arachis hypogaea]
Length=253

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDRVKGPWSPEEDE L++LV  HGPRNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRAF
Sbjct  1    MDRVKGPWSPEEDETLRRLVGAHGPRNWTIISKSIPGRSGKSCRLRWCNQLSPEVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEEDD I+RAHA FGNKWATIARLL GRTDNA+KNHWNSTLKRKC S SA +   +A  
Sbjct  61   TPEEDDIIVRAHAEFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCRS-SASDAVTVAVY  119

Query  512  LQHQPLKRSVSAG  550
               QPLKRS S G
Sbjct  120  PDAQPLKRSASVG  132



>ref|NP_179910.1| myb domain protein 70 [Arabidopsis thaliana]
 gb|AAB87103.1| MYB family transcription factor [Arabidopsis thaliana]
 dbj|BAC41938.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAP37702.1| At2g23280 [Arabidopsis thaliana]
 gb|AAS10044.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEC07437.1| myb domain protein 70 [Arabidopsis thaliana]
Length=309

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 119/150 (79%), Gaps = 11/150 (7%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-----  472
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGG  120

Query  473  ---SMSADEGNDL---ADRLQHQPLKRSVS  544
                 S D G +     +    +PLKR  S
Sbjct  121  GEEGQSCDFGGNGGYDGNLTDEKPLKRRAS  150



>ref|XP_010472329.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+M+R+KGPWSPEED+LLQ LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMNRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGG  120

Query  488  EGNDL----ADRLQHQPLKRSVS  544
            EG             QPLKR+ S
Sbjct  121  EGGQSGGYDGSLTDEQPLKRTAS  143



>gb|AFK48638.1| unknown [Medicago truncatula]
Length=253

 Score =   221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGP SPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPRSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            +PEED+ IIRAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS    +  D    
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRD----  116

Query  512  LQHQPLKRSVSAGA  553
               QPLKRS S GA
Sbjct  117  FNPQPLKRSASVGA  130



>gb|KFK30351.1| hypothetical protein AALP_AA7G250300 [Arabis alpina]
Length=309

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 8/147 (5%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+ ++RK+M+R+KGPWSPEED+LLQ LV KHGPRNWSLISKSI GRSGKSCRLRWCNQLS
Sbjct  1    MSGLNRKNMERIKGPWSPEEDDLLQSLVSKHGPRNWSLISKSISGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAF+ EED+TIIRAHARFGNKWATI+RLL GRTDNAIKNHWNSTLKRKCSS  + 
Sbjct  61   PEVEHRAFSTEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSSNGSQ  120

Query  488  --------EGNDLADRLQHQPLKRSVS  544
                     G    +    QPLKR+ S
Sbjct  121  GQSCDFICNGGYDGNLGDEQPLKRTAS  147



>ref|XP_004151866.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156766.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN63306.1| hypothetical protein Csa_2G427310 [Cucumis sativus]
Length=301

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 114/135 (84%), Gaps = 3/135 (2%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K  DR+KGPWSPEED+ LQ+LV K+GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  3    KQTDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
            AFTP+ED+ II A A +GNKWATIARLL+GRTDNAIKNHWNSTLKRKCSSM  D G   A
Sbjct  63   AFTPDEDEAIINAQALYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMPDDTGGCHA  122

Query  506  DRLQHQPLKRSVSAG  550
                  P K+SVSAG
Sbjct  123  ---TSPPFKKSVSAG  134



>ref|XP_010928389.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=372

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 123/161 (76%), Gaps = 18/161 (11%)
 Frame = +2

Query  131  ASISR--KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            ASIS   KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  3    ASISNRGKDMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  62

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHR FT EED+TIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS + 
Sbjct  63   SPQVEHRPFTAEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSATV  122

Query  485  DEGNDLADRLQHQ---------------PLKRSVSAGAAVT  562
                D    L HQ               PLKRS S G  ++
Sbjct  123  APAVDDVG-LPHQQYDAALVAADDAAVRPLKRSSSVGPILS  162



>gb|AFS65096.1| sucrose responsive element-binding protein [Elaeis guineensis]
Length=372

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 123/161 (76%), Gaps = 18/161 (11%)
 Frame = +2

Query  131  ASISR--KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  304
            ASIS   KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  3    ASISNRGKDMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  62

Query  305  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            SPQVEHR FT EED+TIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS + 
Sbjct  63   SPQVEHRPFTAEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSATV  122

Query  485  DEGNDLADRLQHQ---------------PLKRSVSAGAAVT  562
                D    L HQ               PLKRS S G  ++
Sbjct  123  APAVDDVG-LPHQQYDAALVAADDAAVRPLKRSSSVGPILS  162



>ref|XP_008799576.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=366

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 118/154 (77%), Gaps = 16/154 (10%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KDMDR+KGPWSPEEDE L +LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDEALHKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FTPEEDDTIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS +     D  
Sbjct  70   PFTPEEDDTIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSATVAPAVDDV  129

Query  506  DRLQHQ---------------PLKRSVSAGAAVT  562
              L HQ               PLKRS S G  ++
Sbjct  130  G-LPHQQYDAALAAADDAAARPLKRSSSVGPVLS  162



>ref|XP_006294656.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
 gb|EOA27554.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
Length=308

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKETDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS  472
            HR FT EEDD IIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS
Sbjct  66   HRGFTAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  116



>ref|NP_001287808.1| transcription factor MYB44-like [Malus domestica]
 gb|ADL36769.1| MYB domain class transcription factor [Malus domestica]
Length=319

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK SSMS D
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+     H P KRS S GA     L+ N
Sbjct  120  LSSDVQ---AHPPHKRSASVGAVPVTGLYFN  147



>ref|XP_009354151.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=319

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK SSMS D
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSMSED  119

Query  488  EGNDLADRLQHQPLKRSVSAGA--AVTLHLN  574
              +D+     H P KRS S GA     L+ N
Sbjct  120  LSSDVQ---AHPPHKRSASVGAVPVTGLYFN  147



>gb|EYU36318.1| hypothetical protein MIMGU_mgv1a022221mg, partial [Erythranthe 
guttata]
Length=288

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSP+ED+LLQ+LV+KHGPRNWSLISKSI GRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPDEDDLLQRLVEKHGPRNWSLISKSILGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            P+EDD II AH ++GNKWATIAR L+GRTDNAIKNHWNSTLKRKC SMS +  +      
Sbjct  63   PQEDDAIIEAHFKYGNKWATIARFLSGRTDNAIKNHWNSTLKRKCLSMSEEYFSSFDPEA  122

Query  515  QHQ--PLKRSVSAG  550
            Q Q  PLKRS S G
Sbjct  123  QQQQPPLKRSASVG  136



>emb|CDY38933.1| BnaA04g13540D [Brassica napus]
Length=292

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 115/145 (79%), Gaps = 6/145 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-----  472
            P+VEHRAF+PEED+ I+ AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRAFSPEEDEMILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGW  120

Query  473  -SMSADEGNDLADRLQHQPLKRSVS  544
             S     G         QPLKR+ S
Sbjct  121  TSDDGGNGGYDGSLTDEQPLKRTAS  145



>ref|XP_006844027.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
 gb|ERN05702.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
Length=303

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 2/128 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE L++LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEQLRKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            T EED+TI+RAHA+FGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS S+ +  +  ++
Sbjct  61   TAEEDETIVRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSSSSSQ--EPNEQ  118

Query  512  LQHQPLKR  535
              H P KR
Sbjct  119  EPHHPAKR  126



>ref|NP_001062562.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAF24476.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAG89840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 11/144 (8%)
 Frame = +2

Query  128  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  298
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  2    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  61

Query  299  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  S 
Sbjct  62   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHS-  120

Query  479  SADEGNDLADRLQHQPLKRSVSAG  550
                 + LAD L  +PLKR+ S G
Sbjct  121  -----SLLADDL--RPLKRTTSDG  137



>dbj|BAD34048.1| myb-related transcription factor-like [Oryza sativa Japonica 
Group]
 gb|EAZ43731.1| hypothetical protein OsJ_28356 [Oryza sativa Japonica Group]
Length=318

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 11/144 (8%)
 Frame = +2

Query  128  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  298
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  1    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  60

Query  299  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  S 
Sbjct  61   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHS-  119

Query  479  SADEGNDLADRLQHQPLKRSVSAG  550
                 + LAD L  +PLKR+ S G
Sbjct  120  -----SLLADDL--RPLKRTTSDG  136



>gb|EAZ08096.1| hypothetical protein OsI_30362 [Oryza sativa Indica Group]
Length=318

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 11/144 (8%)
 Frame = +2

Query  128  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  298
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  1    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  60

Query  299  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  S 
Sbjct  61   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHS-  119

Query  479  SADEGNDLADRLQHQPLKRSVSAG  550
                 + LAD L  +PLKR+ S G
Sbjct  120  -----SLLADDL--RPLKRTTSDG  136



>emb|CDX89554.1| BnaC04g35730D [Brassica napus]
Length=293

 Score =   216 bits (550),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC  469
            P+VEHRAF+PEED+TI+ AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKC
Sbjct  61   PEVEHRAFSPEEDETILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKC  114



>ref|XP_008811216.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=372

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 117/144 (81%), Gaps = 5/144 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KDMDR+KGPWSPEEDE LQ+LVQKHG RNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDESLQKLVQKHGARNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS-----MSADE  490
             FTPEEDD IIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS        D 
Sbjct  70   PFTPEEDDAIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSAAVAPAVDDA  129

Query  491  GNDLADRLQHQPLKRSVSAGAAVT  562
                AD    +PLKRS S G  ++
Sbjct  130  AMVAADDAAARPLKRSSSVGPVLS  153



>ref|XP_009140453.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=292

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 114/145 (79%), Gaps = 6/145 (4%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            M   +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MPGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-----  472
            P+VEHRAF+PEED+ I+ AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCS     
Sbjct  61   PEVEHRAFSPEEDEMILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGW  120

Query  473  -SMSADEGNDLADRLQHQPLKRSVS  544
             S     G         QPLKR+ S
Sbjct  121  TSDDGGNGGYDGSLTDEQPLKRTAS  145



>ref|XP_007042527.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX98358.1| Myb domain protein 73, putative [Theobroma cacao]
Length=245

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D DRVKGPWSPEEDELL++LV + GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    QDFDRVKGPWSPEEDELLRKLVLRLGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            AFTPEED+TI+RAHAR+GNKWATIARLL GRTDNA+KNHWNSTLKRK S    D
Sbjct  63   AFTPEEDETIVRAHARYGNKWATIARLLNGRTDNAVKNHWNSTLKRKLSMEDGD  116



>ref|XP_009418521.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=339

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 11/146 (8%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K MDR+KGPWS EEDE L++LV++HGPRNW+LIS+SIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  14   KGMDRIKGPWSIEEDEALRRLVERHGPRNWTLISRSIPGRSGKSCRLRWCNQLSPQVEHR  73

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN---  496
             FTPEED+TIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRKCSS +A       
Sbjct  74   PFTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSPTAFAAAADG  133

Query  497  --------DLADRLQHQPLKRSVSAG  550
                    D  + +  +PLKR+ S G
Sbjct  134  AGGSALALDRDEEIAARPLKRASSVG  159



>ref|XP_009392116.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 7/145 (5%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            D+DR+KGPWSPEED+ LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR 
Sbjct  16   DVDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  75

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS----SMSADEGN  496
            FTPEED+TIIRAH RFGNKWATIARLL+GRTDNA+KNHWNSTLKR+ S    +++ D G 
Sbjct  76   FTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAVKNHWNSTLKRRYSASATAVAVDGGF  135

Query  497  DLADRLQHQP---LKRSVSAGAAVT  562
              A  L+  P   LK++ S G  ++
Sbjct  136  VAAAELEPVPERRLKKTCSDGPLLS  160



>ref|XP_006279745.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
 gb|EOA12643.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
Length=300

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 6/133 (5%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC     D   D     
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCDHRGFDGSED-----  117

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  118  -HRPVKRSVSAGS  129



>ref|NP_001237693.1| MYB transcription factor MYB70 [Glycine max]
 gb|ABH02833.1| MYB transcription factor MYB70 [Glycine max]
Length=268

 Score =   213 bits (541),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 120/143 (84%), Gaps = 12/143 (8%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDRVKGPWSPEEDE L++LVQ HGPRNWS+ISKS+PGRSGKSCRLRWCNQLSPQV HR F
Sbjct  1    MDRVKGPWSPEEDEALRRLVQAHGPRNWSVISKSVPGRSGKSCRLRWCNQLSPQVAHRPF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLL-AGRTDNAIKNHWNSTLKR-KCSSMSADEGNDLA  505
            +P+ED+ I+RAHARFGNKWATIARLL  GRTDNA+KNHWNSTLKR KCS++S    +D+ 
Sbjct  61   SPDEDEAIVRAHARFGNKWATIARLLNNGRTDNAVKNHWNSTLKRKKCSAVS----DDVT  116

Query  506  DRLQHQPLKRSVSAGAAVTLHLN  574
            DR    PLKRS S G A   HLN
Sbjct  117  DR---PPLKRSASVGPA---HLN  133



>ref|XP_006660414.1| PREDICTED: transcription factor MYB44-like [Oryza brachyantha]
Length=312

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  12   RDVDRIKGPWSPEEDEALQRLVARHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  71

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FTP+EDDTI+RAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  +       D  
Sbjct  72   PFTPDEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKYHAHHHHHAADDD  131

Query  506  DRLQHQPLKRSVSAG  550
            DR    PLKR+ S G
Sbjct  132  DR----PLKRTSSDG  142



>ref|XP_007136715.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
 gb|ESW08709.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
Length=262

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            S KDMDR+KGPWSPEEDE L++ VQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  3    SAKDMDRIKGPWSPEEDEALRRFVQIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  62

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            HR FT +ED+TI++AHARFGNKWATIAR L GRTDNAIKNHWNSTLKRKCS   +D
Sbjct  63   HRPFTAKEDETIVKAHARFGNKWATIARFLNGRTDNAIKNHWNSTLKRKCSEPPSD  118



>ref|XP_007199299.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
 gb|EMJ00498.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
Length=292

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            S++++DRVKGPWSP+EDE L+QLVQ HG RNWSLISKS+PGRSGKSCRLRWCNQLSP+VE
Sbjct  4    SQRELDRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCNQLSPEVE  63

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGND  499
            HRAFTPEED+ I  AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK S++S ++   
Sbjct  64   HRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSAISGNDDGP  123

Query  500  LADRLQHQPLKRSVSAGAAVT  562
              D    +P K++ +A  + +
Sbjct  124  TIDDNHFRPEKKTATAAVSFS  144



>emb|CAA90809.1| MYB-related protein [Arabidopsis thaliana]
Length=305

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYD-HRGYDGSE--  119

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  120  DHRPVKRSVSAGS  132



>ref|XP_010444669.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=310

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC         D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSE--  120

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  121  DHRPVKRSVSAGS  133



>ref|NP_201531.1| transcription factor MYB44 [Arabidopsis thaliana]
 sp|Q9FDW1.1|MYB44_ARATH RecName: Full=Transcription factor MYB44; AltName: Full=Myb-related 
protein 44; Short=AtMYB44; AltName: Full=Myb-related 
protein R1; Short=AtMYBR1 [Arabidopsis thaliana]
 gb|AAG41459.1|AF326877_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAK00380.1|AF339698_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 dbj|BAB09015.1| myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAS10118.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED98326.1| transcription factor MYB44 [Arabidopsis thaliana]
 dbj|BAP16463.1| myb-related protein, 33.3K [Cloning vector pTACAtg1]
Length=305

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYD-HRGYDGSE--  119

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  120  DHRPVKRSVSAGS  132



>gb|AAM64847.1| myb-related protein, 33.3K [Arabidopsis thaliana]
Length=305

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYD-HRGYDGSE--  119

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  120  DHRPVKRSVSAGS  132



>gb|AAK96490.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
 gb|AAL31250.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
Length=305

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYD-HRGYDGSE--  119

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  120  DHRPVKRSVSAGS  132



>ref|XP_004305954.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=270

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +2

Query  122  LEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  301
            ++  S+ ++++DRVKGPWSPEED+LL++LVQ+HG RNW+LISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MDCESVQQRELDRVKGPWSPEEDDLLRKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQ  60

Query  302  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS  481
            LSP+VEHRAFT EED+ I  AH+++GNKWATIARLL GRTDNAIKNHWNSTLKRK SSM+
Sbjct  61   LSPEVEHRAFTAEEDEIIAAAHSKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSSMA  120

Query  482  ADEGNDLADRLQH---QPLKRSVSAGAA  556
             D G    +  Q+   +P K+S +A  +
Sbjct  121  EDGGGGGVEENQYHILRPEKKSATASVS  148



>ref|XP_009418325.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=365

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KD+ R+KGPWSPEEDE L++LVQ++GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  9    KDLGRIKGPWSPEEDEALRKLVQRNGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  68

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-SMSADEGNDL  502
             FTPEED+TIIRAH RFGN+WATIARLL+GRTDNA+KNHWNSTLKR+ S S +A +G  +
Sbjct  69   PFTPEEDETIIRAHRRFGNRWATIARLLSGRTDNAVKNHWNSTLKRRYSASATAVDGGFV  128

Query  503  --ADR--LQHQPLKRSVSAGAAVT  562
              ADR  +  +PL R+ S G  ++
Sbjct  129  VAADREVVSARPLLRTSSDGLVLS  152



>ref|XP_008373085.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=302

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  119  VLEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  298
             +E +++ ++++DRVKGPWSP+EDE L+Q+VQ++G RNWS+ISKS+PGRSGKSCRLRWCN
Sbjct  8    AMESSAMVQRELDRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCN  67

Query  299  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
            QLSP+VEHRAFTPEED+ I  AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK S++
Sbjct  68   QLSPEVEHRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSAL  127

Query  479  SADEGNDLADRLQHQPLKRSVSAGAAVT  562
            S +E     D    +P K++ +A  + +
Sbjct  128  SPNEDGATIDEGILRPEKKAATAAVSFS  155



>ref|XP_002866710.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42969.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYD-HRGFDGSE--  119

Query  515  QHQPLKRSVSAGA  553
             H+P+KRSVSAG+
Sbjct  120  DHRPVKRSVSAGS  132



>emb|CCU64171.1| ScMYB19 protein [Saccharum hybrid cultivar Co 86032]
Length=215

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEHR 
Sbjct  17   DVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRP  76

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  466
            FTPEEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRK
Sbjct  77   FTPEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRK  122



>ref|NP_001237709.1| MYB transcription factor MYB81 [Glycine max]
 gb|ABH02837.1| MYB transcription factor MYB81 [Glycine max]
Length=273

 Score =   211 bits (536),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 116/144 (81%), Gaps = 10/144 (7%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            ++MDRVKGPWSPEEDE L+ LVQ HGPRNWS+ISKSIPGR  KSCRLRWCNQLSPQV HR
Sbjct  9    REMDRVKGPWSPEEDEALRALVQAHGPRNWSVISKSIPGRFRKSCRLRWCNQLSPQVAHR  68

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             F+ EED+ II AHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRK S++S D      
Sbjct  69   PFSQEEDEAIIMAHAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKSSAVSDD------  122

Query  506  DRLQH-QPLKRSVSAGAAVTLHLN  574
            D + H QPLKRS S G A   HLN
Sbjct  123  DVVTHRQPLKRSNSVGPA---HLN  143



>ref|XP_009385523.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
            +S S KD+DR+KGPWSP+ED  LQ+LVQ+HGPRNWS ISKSIPGRSGKSCRLRWCNQLSP
Sbjct  15   SSSSSKDVDRIKGPWSPDEDAALQRLVQRHGPRNWSPISKSIPGRSGKSCRLRWCNQLSP  74

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHR FT EED+ IIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRKC+ +  D 
Sbjct  75   QVEHRPFTAEEDEIIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCTPLFGDG  134

Query  491  G  493
            G
Sbjct  135  G  135



>dbj|BAJ86460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 119/142 (84%), Gaps = 8/142 (6%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KD+DR+KGPWSPEED+ LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  13   KDVDRIKGPWSPEEDDALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  72

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE-----  490
             FTP+EDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRK SS S+       
Sbjct  73   PFTPDEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSSSSASASASA  132

Query  491  --GNDLADRLQHQPLKRSVSAG  550
              G+D  D    +PLKR+ S G
Sbjct  133  SPGDDAVDD-DRRPLKRTSSDG  153



>ref|XP_008236375.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=302

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  119  VLEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  298
             ++ ++ +++++DRVKGPWSP+EDE L+QLVQ HG RNWSLISKS+PGRSGKSCRLRWCN
Sbjct  7    AMDSSAQAQRELDRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCN  66

Query  299  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
            QLSP+VEHRAFTPEED+ I  AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK S++
Sbjct  67   QLSPEVEHRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSAI  126

Query  479  SADEGNDLADRLQHQPLKRSVSAGAAVT  562
            S ++     D    +P K++ +A  + +
Sbjct  127  SGNDDGATIDDNHVRPEKKTATAAVSFS  154



>ref|XP_004163238.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like 
[Cucumis sativus]
Length=262

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 119/147 (81%), Gaps = 13/147 (9%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MA+I+    DR+KGPWSP+EDELL++LV  +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATIT----DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  56

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT +EDDTII+AH+RFGNKWATIARLL GRTDNAIKNHWNSTLKRK SS + +
Sbjct  57   PEVEHRPFTSDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSSAPE  116

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLH  568
            +           PLKRS SA A +  +
Sbjct  117  DD---------HPLKRSTSASAPLCFN  134



>ref|XP_004141275.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN55237.1| hypothetical protein Csa_4G641690 [Cucumis sativus]
Length=263

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 120/149 (81%), Gaps = 14/149 (9%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MA+I+    DR+KGPWSP+EDELL++LV  +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATIT----DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  56

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHR FT +EDDTII+AH+RFGNKWATIARLL GRTDNAIKNHWNSTLKRK SS + +
Sbjct  57   PEVEHRPFTSDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSSAPE  116

Query  488  EGNDLADRLQHQPLKRSVSAGAAVTLHLN  574
            +           PLKRS SA A   L+ N
Sbjct  117  DD---------HPLKRSTSASAP-PLYFN  135



>ref|XP_008452606.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=269

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 115/140 (82%), Gaps = 10/140 (7%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSP+EDELL++LV  +GPRNWSLISKSI GRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  5    DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSISGRSGKSCRLRWCNQLSPEVEHRPFT  64

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            P+EDDTII+AH+RFGNKWATIARLL GRTDNAIKNHWNSTLKRK SS + ++        
Sbjct  65   PDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSSSAPED--------  116

Query  515  QHQPLKRSVSAGAAVTLHLN  574
               PLKRS S GA   L+ N
Sbjct  117  -DHPLKRSASVGAP-PLYFN  134



>ref|XP_010484518.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR+F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRSFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC         D ++  
Sbjct  63   TEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSE--  120

Query  515  QHQPLKRSVSAGA  553
              +P+KRSVSAG+
Sbjct  121  DQRPVKRSVSAGS  133



>gb|KFK28404.1| hypothetical protein AALP_AA8G510400 [Arabis alpina]
Length=309

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 8/133 (6%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS      G D   R 
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS------GYD--HRE  114

Query  515  QHQPLKRSVSAGA  553
             H+P+KRS S G+
Sbjct  115  DHRPMKRSASDGS  127



>ref|XP_010464243.1| PREDICTED: transcription factor MYB44 [Camelina sativa]
Length=309

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC         D ++  
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSE--  120

Query  515  QHQPLKRSVSAGA  553
              +P+KRSVSAG+
Sbjct  121  DQRPVKRSVSAGS  133



>ref|XP_006393928.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
 gb|ESQ31214.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
Length=301

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 115/143 (80%), Gaps = 9/143 (6%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G D     
Sbjct  63   SEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCG------GYDHRFEE  116

Query  515  QHQPLKRSVSAG---AAVTLHLN  574
             H+P KRSVS G    A  L+++
Sbjct  117  DHRPTKRSVSDGTPPVATGLYMS  139



>ref|XP_009103434.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=296

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 110/132 (83%), Gaps = 7/132 (5%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G   A   
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKC-------GGFYASTE  115

Query  515  QHQPLKRSVSAG  550
              +P+KRSVS G
Sbjct  116  DQRPVKRSVSDG  127



>gb|AAR83899.1| tuber-specific protein [Capsicum annuum]
Length=344

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 114/141 (81%), Gaps = 23/141 (16%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKS                    VEHRAF
Sbjct  1    MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKS--------------------VEHRAF  40

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEED+TIIRAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRKCSS+SADEGN+LAD+
Sbjct  41   TPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSADEGNELADQ  100

Query  512  L---QHQPLKRSVSAGAAVTL  565
            +   Q  PLKRSVSAG+A+ +
Sbjct  101  IFENQQPPLKRSVSAGSAMPV  121



>gb|ADL36760.1| MYB domain class transcription factor [Malus domestica]
Length=289

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            ++++DRVKGPWSP+EDE L+Q+VQ++G RNWS+ISKS+PGRSGKSCRLRWCNQLSP+VEH
Sbjct  3    QRELDRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCNQLSPEVEH  62

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDL  502
            RAFTPEED+ I  AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK S++S +E    
Sbjct  63   RAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSALSPNEDGAT  122

Query  503  ADRLQHQPLKRSVSAGAAVT  562
             D    +P K++ +A  + +
Sbjct  123  IDEGILRPEKKTATAAVSFS  142



>gb|AHN50422.1| R2R3-type MYB transcription factor [Salicornia brachiata]
Length=269

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            ++S   K  DR+KGPWSPEED+LL++LV KHG RNWS ISKSIPGRSGKSCRLRWCNQLS
Sbjct  7    LSSSRLKAADRIKGPWSPEEDDLLKKLVDKHGARNWSEISKSIPGRSGKSCRLRWCNQLS  66

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P+VEHRAF PEED+ I++AHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK S +   
Sbjct  67   PEVEHRAFLPEEDEIIVKAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSEIG--  124

Query  488  EGNDLADRLQHQPLKR  535
             G  ++D   H+P KR
Sbjct  125  -GGGVSDVEFHRPEKR  139



>gb|AHN60125.1| MYB transcription factor 44 [Brassica napus]
Length=300

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 110/132 (83%), Gaps = 7/132 (5%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G   A   
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKC-------GGFYASAE  115

Query  515  QHQPLKRSVSAG  550
              +P+KRSVS G
Sbjct  116  DQRPVKRSVSDG  127



>gb|KDP45901.1| hypothetical protein JCGZ_15461 [Jatropha curcas]
 gb|AIT52203.1| MYB family protein [Jatropha curcas]
Length=267

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            +DRVKGPWSPEED+LLQ+ VQ+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  7    IDRVKGPWSPEEDQLLQKFVQRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  66

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            TPEED+ II AHA+ GNKWATIARLL GRTDNAIKNHWNSTLKRK S+  +++G    DR
Sbjct  67   TPEEDEIIINAHAKQGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSAAMSEDGT--TDR  124

Query  512  LQ  517
            LQ
Sbjct  125  LQ  126



>ref|XP_002462029.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
 gb|EER98550.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
Length=366

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            ++ D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVE
Sbjct  13   NKADVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVE  72

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  466
            HR FTPEEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRK
Sbjct  73   HRPFTPEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRK  121



>gb|EPS70032.1| myb-like protein, partial [Genlisea aurea]
Length=147

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +2

Query  128  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  307
            MA+   +  +R KGPWSPEED LL++LV+K GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  4    MAARKEESSERAKGPWSPEEDGLLRRLVEKQGPRNWSLISKSIPGRSGKSCRLRWCNQLS  63

Query  308  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            P VEHRAFT EED TIIRAH   GNKWA IARLL+GRTDNAIKNHWNSTLKRKC + S  
Sbjct  64   PAVEHRAFTAEEDATIIRAHGELGNKWAAIARLLSGRTDNAIKNHWNSTLKRKCGASSTS  123

Query  488  EGNDLA--DRLQHQPLKRSVSAG  550
              ++    D     P+KR+ S G
Sbjct  124  SSDEFCAFDADAPPPIKRAASFG  146



>ref|NP_001235715.1| MYB transcription factor MYB68 [Glycine max]
 gb|ABH02831.1| MYB transcription factor MYB68 [Glycine max]
Length=259

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 115/154 (75%), Gaps = 14/154 (9%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE L++LVQ +GPRNWS+ISKSIPGRSGKSCRLRWCNQLSP+VE R F
Sbjct  1    MDRIKGPWSPEEDEALRRLVQTYGPRNWSVISKSIPGRSGKSCRLRWCNQLSPEVERRPF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS------------  475
            T EED+ I++AHARFGNKWATIAR L GRTDNAIKNHWNSTLKRKCS             
Sbjct  61   TAEEDEAILKAHARFGNKWATIARFLNGRTDNAIKNHWNSTLKRKCSEPLSEPRPLKRSA  120

Query  476  --MSADEGNDLADRLQHQPLKRSVSAGAAVTLHL  571
                +  G+DL+D      L RSVS   A + HL
Sbjct  121  TVSGSQSGSDLSDSGLPIILARSVSVTVAPSNHL  154



>ref|NP_001151336.1| sucrose responsive element binding protein [Zea mays]
 gb|ACG42418.1| sucrose responsive element binding protein [Zea mays]
 tpg|DAA60650.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=345

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 116/140 (83%), Gaps = 3/140 (2%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
             S  + D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP
Sbjct  10   GSGGKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSP  69

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHR FT EEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRK  + S   
Sbjct  70   QVEHRPFTAEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYYAASDAV  129

Query  491  GNDLADRLQHQPLKRSVSAG  550
               +AD    +PLKR+ S G
Sbjct  130  ---VADADDERPLKRTSSDG  146



>ref|XP_010547530.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=315

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 5/137 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEED+ L++LV K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPEEDDQLRRLVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS---SMSADEGNDLA  505
             EED+TIIRAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRK      +    GN +A
Sbjct  63   TEEDETIIRAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKSVFSRGVGGYNGNFVA  122

Query  506  DRLQHQPLKRSVSAGAA  556
            +     PLKRS SAG+ 
Sbjct  123  E--DGPPLKRSASAGSG  137



>gb|ADX60118.1| MYB-RELATED transcription factor [Zea mays]
Length=347

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 116/140 (83%), Gaps = 3/140 (2%)
 Frame = +2

Query  131  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  310
             S  + D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP
Sbjct  10   GSGGKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSP  69

Query  311  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            QVEHR FT EEDDTI+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKRK  + S   
Sbjct  70   QVEHRPFTAEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYYAASDAV  129

Query  491  GNDLADRLQHQPLKRSVSAG  550
               +AD    +PLKR+ S G
Sbjct  130  ---VADADDERPLKRTSSDG  146



>ref|XP_010558924.1| PREDICTED: transcription factor MYB44-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558931.1| PREDICTED: transcription factor MYB44-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558937.1| PREDICTED: transcription factor MYB44-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010558944.1| PREDICTED: transcription factor MYB44-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010558950.1| PREDICTED: transcription factor MYB44-like isoform X5 [Tarenaya 
hassleriana]
Length=311

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 110/138 (80%), Gaps = 5/138 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEED+ L++LV K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPEEDDQLRRLVVKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEEDDTI+RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRK                
Sbjct  63   PEEDDTILRAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKSGGSDGSSPGGGGYEG  122

Query  515  -----QHQPLKRSVSAGA  553
                 + +PLKRS SAG+
Sbjct  123  SFSASEERPLKRSASAGS  140



>gb|AFH03055.1| R2R3-MYB transcription factor MYB3 [Epimedium sagittatum]
Length=308

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 6/130 (5%)
 Frame = +2

Query  161  VKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPE  340
            +KGPWSPEED+LLQ+LVQ HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT E
Sbjct  22   IKGPWSPEEDDLLQKLVQTHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTAE  81

Query  341  EDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRLQH  520
            ED+TII+AH +FGNKWATIARLL GRTDNAIKNHWNSTLKRKC S    +G++  D+ Q+
Sbjct  82   EDETIIKAHEKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCCS----DGSNPQDQDQN  137

Query  521  -QPLK-RSVS  544
             +P K RSVS
Sbjct  138  PRPFKQRSVS  147



>ref|XP_009394543.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 116/148 (78%), Gaps = 8/148 (5%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR KG WS EEDE L++LV++HGPRNW+LI +SIPGRSGKSCRLRWCNQLSPQVEHR F
Sbjct  1    MDRTKGSWSTEEDEALRRLVERHGPRNWTLIGRSIPGRSGKSCRLRWCNQLSPQVEHRPF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-SMSADEGNDLAD  508
            TPEED+TIIRAH RFGNKWATIARLL+GRTDNAIKNHWNSTL+R+C+ S+ A    D   
Sbjct  61   TPEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLRRRCAPSVPAASVVDREG  120

Query  509  RLQHQPLKRS-------VSAGAAVTLHL  571
                QP KRS        SAGA + L L
Sbjct  121  ETTAQPPKRSSGEGPVLASAGAGLCLSL  148



>ref|XP_009415461.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            SRKD+DR+ GPWS EEDE LQ LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    SRKDVDRITGPWSQEEDEALQSLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS  475
            HR FT EED+ I+RAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK S+
Sbjct  63   HRHFTAEEDEIIVRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYST  114



>emb|CDY01420.1| BnaA07g11930D [Brassica napus]
Length=263

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 7/129 (5%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G   A   
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKC-------GGFYASAE  115

Query  515  QHQPLKRSV  541
              +P+KRSV
Sbjct  116  DQRPVKRSV  124



>ref|XP_009395856.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=364

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 5/125 (4%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K+ DR+KGPWSP EDE LQ+LVQ+HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  14   KEADRIKGPWSPAEDEALQRLVQRHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  73

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED+ I+RAH RFGNKWATIARLL+GRTDNAIKNHWNSTLKRK S   A E     
Sbjct  74   PFTDEEDEIIVRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKHSRPCAGE-----  128

Query  506  DRLQH  520
            D LQH
Sbjct  129  DGLQH  133



>ref|XP_003575562.1| PREDICTED: transcription factor MYB44-like [Brachypodium distachyon]
Length=336

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            KD DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  18   KDADRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  77

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM  478
             FT +ED+ I+RAHARFGNKWATIARLL GRTDNAIKNHWNSTLKRK SSM
Sbjct  78   PFTADEDEAILRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSSM  128



>emb|CDY12830.1| BnaC07g16030D [Brassica napus]
Length=253

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 112/143 (78%), Gaps = 11/143 (8%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI RAHA+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       G   A   
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKC-------GGFYAPAE  115

Query  515  QHQPLKRSVSA----GAAVTLHL  571
              +P+KRSV         VTL L
Sbjct  116  DQRPVKRSVFKPVPRAGGVTLPL  138



>ref|XP_006293134.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
 gb|EOA26032.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
Length=309

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 10/142 (7%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC-------SSMSADEG  493
            PEED+TI+ A ++FGNKWATIARLL GRTDNA+KNHWNSTLKRKC       ++M+ADE 
Sbjct  63   PEEDETIVTARSKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGGGVATTTMTADEE  122

Query  494  NDLADRLQHQPLKRSVSAGAAV  559
             D  DR +    +RSVS  +A 
Sbjct  123  EDDQDRPKK---RRSVSFDSAF  141



>ref|XP_011088207.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=286

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDELL++LVQ+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHRAFT
Sbjct  9    DRIKGPWSPEEDELLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPEVEHRAFT  68

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             +ED+ I++AHA+FGNKWATIARLL GRTDNAIKNHWNSTLKRK ++ +A  G  + +  
Sbjct  69   ADEDEIILKAHAQFGNKWATIARLLNGRTDNAIKNHWNSTLKRKFAAETAAVG--VGEER  126

Query  515  QHQPLKRSVSAGAAVTL  565
              Q L+R+ S   +  +
Sbjct  127  LAQVLRRTGSGDVSTAM  143



>ref|XP_002313145.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
 gb|EEE87100.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
Length=245

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            D +RVKGPWSPEED+LL+ LV KHGPRNW++I++++PGRSGKSCRLRWCNQLSP+VEHRA
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLAD  508
            FT EED+ II AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK + +  ++G    D
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTDNAIKNHWNSTLKRKYADLIENDGTVNED  121

Query  509  RLQHQPLKRSVSAGAAVTLH  568
             ++    ++S   G++ ++H
Sbjct  122  GVK----EKSAKTGSSSSVH  137



>ref|XP_010057256.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW74299.1| hypothetical protein EUGRSUZ_E02958 [Eucalyptus grandis]
Length=296

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  319
            SR+D DRVKGPWSP+ED+LL++LVQ+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP VE
Sbjct  10   SRRDADRVKGPWSPDEDDLLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPGVE  69

Query  320  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            HR FT EEDD I+RAHA++GN+WATIARLL+GRTDNAIKNHWNSTLKRK ++   D
Sbjct  70   HRPFTAEEDDLIVRAHAKYGNRWATIARLLSGRTDNAIKNHWNSTLKRKYAAAIPD  125



>ref|XP_002518677.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF43602.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=245

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
             DRVKGPWSPEED LL++LVQ+HG RNW+LISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  7    FDRVKGPWSPEEDLLLKKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  66

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
             PEED+ I+ AH+RFGNKWA IARLL GRTDNAIKNHWNSTLKRK     A   ND  DR
Sbjct  67   APEEDEIIVDAHSRFGNKWAAIARLLNGRTDNAIKNHWNSTLKRK---YGAAFNNDDGDR  123

Query  512  LQHQ  523
            LQ +
Sbjct  124  LQEK  127



>ref|XP_011001142.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=243

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            D +RVKGPWSPEED+LL+ LV KHGPRNW++I++++PGRSGKSCRLRWCNQLSP+VEHRA
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLAD  508
            FT EED+ II AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRK + +  ++G    D
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTDNAIKNHWNSTLKRKYADLIENDGTVNED  121

Query  509  RLQHQPLKRSVSAGAAVTLH  568
             ++    ++S   G++ ++H
Sbjct  122  GVK----EKSAKTGSSSSVH  137



>ref|XP_002877726.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53985.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=285

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 10/142 (7%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS-------SMSADEG  493
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS       +M+  E 
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAAVTAMTVTET  122

Query  494  NDLADRLQHQPLKRSVSAGAAV  559
            ++  DR +    +RSVS  +A 
Sbjct  123  DEEEDRPKK---RRSVSFDSAF  141



>ref|XP_010691674.1| PREDICTED: transcription factor MYB44-like [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 7/127 (6%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEEDELLQ+LVQKHG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  15   DRIKGPWSPEEDELLQKLVQKHGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  74

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+ I+RAHA+ GNKWATI+RLL GRTDNAIKNHWNSTLKRK SS+ A  G+++    
Sbjct  75   TEEDEIIVRAHAQHGNKWATISRLLNGRTDNAIKNHWNSTLKRKFSSIVA--GDEI----  128

Query  515  QHQPLKR  535
             ++P KR
Sbjct  129  -YRPEKR  134



>ref|NP_001183628.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR37800.1| unknown [Zea mays]
 tpg|DAA39569.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04986.1| MYB transcription factor, partial [Zea mays]
Length=285

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            +DR+KGPWSPEEDE LQ+LV++HG RNWSLIS+S+PGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  17   VDRIKGPWSPEEDEALQRLVRRHGARNWSLISRSVPGRSGKSCRLRWCNQLSPRVEHRPF  76

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  466
            TP+EDD I+RAHARFGNKWATIARLL+GRTDNAIKNHWNSTLKR+
Sbjct  77   TPDEDDAILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRE  121



>ref|XP_010096284.1| Transcription factor [Morus notabilis]
 gb|EXB63679.1| Transcription factor [Morus notabilis]
Length=299

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            D+VKGPWS EEDELLQ LVQ++GPRNWS+IS+SIPGRSGKSCRLRWCNQLSP+V+HR F+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLAD  508
             EEDD I+ AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRKCSS + D+G  L D
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-AIDDGVMLLD  124



>gb|ABL97967.1| R2R3-MYB transcription factor [Brassica rapa]
Length=266

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS     +GN  A+  
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS-----DGNPTAEEE  117

Query  515  QHQPLKR  535
            Q    KR
Sbjct  118  QDPAKKR  124



>gb|AHN60131.1| MYB transcription factor 77 [Brassica napus]
Length=265

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS     +GN  A+  
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS-----DGNPTAEED  117

Query  515  QHQPLKR  535
            Q    KR
Sbjct  118  QDPAKKR  124



>gb|ABD60291.2| R2R3-MYB transcription factor MYB6 [Picea glauca]
Length=252

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 112/145 (77%), Gaps = 8/145 (6%)
 Frame = +2

Query  149  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  328
            + DR+KGPWSPEED  LQ  VQK GPRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR 
Sbjct  2    EPDRIKGPWSPEEDAALQHFVQKCGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRP  61

Query  329  FTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA----DEGN  496
            FTPEED TIIRAHA+ GNKWATIAR+L+GRTDNAIKNHWNSTL+R+C    A    DE  
Sbjct  62   FTPEEDATIIRAHAQHGNKWATIARVLSGRTDNAIKNHWNSTLRRRCQGGGALVIDDEIT  121

Query  497  DLADRLQHQPLKRSVSAGAAVTLHL  571
              AD  +    KRS+S  A  +  L
Sbjct  122  SGADGFR----KRSLSEDADASRKL  142



>ref|XP_006404067.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
 gb|ESQ45520.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
Length=300

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 4/138 (3%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRKMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA---  505
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC     D     A   
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGGGGDVSFATATTT  122

Query  506  DRLQHQPLK-RSVSAGAA  556
            +  Q +P K RSVS+ +A
Sbjct  123  EEDQDRPKKRRSVSSESA  140



>gb|KJB77654.1| hypothetical protein B456_012G149000 [Gossypium raimondii]
Length=246

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D+DRVKGPWSPEEDELL++LV +HG RNWSL+S+SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    RDVDRVKGPWSPEEDELLRKLVHRHGARNWSLVSRSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED  I++AHA++GNKWATIARLL GRTDNA+KNHWNSTLKRK S   A++G+ + 
Sbjct  63   PFTSEEDGVIVKAHAKYGNKWATIARLLNGRTDNAVKNHWNSTLKRKLS--EAEDGDSVQ  120

Query  506  D---RLQHQPLKRSVSAGAAVTLHL  571
            +   R    P + S S      L L
Sbjct  121  ESEKRSVKSPRRESPSGSEVSDLGL  145



>ref|NP_190575.1| myb domain protein 77 [Arabidopsis thaliana]
 gb|AAL11582.1|AF424588_1 AT3g50060/F3A4_140 [Arabidopsis thaliana]
 emb|CAB62114.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
 gb|AAM70537.1| AT3g50060/F3A4_140 [Arabidopsis thaliana]
 gb|AAS10068.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE78622.1| myb domain protein 77 [Arabidopsis thaliana]
Length=301

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS   A       +  
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEED  122

Query  515  QHQPLK-RSVSAGAAV  559
            Q +P K RSVS  +A 
Sbjct  123  QDRPKKRRSVSFDSAF  138



>ref|XP_006487005.1| PREDICTED: transcription factor MYB44-like [Citrus sinensis]
Length=252

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 5/138 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC-----SSMSADEGND  499
            P+ED+ II+AHAR+GNKWATIARLL GRTDNAIKNHWNSTLKRK      S+++A    D
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDED  127

Query  500  LADRLQHQPLKRSVSAGA  553
              D  + +  + +VS   
Sbjct  128  SEDSDEREKKRSAVSVSG  145



>gb|KDO59816.1| hypothetical protein CISIN_1g040502mg [Citrus sinensis]
Length=252

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 5/138 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC-----SSMSADEGND  499
            P+ED+ II+AHAR+GNKWATIARLL GRTDNAIKNHWNSTLKRK      S+++A    D
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDED  127

Query  500  LADRLQHQPLKRSVSAGA  553
              D  + +  + +VS   
Sbjct  128  SEDSDEREKKRSAVSVSG  145



>ref|XP_006422932.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
 gb|ESR36172.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
Length=252

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 5/138 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC-----SSMSADEGND  499
            P+ED+ II+AHAR+GNKWATIARLL GRTDNAIKNHWNSTLKRK      S+++A    D
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDED  127

Query  500  LADRLQHQPLKRSVSAGA  553
              D  + +  + +VS   
Sbjct  128  SEDSDEREKKRSAVSVSG  145



>ref|XP_010092183.1| Transcription factor [Morus notabilis]
 gb|EXB50409.1| Transcription factor [Morus notabilis]
Length=310

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            D+VKGPWS EEDELLQ LVQ++GPRNWS+IS+SIPGRSGKSCRLRWCNQLSP+V+HR F+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLAD  508
             EEDD I+ AHA++GNKWATIARLL GRTDNAIKNHWNSTLKRKCSS + D+G  L D
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-AIDDGVMLLD  124



>emb|CAA74604.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
Length=304

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS   A       +  
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEED  122

Query  515  QHQPLK-RSVSAGAAV  559
            Q +P K RSVS  +A 
Sbjct  123  QDRPKKRRSVSFDSAF  138



>gb|KJB32313.1| hypothetical protein B456_005G234900 [Gossypium raimondii]
Length=236

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D+DRVKGPW PEEDE L++LVQ HGPRNWSLIS+SIPGRSGKSCRLRWCNQLSP+V HR
Sbjct  3    QDIDRVKGPWGPEEDESLRKLVQLHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPEVAHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED+ II+AHA+FGNKWATIARLL GRTDNA+KNHWNSTLKR+ S+   D   +  
Sbjct  63   PFTAEEDEIIIKAHAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRRRSAEDGDSVQESE  122

Query  506  DRLQHQPLKRSVS  544
             R    P   S+S
Sbjct  123  RRSSKFPRSGSIS  135



>ref|XP_008239060.1| PREDICTED: transcription factor MYB44, partial [Prunus mume]
Length=310

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 105/134 (78%), Gaps = 11/134 (8%)
 Frame = +2

Query  197  LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF  376
            LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF
Sbjct  2    LQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF  61

Query  377  GNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL-----------QHQ  523
            GNKWATIARLL GRTDNAIKNHWNSTLKRKCS +                       +  
Sbjct  62   GNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDIGVVFPGGGVGGSGGYDGHFLHDHEQP  121

Query  524  PLKRSVSAGAAVTL  565
            PLKRSVSAG+ + +
Sbjct  122  PLKRSVSAGSGMPV  135



>ref|XP_009396365.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=375

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K+  R+KGPWSPEED  LQ+LVQ+HGPRNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  11   KEAARIKGPWSPEEDTSLQRLVQRHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHR  70

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLA  505
             FT EED+ IIRAH RFGNKWATIAR+L+GRTDNAIKNHWNSTLKRK +   A  G+   
Sbjct  71   PFTAEEDEIIIRAHRRFGNKWATIARILSGRTDNAIKNHWNSTLKRKYTPPCAGSGD---  127

Query  506  DRLQH  520
              LQH
Sbjct  128  GGLQH  132



>emb|CAA90810.1| MYB-related protein [Arabidopsis thaliana]
Length=304

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS   A       +  
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEED  122

Query  515  QHQPLKR  535
            Q +P KR
Sbjct  123  QDRPKKR  129



>ref|XP_010932223.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=243

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            +R+KGPWSPEEDE L++L++ HGPRNWS ISK +PGRSGKSCRLRWCNQLSP VEHR FT
Sbjct  4    ERIKGPWSPEEDEALRRLIEIHGPRNWSAISKGVPGRSGKSCRLRWCNQLSPVVEHRPFT  63

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+ I+RAH RFGNKWATIARLLAGRTDNA+KNHWN+TLKR+ SS S D+G DL  R 
Sbjct  64   AEEDEAIVRAHRRFGNKWATIARLLAGRTDNAVKNHWNATLKRRLSSPSDDDG-DLNKRC  122

Query  515  QHQPLKRSVS  544
            +  P +   S
Sbjct  123  RSTPSRSDAS  132



>ref|XP_009396271.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=325

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 110/145 (76%), Gaps = 6/145 (4%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            K+M RV GPW  EEDE L +LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  22   KEMARVTGPWRAEEDEALLRLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPRVEHR  81

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGN---  496
             FT EED+ I+RAH R GNKWATIARLL+GRTDNAIKNHW STLKRK S    D+     
Sbjct  82   PFTAEEDEAIVRAHRRLGNKWATIARLLSGRTDNAIKNHWYSTLKRKSSPPPVDDAEGFA  141

Query  497  ---DLADRLQHQPLKRSVSAGAAVT  562
               DL D    +P KR+   GAA T
Sbjct  142  MAVDLKDAPAERPFKRASCVGAAYT  166



>ref|XP_010550347.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=305

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            +DR+KGPWS EEDE L++LV+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  2    VDRIKGPWSVEEDEQLRRLVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS  472
            T EED+TI+RAH +FGNKWATIARLL GRTDNA+KNHWNSTLKRKC+
Sbjct  62   TAEEDETIVRAHTQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCA  108



>ref|XP_010547980.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=319

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 10/139 (7%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            +K++DRVKGPWSPEED+LL++LVQ+HG RNW+ ISKSIPGRSGKSCRLRWCNQLSP+VEH
Sbjct  4    QKNLDRVKGPWSPEEDQLLRRLVQQHGARNWTGISKSIPGRSGKSCRLRWCNQLSPEVEH  63

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSM-------S  481
            R FT EED+ I+RAH   GNKWATIAR L GRTDNA+KNHWNSTLKR+ S+M       S
Sbjct  64   RPFTAEEDEIIVRAHVEHGNKWATIARRLNGRTDNAVKNHWNSTLKRRFSAMAMENGAIS  123

Query  482  ADEGNDLAD---RLQHQPL  529
             D+G  LAD   RL  +PL
Sbjct  124  EDDGYHLADKKQRLSPKPL  142



>emb|CDY30608.1| BnaAnng03830D [Brassica napus]
Length=265

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
             EED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS     +GN  A+  
Sbjct  63   AEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS-----DGNPTAEEE  117

Query  515  QHQPLKR  535
            Q    KR
Sbjct  118  QDPAKKR  124



>emb|CDY57355.1| BnaC08g48630D [Brassica napus]
Length=278

 Score =   197 bits (502),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC      +GN   +  
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCL-----DGNPTTEED  117

Query  515  QHQPLKR  535
            Q +  KR
Sbjct  118  QDRAKKR  124



>ref|XP_010426549.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=311

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCS  472
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKCS
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS  108



>ref|XP_009115687.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=266

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 5/127 (4%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADRL  514
            PEED+TI+ A A+FGNKWATIARLL GRT+NA+KNHWNSTLKRKC      +GN  A+  
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTNNAVKNHWNSTLKRKCL-----DGNPTAEEE  117

Query  515  QHQPLKR  535
            Q    KR
Sbjct  118  QDPAKKR  124



>gb|KJB12279.1| hypothetical protein B456_002G009300 [Gossypium raimondii]
Length=252

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D+DRV+GPWSPEEDELL++LVQ++GPRNW++IS SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    QDIDRVRGPWSPEEDELLRKLVQRYGPRNWTVISTSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  466
            AFT EED  I +AHA +GNKWATIARLL GRTDNA+KNHWNSTLKRK
Sbjct  63   AFTAEEDRIIRKAHALYGNKWATIARLLNGRTDNAVKNHWNSTLKRK  109



>ref|XP_010515371.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRMMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA  484
            PEED+TI+ A A+FGNKWATIARLL GRTDNA+KNHWNSTLKRKC    A
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGGGA  112



>gb|ABQ51222.1| R2R3-MYB transcription factor MYB6 [Picea glauca]
Length=350

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 108/137 (79%), Gaps = 8/137 (6%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DR+KGPWSPEED  LQ  VQK  PRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  12   DRIKGPWSPEEDAALQHFVQKCWPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRPFT  71

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSA----DEGNDL  502
            PEED TIIRAHA+ GNKWATIAR+L+GRTDNAIKNHWNSTL+R+C    A    DE    
Sbjct  72   PEEDATIIRAHAQHGNKWATIARMLSGRTDNAIKNHWNSTLRRRCQGGGALVIDDEITSG  131

Query  503  ADRLQHQPLKRSVSAGA  553
            AD  +    KRS+S  A
Sbjct  132  ADGFR----KRSLSEDA  144



>gb|ABD60281.1| R2R3-MYB transcription factor MYB7 [Pinus taeda]
Length=374

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  146  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  325
            +D+DR+KGPWSPEED  LQ+LVQK+GPRNW+LISK IPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   EDLDRIKGPWSPEEDASLQRLVQKYGPRNWTLISKGIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  326  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC  469
             FTP ED  I++AHA+ GNKWATIAR L GRTDNAIKNHWNSTL+R+C
Sbjct  70   PFTPSEDAAILQAHAQHGNKWATIARALPGRTDNAIKNHWNSTLRRRC  117



>gb|KFK34266.1| hypothetical protein AALP_AA5G122700 [Arabis alpina]
Length=311

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKC  469
            PEED+TII A  +FGNKWATIARLL GRTDNA+KNHWNSTLKRKC
Sbjct  63   PEEDETIISARGKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKC  107



>gb|KEH25080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1513

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            MDR+KGPWSPEEDE LQ+LV+KHG RNWS++SKSIPGRSGKSCRL WCNQLSPQVE  AF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGARNWSILSKSIPGRSGKSCRLPWCNQLSPQVERGAF  60

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADE  490
            TPEED+ IIRAHARFGNKWATIARLL G+TDNA+KNHWN TLK KCSS+  DE
Sbjct  61   TPEEDEAIIRAHARFGNKWATIARLLPGQTDNAVKNHWNITLKHKCSSIIMDE  113



>ref|XP_002451692.1| hypothetical protein SORBIDRAFT_04g005940 [Sorghum bicolor]
 gb|EES04668.1| hypothetical protein SORBIDRAFT_04g005940 [Sorghum bicolor]
Length=327

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = +2

Query  134  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  313
             +   + DR+KGPWSPEEDE L++LV++HG RNW+ I + IPGRSGKSCRLRWCNQLSPQ
Sbjct  2    GVESSECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWCNQLSPQ  61

Query  314  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEG  493
            VE R FTPEED  I+ AHAR GN+WA IARLL GRTDNA+KNHWNS+LKRK ++ ++  G
Sbjct  62   VERRPFTPEEDAAILAAHARLGNRWAAIARLLPGRTDNAVKNHWNSSLKRKLATATSSGG  121

Query  494  NDLADRLQHQPLKRSVSAG  550
             D+ D  + +P KR+  AG
Sbjct  122  ADIGD-PEERPCKRASPAG  139



>ref|XP_002285389.1| PREDICTED: transcription factor MYB44 [Vitis vinifera]
Length=303

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  143  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  322
            + + DRVKGPWSP+ED+ LQ LV+++G RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  5    QNEADRVKGPWSPQEDQALQCLVKRYGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEH  64

Query  323  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSS  475
            R FTPEED  II AHA++GNKWATIAR+L GRTDNAIKNHWNSTLKRK ++
Sbjct  65   RPFTPEEDRRIIEAHAKYGNKWATIARMLNGRTDNAIKNHWNSTLKRKFAA  115



>ref|XP_008796508.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=267

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            +R+KGPW PEEDE L++LV+ HGPRNWS ISK +PGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  4    ERIKGPWGPEEDEALRRLVEIHGPRNWSAISKGVPGRSGKSCRLRWCNQLSPEVEHRPFT  63

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMS--ADEGNDLAD  508
             EED+ I+RAH RFG+KWATIARLLAGRTDNA+KNHWN+TLKR+ +S+S  +++ +D   
Sbjct  64   AEEDEIIVRAHRRFGSKWATIARLLAGRTDNAVKNHWNATLKRRLASLSPASNDDDDRNK  123

Query  509  RLQHQPLKRSVS  544
            R +  P    VS
Sbjct  124  RCRSTPSGSDVS  135



>emb|CDY23023.1| BnaC07g31640D [Brassica napus]
Length=290

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSAD  487
            PEED+TI+ A A+FGN+WATIARLL GRTDNA+KNHWNSTLKRK      D
Sbjct  63   PEEDETILSARAKFGNRWATIARLLNGRTDNAVKNHWNSTLKRKFVGGGGD  113



>ref|XP_004501595.1| PREDICTED: transcriptional activator Myb-like [Cicer arietinum]
Length=237

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  152  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  331
            +DR+KGPWS EED +L +LV++HGPRNWSLIS+ I GRSGKSCRLRWCNQLSP VEHR F
Sbjct  31   LDRIKGPWSAEEDRILTRLVEQHGPRNWSLISRYIKGRSGKSCRLRWCNQLSPTVEHRPF  90

Query  332  TPEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKCSSMSADEGNDLADR  511
            +P+ED+TII AHA++GN+WATIARLL GRTDNA+KNHWNSTLKRK S +  D    +A  
Sbjct  91   SPQEDETIIAAHAQYGNRWATIARLLPGRTDNAVKNHWNSTLKRKASGLGGDCSVVVAGN  150

Query  512  LQHQPLKRSVSAGAAV  559
            +       S S+G  V
Sbjct  151  VTASNEGGSFSSGRGV  166



>emb|CDY02098.1| BnaA03g40690D [Brassica napus]
Length=293

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  155  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  334
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  335  PEEDDTIIRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRK  466
            PEED+TI+ A A+FGN+WATIARLL GRTDNA+KNHWNSTLKRK
Sbjct  63   PEEDETILSARAKFGNRWATIARLLNGRTDNAVKNHWNSTLKRK  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750