BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022P02

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAJ77501.1|  expp1 protein precursor                                331   4e-111   Solanum tuberosum [potatoes]
ref|XP_006339175.1|  PREDICTED: uncharacterized protein LOC102588286    329   1e-110   
ref|XP_009589407.1|  PREDICTED: uncharacterized protein LOC104086779    326   3e-109   Nicotiana tomentosiformis
ref|XP_009780791.1|  PREDICTED: uncharacterized protein LOC104229791    326   4e-109   Nicotiana sylvestris
ref|XP_011094218.1|  PREDICTED: uncharacterized protein LOC105173973    318   5e-106   Sesamum indicum [beniseed]
ref|XP_009608547.1|  PREDICTED: uncharacterized protein LOC104102525    318   6e-106   Nicotiana tomentosiformis
ref|XP_007028015.1|  Uncharacterized protein TCM_023045                 313   5e-104   Theobroma cacao [chocolate]
emb|CDP10582.1|  unnamed protein product                                311   3e-103   Coffea canephora [robusta coffee]
ref|XP_009368382.1|  PREDICTED: uncharacterized protein LOC103957887    311   3e-103   
ref|XP_008385577.1|  PREDICTED: uncharacterized protein LOC103448116    310   7e-103   Malus domestica [apple tree]
gb|KJB16527.1|  hypothetical protein B456_002G234200                    310   9e-103   Gossypium raimondii
gb|KHG09254.1|  hypothetical protein F383_15505                         309   1e-102   Gossypium arboreum [tree cotton]
ref|XP_011077792.1|  PREDICTED: uncharacterized protein LOC105161704    306   2e-101   Sesamum indicum [beniseed]
ref|XP_004249401.2|  PREDICTED: uncharacterized protein LOC101246776    306   2e-101   Solanum lycopersicum
ref|XP_010058958.1|  PREDICTED: uncharacterized protein LOC104446855    306   3e-101   Eucalyptus grandis [rose gum]
gb|KDP36093.1|  hypothetical protein JCGZ_08737                         305   8e-101   Jatropha curcas
ref|XP_004140172.1|  PREDICTED: uncharacterized protein LOC101221211    305   8e-101   Cucumis sativus [cucumbers]
ref|XP_010514756.1|  PREDICTED: uncharacterized protein LOC104790674    305   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009121178.1|  PREDICTED: uncharacterized protein LOC103846006    305   2e-100   Brassica rapa
ref|XP_010503072.1|  PREDICTED: uncharacterized protein LOC104780...    304   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_008449601.1|  PREDICTED: uncharacterized protein LOC103491438    303   4e-100   Cucumis melo [Oriental melon]
ref|XP_006291737.1|  hypothetical protein CARUB_v10017907mg             303   6e-100   Capsella rubella
ref|XP_010496864.1|  PREDICTED: uncharacterized protein LOC104773893    303   7e-100   Camelina sativa [gold-of-pleasure]
emb|CDY55301.1|  BnaA06g38910D                                          301   2e-99    Brassica napus [oilseed rape]
emb|CDX87939.1|  BnaC03g54570D                                          301   3e-99    
ref|XP_011046438.1|  PREDICTED: uncharacterized protein LOC105141047    300   3e-99    Populus euphratica
ref|XP_011042566.1|  PREDICTED: uncharacterized protein LOC105138225    300   4e-99    Populus euphratica
ref|XP_011035616.1|  PREDICTED: uncharacterized protein LOC105133...    300   6e-99    Populus euphratica
ref|XP_003538086.1|  PREDICTED: uncharacterized protein LOC100814491    300   6e-99    Glycine max [soybeans]
ref|XP_010535718.1|  PREDICTED: uncharacterized protein LOC104810937    300   6e-99    Tarenaya hassleriana [spider flower]
ref|XP_010247701.1|  PREDICTED: uncharacterized protein LOC104590673    300   6e-99    Nelumbo nucifera [Indian lotus]
ref|XP_002322773.1|  hypothetical protein POPTR_0016s06840g             299   1e-98    Populus trichocarpa [western balsam poplar]
gb|KFK33866.1|  hypothetical protein AALP_AA5G070300                    299   1e-98    Arabis alpina [alpine rockcress]
ref|NP_190001.2|  uncharacterized protein                               299   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011035615.1|  PREDICTED: uncharacterized protein LOC105133...    299   2e-98    Populus euphratica
ref|XP_002875644.1|  predicted protein                                  298   3e-98    Arabidopsis lyrata subsp. lyrata
gb|KHN21200.1|  hypothetical protein glysoja_006679                     298   3e-98    Glycine soja [wild soybean]
ref|NP_001240927.1|  uncharacterized protein LOC100818051 precursor     297   5e-98    Glycine max [soybeans]
ref|XP_006404508.1|  hypothetical protein EUTSA_v10010660mg             297   1e-97    Eutrema salsugineum [saltwater cress]
ref|XP_007145779.1|  hypothetical protein PHAVU_007G267000g             294   8e-97    Phaseolus vulgaris [French bean]
gb|KHF98050.1|  hypothetical protein F383_37453                         294   8e-97    Gossypium arboreum [tree cotton]
ref|XP_004497641.1|  PREDICTED: uncharacterized protein LOC101499...    293   2e-96    Cicer arietinum [garbanzo]
ref|XP_002309260.1|  hypothetical protein POPTR_0006s21620g             293   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010106982.1|  hypothetical protein L484_016911                   292   7e-96    Morus notabilis
ref|XP_002524077.1|  conserved hypothetical protein                     292   7e-96    Ricinus communis
ref|XP_007202487.1|  hypothetical protein PRUPE_ppa010561mg             292   8e-96    Prunus persica
ref|XP_004303412.1|  PREDICTED: uncharacterized protein LOC101306356    291   1e-95    Fragaria vesca subsp. vesca
ref|XP_006481617.1|  PREDICTED: uncharacterized protein LOC102630770    290   5e-95    Citrus sinensis [apfelsine]
ref|XP_006430044.1|  hypothetical protein CICLE_v10012616mg             290   6e-95    Citrus clementina [clementine]
ref|XP_004497642.1|  PREDICTED: uncharacterized protein LOC101499...    289   9e-95    
ref|XP_007132505.1|  hypothetical protein PHAVU_011G099900g             288   3e-94    Phaseolus vulgaris [French bean]
ref|XP_009336403.1|  PREDICTED: uncharacterized protein LOC103928991    287   6e-94    
ref|XP_009336402.1|  PREDICTED: uncharacterized protein LOC103928990    286   6e-94    Pyrus x bretschneideri [bai li]
ref|XP_007015648.1|  Uncharacterized protein TCM_041214                 287   6e-94    Theobroma cacao [chocolate]
ref|XP_008360605.1|  PREDICTED: uncharacterized protein LOC103424296    286   2e-93    
ref|XP_008367354.1|  PREDICTED: uncharacterized protein LOC103430985    285   3e-93    
ref|XP_003519108.1|  PREDICTED: uncharacterized protein LOC100807...    285   4e-93    Glycine max [soybeans]
ref|XP_009348837.1|  PREDICTED: uncharacterized protein LOC103940443    285   4e-93    Pyrus x bretschneideri [bai li]
ref|XP_006842158.1|  hypothetical protein AMTR_s00078p00138630          285   6e-93    Amborella trichopoda
ref|XP_010677555.1|  PREDICTED: uncharacterized protein LOC104893168    284   9e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|EPS69588.1|  expp1 protein                                           283   1e-92    Genlisea aurea
ref|XP_008361648.1|  PREDICTED: uncharacterized protein LOC103425346    284   1e-92    
ref|XP_008344952.1|  PREDICTED: uncharacterized protein LOC103407860    284   1e-92    
ref|XP_010534378.1|  PREDICTED: uncharacterized protein LOC104809944    283   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_003535822.1|  PREDICTED: uncharacterized protein LOC100795...    283   2e-92    Glycine max [soybeans]
emb|CAB88423.1|  putative protein                                       283   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263047.1|  PREDICTED: uncharacterized protein LOC104601426    282   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_002271183.1|  PREDICTED: uncharacterized protein LOC100249592    280   2e-91    Vitis vinifera
ref|XP_010907712.1|  PREDICTED: uncharacterized protein LOC105034308    280   5e-91    Elaeis guineensis
ref|XP_008787836.1|  PREDICTED: uncharacterized protein LOC103705763    277   3e-90    Phoenix dactylifera
gb|AEZ00912.1|  putative expp1 protein                                  277   6e-90    Elaeis guineensis
ref|XP_010906029.1|  PREDICTED: uncharacterized protein LOC105033073    277   7e-90    Elaeis guineensis
ref|XP_009381303.1|  PREDICTED: uncharacterized protein LOC103969490    275   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004161289.1|  PREDICTED: uncharacterized LOC101209667 isof...    273   2e-88    
ref|XP_004136522.1|  PREDICTED: uncharacterized protein LOC101209667    273   2e-88    Cucumis sativus [cucumbers]
ref|XP_003590316.1|  hypothetical protein MTR_1g056390                  272   3e-88    Medicago truncatula
ref|XP_010036587.1|  PREDICTED: uncharacterized protein LOC104425564    271   7e-88    Eucalyptus grandis [rose gum]
ref|XP_008811297.1|  PREDICTED: uncharacterized protein LOC103722495    271   8e-88    
ref|XP_010263787.1|  PREDICTED: uncharacterized protein LOC104601...    271   8e-88    Nelumbo nucifera [Indian lotus]
ref|XP_010263788.1|  PREDICTED: uncharacterized protein LOC104601...    271   1e-87    Nelumbo nucifera [Indian lotus]
ref|XP_010263789.1|  PREDICTED: uncharacterized protein LOC104601...    271   1e-87    Nelumbo nucifera [Indian lotus]
ref|XP_008442938.1|  PREDICTED: uncharacterized protein LOC103486692    271   1e-87    Cucumis melo [Oriental melon]
gb|ABK22043.1|  unknown                                                 270   4e-87    Picea sitchensis
ref|XP_008241077.1|  PREDICTED: uncharacterized protein LOC103339548    267   5e-86    Prunus mume [ume]
ref|XP_010503073.1|  PREDICTED: uncharacterized protein LOC104780...    266   1e-85    
ref|XP_004982307.1|  PREDICTED: uncharacterized protein LOC101777564    265   2e-85    Setaria italica
ref|XP_002882747.1|  hypothetical protein ARALYDRAFT_478525             265   3e-85    
ref|XP_009407725.1|  PREDICTED: uncharacterized protein LOC103990346    264   5e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148355.1|  expp1 protein precursor                            262   3e-84    
gb|AAT75254.1|  expressed protein                                       263   3e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148709.1|  expp1 protein precursor                            262   4e-84    
ref|NP_001140927.1|  expp1 protein precursor                            262   5e-84    Zea mays [maize]
ref|XP_006356594.1|  PREDICTED: uncharacterized protein LOC102601...    261   7e-84    Solanum tuberosum [potatoes]
ref|NP_566401.1|  uncharacterized protein                               261   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667260.1|  PREDICTED: expp1 protein isoform X2                263   1e-83    
ref|XP_008667257.1|  PREDICTED: expp1 protein isoform X1                263   2e-83    
ref|XP_002464167.1|  hypothetical protein SORBIDRAFT_01g013420          260   2e-83    Sorghum bicolor [broomcorn]
ref|XP_010464889.1|  PREDICTED: uncharacterized protein LOC104745376    260   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010276279.1|  PREDICTED: uncharacterized protein LOC104611063    259   3e-83    
ref|XP_006298425.1|  hypothetical protein CARUB_v10014494mg             259   3e-83    Capsella rubella
gb|ACL53994.1|  unknown                                                 259   4e-83    Zea mays [maize]
ref|XP_004290389.1|  PREDICTED: uncharacterized protein LOC101301448    259   5e-83    Fragaria vesca subsp. vesca
gb|ABF97892.1|  expressed protein                                       259   6e-83    Oryza sativa Japonica Group [Japonica rice]
gb|KFK38545.1|  hypothetical protein AALP_AA3G127900                    259   6e-83    Arabis alpina [alpine rockcress]
ref|XP_004248747.1|  PREDICTED: uncharacterized protein LOC101250348    258   7e-83    Solanum lycopersicum
gb|EEC77546.1|  hypothetical protein OsI_16454                          259   9e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001050775.2|  Os03g0647800                                       258   2e-82    
ref|XP_002281560.2|  PREDICTED: uncharacterized protein LOC100243476    258   2e-82    Vitis vinifera
emb|CBI32499.3|  unnamed protein product                                257   2e-82    Vitis vinifera
ref|XP_010498123.1|  PREDICTED: uncharacterized protein LOC104775868    256   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010486846.1|  PREDICTED: uncharacterized protein LOC104764937    256   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009759897.1|  PREDICTED: uncharacterized protein LOC104212369    255   2e-81    Nicotiana sylvestris
gb|EYU37728.1|  hypothetical protein MIMGU_mgv1a012673mg                254   3e-81    Erythranthe guttata [common monkey flower]
ref|XP_003559352.1|  PREDICTED: uncharacterized protein LOC100825968    254   4e-81    Brachypodium distachyon [annual false brome]
ref|XP_006651640.1|  PREDICTED: uncharacterized protein LOC102702926    253   5e-81    Oryza brachyantha
ref|XP_006651887.1|  PREDICTED: uncharacterized protein LOC102713815    252   1e-80    
ref|XP_009590990.1|  PREDICTED: uncharacterized protein LOC104088076    251   4e-80    Nicotiana tomentosiformis
emb|CDY08494.1|  BnaA05g27300D                                          251   5e-80    Brassica napus [oilseed rape]
ref|XP_009146681.1|  PREDICTED: uncharacterized protein LOC103870308    251   6e-80    Brassica rapa
ref|XP_009135184.1|  PREDICTED: uncharacterized protein LOC103859409    249   4e-79    Brassica rapa
emb|CAN82373.1|  hypothetical protein VITISV_027624                     248   1e-78    Vitis vinifera
emb|CDO97124.1|  unnamed protein product                                246   5e-78    Coffea canephora [robusta coffee]
ref|XP_002519146.1|  conserved hypothetical protein                     246   6e-78    
ref|XP_008374037.1|  PREDICTED: uncharacterized protein LOC103437345    246   8e-78    Malus domestica [apple tree]
ref|XP_011088314.1|  PREDICTED: uncharacterized protein LOC105169588    245   1e-77    Sesamum indicum [beniseed]
ref|XP_004981507.1|  PREDICTED: uncharacterized protein LOC101763233    245   1e-77    
ref|XP_006407410.1|  hypothetical protein EUTSA_v10021362mg             246   1e-77    
gb|EPS70295.1|  hypothetical protein M569_04465                         244   3e-77    Genlisea aurea
ref|XP_010690983.1|  PREDICTED: uncharacterized protein LOC104904437    243   6e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003561838.1|  PREDICTED: uncharacterized protein LOC100825689    243   8e-77    Brachypodium distachyon [annual false brome]
ref|NP_001149996.1|  expp1 protein precursor                            242   3e-76    
ref|XP_007199436.1|  hypothetical protein PRUPE_ppa026636mg             239   1e-75    
ref|XP_008236692.1|  PREDICTED: uncharacterized protein LOC103335461    239   2e-75    Prunus mume [ume]
ref|XP_010096267.1|  hypothetical protein L484_027004                   239   3e-75    Morus notabilis
ref|XP_010263791.1|  PREDICTED: uncharacterized protein LOC104601...    238   5e-75    Nelumbo nucifera [Indian lotus]
ref|XP_009417070.1|  PREDICTED: uncharacterized protein LOC103997543    239   5e-75    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94664.1|  predicted protein                                      239   6e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90624.1|  predicted protein                                      239   6e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010526940.1|  PREDICTED: uncharacterized protein LOC104804369    238   7e-75    Tarenaya hassleriana [spider flower]
gb|KDP38260.1|  hypothetical protein JCGZ_04903                         237   2e-74    Jatropha curcas
ref|XP_008459230.1|  PREDICTED: uncharacterized protein LOC103498418    234   2e-73    Cucumis melo [Oriental melon]
ref|XP_009136289.1|  PREDICTED: uncharacterized protein LOC103860439    234   5e-73    Brassica rapa
ref|XP_010517082.1|  PREDICTED: uncharacterized protein LOC104792590    233   9e-73    
ref|XP_010467337.1|  PREDICTED: uncharacterized protein LOC104747407    233   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010066065.1|  PREDICTED: uncharacterized protein LOC104453239    233   1e-72    Eucalyptus grandis [rose gum]
ref|XP_006299440.1|  hypothetical protein CARUB_v10015605mg             232   2e-72    
ref|XP_002463772.1|  hypothetical protein SORBIDRAFT_01g005890          231   4e-72    
emb|CDY02274.1|  BnaA03g38930D                                          234   9e-72    
ref|XP_008643755.1|  PREDICTED: expp1 protein isoform X1                244   9e-72    
emb|CDX89683.1|  BnaC03g45970D                                          234   9e-72    
gb|ACF84480.1|  unknown                                                 229   2e-71    Zea mays [maize]
ref|XP_006409495.1|  hypothetical protein EUTSA_v10023083mg             232   3e-71    
ref|XP_004507366.1|  PREDICTED: uncharacterized protein LOC101506783    229   6e-71    Cicer arietinum [garbanzo]
gb|KDO39918.1|  hypothetical protein CISIN_1g040802mg                   228   1e-70    Citrus sinensis [apfelsine]
ref|XP_002885990.1|  hypothetical protein ARALYDRAFT_319534             231   1e-70    
ref|XP_006423087.1|  hypothetical protein CICLE_v10029171mg             228   1e-70    
ref|XP_006480155.1|  PREDICTED: uncharacterized protein LOC102615233    228   1e-70    Citrus sinensis [apfelsine]
ref|XP_011005674.1|  PREDICTED: uncharacterized protein LOC105111893    228   1e-70    Populus euphratica
ref|XP_006384473.1|  hypothetical protein POPTR_0004s15390g             226   2e-70    
ref|XP_004145350.1|  PREDICTED: uncharacterized protein LOC101213680    226   3e-70    
ref|XP_011001205.1|  PREDICTED: uncharacterized protein LOC105108558    224   2e-69    Populus euphratica
gb|AFK46494.1|  unknown                                                 223   1e-68    Lotus japonicus
ref|XP_007042316.1|  CSL zinc finger domain-containing protein          218   3e-67    
gb|KJB78925.1|  hypothetical protein B456_013G040100                    217   6e-67    Gossypium raimondii
ref|XP_007131910.1|  hypothetical protein PHAVU_011G050900g             214   2e-65    Phaseolus vulgaris [French bean]
ref|XP_001762404.1|  predicted protein                                  213   5e-65    
ref|NP_179191.1|  CSL zinc finger domain-containing protein             217   5e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002977899.1|  hypothetical protein SELMODRAFT_36451              209   2e-63    
ref|XP_003606839.1|  hypothetical protein MTR_4g068290                  209   2e-63    
ref|XP_003541122.2|  PREDICTED: uncharacterized protein LOC100813820    209   2e-63    Glycine max [soybeans]
gb|KHN25326.1|  hypothetical protein glysoja_010243                     209   2e-63    Glycine soja [wild soybean]
gb|AES89036.2|  CSL zinc finger protein, putative                       209   3e-63    Medicago truncatula
gb|KJB78926.1|  hypothetical protein B456_013G040100                    207   4e-63    Gossypium raimondii
ref|NP_001241490.1|  uncharacterized protein LOC100816612               207   2e-62    Glycine max [soybeans]
ref|XP_002979423.1|  hypothetical protein SELMODRAFT_58114              206   2e-62    
gb|KGN61748.1|  hypothetical protein Csa_2G237180                       205   4e-62    Cucumis sativus [cucumbers]
gb|EEC76294.1|  hypothetical protein OsI_13809                          201   1e-60    Oryza sativa Indica Group [Indian rice]
tpg|DAA50290.1|  TPA: hypothetical protein ZEAMMB73_913292              194   3e-58    
gb|ACL54751.1|  unknown                                                 192   3e-57    Zea mays [maize]
ref|XP_006838810.1|  hypothetical protein AMTR_s00002p00262020          189   1e-56    
gb|ACU17763.1|  unknown                                                 184   5e-55    Glycine max [soybeans]
ref|XP_002863988.1|  hypothetical protein ARALYDRAFT_495006             174   4e-50    
ref|XP_010517092.1|  PREDICTED: uncharacterized protein LOC104792600    171   1e-49    
gb|EYU18142.1|  hypothetical protein MIMGU_mgv1a011713mg                163   1e-49    Erythranthe guttata [common monkey flower]
emb|CDY70957.1|  BnaC03g73480D                                          169   4e-49    Brassica napus [oilseed rape]
gb|KCW63843.1|  hypothetical protein EUGRSUZ_G01513                     171   6e-49    Eucalyptus grandis [rose gum]
ref|XP_008354774.1|  PREDICTED: uncharacterized protein LOC103418422    164   3e-47    Malus domestica [apple tree]
gb|AAU89199.1|  expressed protein                                       172   8e-47    Oryza sativa Japonica Group [Japonica rice]
gb|AFW68146.1|  expp1 protein, mRNA isoform 1                           160   4e-46    
gb|EMS61424.1|  Protein IQ-DOMAIN 1                                     166   4e-44    Triticum urartu
gb|EMT08784.1|  hypothetical protein F775_31788                         150   2e-41    
gb|EMT01607.1|  hypothetical protein F775_23771                         158   7e-41    
gb|AAF23196.1|AC016795_9  unknown protein                               145   3e-40    Arabidopsis thaliana [mouse-ear cress]
gb|AFW67426.1|  hypothetical protein ZEAMMB73_369494                    137   8e-37    
ref|XP_006292065.1|  hypothetical protein CARUB_v10018260mg             132   2e-35    
emb|CAB62352.1|  hypothetical protein                                   124   7e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827430.1|  hypothetical protein AMTR_s00009p00088580          119   3e-30    
ref|XP_002975636.1|  hypothetical protein SELMODRAFT_415872             119   1e-28    
ref|XP_002973613.1|  hypothetical protein SELMODRAFT_414097             119   1e-28    
ref|XP_002978961.1|  hypothetical protein SELMODRAFT_418771             116   6e-27    
emb|CAN71120.1|  hypothetical protein VITISV_000390                     105   9e-25    Vitis vinifera
ref|XP_008350235.1|  PREDICTED: uncharacterized protein LOC103413547    107   7e-23    
ref|NP_001051495.1|  Os03g0787100                                     98.6    3e-22    
ref|XP_001760696.1|  predicted protein                                96.7    2e-19    
ref|XP_006303588.1|  hypothetical protein CARUB_v100111180mg          88.2    7e-19    
ref|NP_190432.4|  uncharacterized protein                             66.6    1e-12    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54071.1|  BnaA07g36330D                                        72.4    2e-12    Brassica napus [oilseed rape]
ref|XP_003064312.1|  predicted protein                                68.9    1e-10    Micromonas pusilla CCMP1545
ref|XP_002501068.1|  predicted protein                                65.1    2e-09    Micromonas commoda
ref|XP_006584145.1|  PREDICTED: uncharacterized protein LOC102665500  58.2    1e-07    
ref|XP_001695376.1|  predicted protein                                57.0    2e-06    Chlamydomonas reinhardtii
ref|XP_005647423.1|  hypothetical protein COCSUDRAFT_42464            51.6    1e-04    Coccomyxa subellipsoidea C-169



>emb|CAJ77501.1| expp1 protein precursor [Solanum tuberosum]
Length=243

 Score =   331 bits (848),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A+S SDTNHV+SPCAD  VQ+SDGF+FGI FA+R + F+N S    VQLSPCD+RLSL+ 
Sbjct  22   AQSRSDTNHVYSPCADAKVQRSDGFSFGIAFASRTSFFVNSS----VQLSPCDKRLSLSS  77

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+Q+AVFRPKVDEISLLT+NTSSFFPDS GGYMVAFAGRKYAARS PAFVANG++ V+S
Sbjct  78   ANSQIAVFRPKVDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSLPAFVANGTFTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+CKNRGGNVDCSLGIQ
Sbjct  138  FTLVHEFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            LTFSGTDKH SVFNSW+EVK
Sbjct  198  LTFSGTDKHASVFNSWFEVK  217



>ref|XP_006339175.1| PREDICTED: uncharacterized protein LOC102588286 [Solanum tuberosum]
Length=243

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 179/200 (90%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A+S SDTNHV+SPCAD  VQ+SDGF+FGI FA+R + F+N S    VQLSPCD+RLSL+ 
Sbjct  22   AQSRSDTNHVYSPCADAKVQRSDGFSFGIAFASRTSFFVNSS----VQLSPCDKRLSLSS  77

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+Q+AVFRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVANG++ V+S
Sbjct  78   ANSQIAVFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANGTFTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+CKNRGGNVDCSLGIQ
Sbjct  138  FTLVHEFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            LTFSGTDKH SVFNSW+EVK
Sbjct  198  LTFSGTDKHASVFNSWFEVK  217



>ref|XP_009589407.1| PREDICTED: uncharacterized protein LOC104086779 [Nicotiana tomentosiformis]
Length=242

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 178/200 (89%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A+S SDTNHV+SPCAD  VQKSDGF+FGI F++R + F+N S    VQLSPCD+RLSL+ 
Sbjct  21   AQSRSDTNHVYSPCADAKVQKSDGFSFGIAFSSRTSFFLNSS----VQLSPCDKRLSLSS  76

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+Q+AVFRPKVDEISLLT+NT++FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+S
Sbjct  77   ANSQIAVFRPKVDEISLLTINTTNFFPDSYGGYMVAFAGRKYAARSLPAFVANNTFTVTS  136

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLN QDCA++TN+CKNRGGNVDCSLGIQ
Sbjct  137  FTLVLEFKKGRLENLYWKRDGCSSCSGNSNFVCLNDQDCAIRTNNCKNRGGNVDCSLGIQ  196

Query  616  LTFSGTDKHESVFNSWYEVK  675
            LTFSGTDKHESVFNSW+EVK
Sbjct  197  LTFSGTDKHESVFNSWFEVK  216



>ref|XP_009780791.1| PREDICTED: uncharacterized protein LOC104229791 [Nicotiana sylvestris]
Length=242

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 178/200 (89%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A+S SDTNHV+SPCAD  VQKSDGF+FGI F++R + F+N S    VQLSPCD+RLSL+ 
Sbjct  21   AQSRSDTNHVYSPCADAKVQKSDGFSFGIAFSSRTSFFLNSS----VQLSPCDKRLSLSS  76

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+QLAVFRP+VDEISLLT+NT++FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+S
Sbjct  77   ANSQLAVFRPRVDEISLLTINTTNFFPDSYGGYMVAFAGRKYAARSLPAFVANNTFTVTS  136

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRL+NLYWKRDGC+SC G+S F CLN QDCA++TN+CKNRGGNVDCSLGIQ
Sbjct  137  FTLVLEFKKGRLENLYWKRDGCSSCSGNSNFVCLNDQDCAIRTNNCKNRGGNVDCSLGIQ  196

Query  616  LTFSGTDKHESVFNSWYEVK  675
            LTFSGTDKHESVFNSW+EVK
Sbjct  197  LTFSGTDKHESVFNSWFEVK  216



>ref|XP_011094218.1| PREDICTED: uncharacterized protein LOC105173973 [Sesamum indicum]
Length=242

 Score =   318 bits (814),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 176/199 (88%), Gaps = 6/199 (3%)
 Frame = +1

Query  85   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--  258
            +SSSDTNHVFSPC+D ++Q+SDGFTFGI FAAR A F N S    VQLSPCDRRLSL+  
Sbjct  22   DSSSDTNHVFSPCSDASIQRSDGFTFGIAFAARTAFFFNSS----VQLSPCDRRLSLSSA  77

Query  259  NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  438
            N+Q+AVFRPKVDEISLLT+NTS+FFPDSVGGYMVAFAGRKYA+RS PAFVAN +Y V+SF
Sbjct  78   NSQVAVFRPKVDEISLLTINTSNFFPDSVGGYMVAFAGRKYASRSIPAFVANSTYTVTSF  137

Query  439  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            TLV EFKKGRLQNLYWKRDGCASC G + F CLN QDCA++TN+C+NRGG VDCSLGIQL
Sbjct  138  TLVLEFKKGRLQNLYWKRDGCASCSGKTNFVCLNNQDCAIRTNNCRNRGGTVDCSLGIQL  197

Query  619  TFSGTDKHESVFNSWYEVK  675
             FSGTDKHE+VFNSWYEVK
Sbjct  198  AFSGTDKHEAVFNSWYEVK  216



>ref|XP_009608547.1| PREDICTED: uncharacterized protein LOC104102525 [Nicotiana tomentosiformis]
Length=246

 Score =   318 bits (814),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 174/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            +ES SDTNHV+ PCAD  VQ+SDGF+FGI FA RN+     + +  VQLSPCDRRLSL+ 
Sbjct  23   SESRSDTNHVYPPCADAKVQRSDGFSFGIAFAPRNSF--FINSSSSVQLSPCDRRLSLSS  80

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+QLA+FRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVAN ++ ++S
Sbjct  81   ANSQLALFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANSTFTITS  140

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRL+NLYWKRDGCASC G+S F CLN QDCA++TN+CKNRGG+VDCSLGIQ
Sbjct  141  FTLVLEFKKGRLENLYWKRDGCASCSGNSNFVCLNNQDCAIRTNNCKNRGGSVDCSLGIQ  200

Query  616  LTFSGTDKHESVFNSWYEVK  675
            LTFSGTDKHE VFNSWYEVK
Sbjct  201  LTFSGTDKHEMVFNSWYEVK  220



>ref|XP_007028015.1| Uncharacterized protein TCM_023045 [Theobroma cacao]
 gb|EOY08517.1| Uncharacterized protein TCM_023045 [Theobroma cacao]
Length=243

 Score =   313 bits (801),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 168/200 (84%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
             ESS DTNH ++PC+DT +Q SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYTPCSDTKIQLSDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  262  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            +  ++A+FRPKVDEISLLT+NTSSF PDSVGGYMVAFAGRKYAARS PAFVAN +Y V+S
Sbjct  78   SNSRVALFRPKVDEISLLTINTSSFSPDSVGGYMVAFAGRKYAARSLPAFVANNTYTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRLQNLYWKRDGCA C G S F CLN QDCA+ TN+CKN GG+VDCSLGIQ
Sbjct  138  FTLVLEFKKGRLQNLYWKRDGCAQCSGKSNFVCLNKQDCAISTNNCKNHGGSVDCSLGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH SV NSWYEV+
Sbjct  198  LAFSGTDKHLSVLNSWYEVE  217



>emb|CDP10582.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 176/200 (88%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            +ESSSDTN V+SPC+D  VQ+SDGFTF I FA+RN  F N+S    +QLSPCDRRLSL++
Sbjct  24   SESSSDTNSVYSPCSDAKVQRSDGFTFSIAFASRNNFFFNNS----LQLSPCDRRLSLSS  79

Query  262  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            +  Q+AVFRPKVDEISLL++NTS+FFPDS GGYMVAFAGRKYAARS PAFVANGSYIV+S
Sbjct  80   SNSQVAVFRPKVDEISLLSINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANGSYIVTS  139

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTL  EFKKGRLQNLYWKRDGC SC G+S F CLN QDCA++TNSCKNRGGNVDCSLGIQ
Sbjct  140  FTLALEFKKGRLQNLYWKRDGCTSCSGNSNFVCLNNQDCAIRTNSCKNRGGNVDCSLGIQ  199

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH++VFNSWYEVK
Sbjct  200  LAFSGTDKHDAVFNSWYEVK  219



>ref|XP_009368382.1| PREDICTED: uncharacterized protein LOC103957887 [Pyrus x bretschneideri]
Length=249

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 171/197 (87%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  264
            +++TN V+SPC DT +Q+SDGFTFGI FA++N+ F+N   N+  QLSPCDRRLSL++A  
Sbjct  29   AANTNSVYSPCLDTKIQRSDGFTFGIAFASKNSFFLNG--NQSHQLSPCDRRLSLSSAKS  86

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+K +SCKNRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKMSSCKNRGGSVDCSLGIQLAF  206

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  207  SGTDKHLSVLNSWYEVE  223



>ref|XP_008385577.1| PREDICTED: uncharacterized protein LOC103448116 [Malus domestica]
Length=248

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 172/197 (87%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            +++TN V+SPC+DT +Q+SDGFTFGI F+++N+ F+N   N+  QLSPCDRRLSL+  N+
Sbjct  29   AANTNSVYSPCSDTKIQRSDGFTFGIAFSSKNSFFLNG--NQSHQLSPCDRRLSLSSANS  86

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++GRLQNLYWKRDGCA C G+S F CLN QDCA+K +SCKNRGG+VDCSLGIQL F
Sbjct  147  VLEFQRGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKMSSCKNRGGSVDCSLGIQLAF  206

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  207  SGTDKHLSVLNSWYEVE  223



>gb|KJB16527.1| hypothetical protein B456_002G234200 [Gossypium raimondii]
Length=243

 Score =   310 bits (793),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 166/200 (83%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
             ESS DTNH + PC+DT VQ SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYLPCSDTKVQISDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  262  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            A  +LA+FRPKVDEISLLT+NTSSF PD VGGYMVAFAGRKYAARS PAFVANG+Y V+S
Sbjct  78   ANSRLALFRPKVDEISLLTINTSSFTPDVVGGYMVAFAGRKYAARSLPAFVANGTYTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRLQNL+WKRDGCA C G S F CLN QDCA+ TN+CKN GG+VDCS+GIQ
Sbjct  138  FTLVLEFKKGRLQNLFWKRDGCAQCSGRSNFVCLNKQDCAINTNNCKNHGGSVDCSIGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH S  NSWYEV+
Sbjct  198  LAFSGTDKHLSALNSWYEVE  217



>gb|KHG09254.1| hypothetical protein F383_15505 [Gossypium arboreum]
Length=243

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 166/200 (83%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
             ESS DTNH + PC+DT VQ SDGFTFGI FA+R + F N S    +QLSPCDRRLSL+N
Sbjct  22   VESSDDTNHAYLPCSDTKVQISDGFTFGIAFASRQSFFFNSS----LQLSPCDRRLSLSN  77

Query  262  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            A  +LA+FRPKVDEISLLT+NTSSF PD VGGYMVAFAGRKYAARS PAFVANG+Y V+S
Sbjct  78   ANSRLALFRPKVDEISLLTINTSSFTPDVVGGYMVAFAGRKYAARSRPAFVANGTYTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRLQNL+WKRDGCA C G S F CLN QDCA+ TN+CKN GG+VDCS+GIQ
Sbjct  138  FTLVLEFKKGRLQNLFWKRDGCAQCSGRSNFVCLNKQDCAINTNNCKNHGGSVDCSIGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH S  NSWYEV+
Sbjct  198  LAFSGTDKHLSALNSWYEVE  217



>ref|XP_011077792.1| PREDICTED: uncharacterized protein LOC105161704 [Sesamum indicum]
Length=243

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 173/196 (88%), Gaps = 6/196 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  267
            SD+N V+SPCAD ++Q+SDGFTFGI FAAR A F N+S    VQLSPCD RLSL+  N+Q
Sbjct  26   SDSNDVYSPCADASIQRSDGFTFGIAFAARTAFFFNNS----VQLSPCDHRLSLSSANSQ  81

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            +AVFRPKVDEISLLT+NTS+FFPDSVGGYMVAFAGR+YAARS PAFVAN +Y ++SFTLV
Sbjct  82   VAVFRPKVDEISLLTINTSNFFPDSVGGYMVAFAGRRYAARSIPAFVANNTYTITSFTLV  141

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EFKKGRLQNLYWKRDGCASC G S F CLN QDCA++TN+CKNRGG+VDCS+GIQL FS
Sbjct  142  HEFKKGRLQNLYWKRDGCASCSGKSNFVCLNNQDCAIRTNNCKNRGGSVDCSIGIQLAFS  201

Query  628  GTDKHESVFNSWYEVK  675
            GTDKHE+VFNSWYEVK
Sbjct  202  GTDKHEAVFNSWYEVK  217



>ref|XP_004249401.2| PREDICTED: uncharacterized protein LOC101246776 [Solanum lycopersicum]
Length=243

 Score =   306 bits (783),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 172/195 (88%), Gaps = 6/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL--  270
            DTNHV+SPCAD  VQ+SDGF+FGI F++R + F+N S    VQLSPCD+RLSL+++    
Sbjct  27   DTNHVYSPCADAKVQRSDGFSFGIAFSSRTSFFVNSS----VQLSPCDKRLSLSSSNSQL  82

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+NTS+FFPDS GGYMVAFAGRKYAARS PAFVAN ++ V+SFTLV 
Sbjct  83   AVFRPKVDEISLLTINTSNFFPDSYGGYMVAFAGRKYAARSLPAFVANSTFTVTSFTLVH  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFKKGRL+NLYWKRDGC+SC G+S F CLNGQDCA++TN+CKNRGGNVDCSLGIQLTFSG
Sbjct  143  EFKKGRLENLYWKRDGCSSCSGNSNFVCLNGQDCAIRTNNCKNRGGNVDCSLGIQLTFSG  202

Query  631  TDKHESVFNSWYEVK  675
            TDKH SVFNSW+EVK
Sbjct  203  TDKHASVFNSWFEVK  217



>ref|XP_010058958.1| PREDICTED: uncharacterized protein LOC104446855 [Eucalyptus grandis]
 gb|KCW90433.1| hypothetical protein EUGRSUZ_A02567 [Eucalyptus grandis]
Length=253

 Score =   306 bits (783),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 169/199 (85%), Gaps = 6/199 (3%)
 Frame = +1

Query  85   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA  264
            ES++DTN V+SPCADTTVQ+SDGFTFGI FA R + F N S    ++LSPCDRRLSL++A
Sbjct  33   ESAADTNRVYSPCADTTVQRSDGFTFGIAFAPRLSFFHNGS----LELSPCDRRLSLSSA  88

Query  265  --QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  438
              Q+A FRPKVDEISLLT+NTSSF P + GGYMVAFAGRKYAARS P+FVAN +Y V+SF
Sbjct  89   TSQVATFRPKVDEISLLTINTSSFSPANYGGYMVAFAGRKYAARSLPSFVANSTYTVTSF  148

Query  439  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            TLV EFKKGRLQNLYWKRDGCASC G S F CLN QDCA+KT++CKN GG VDCSLGIQL
Sbjct  149  TLVLEFKKGRLQNLYWKRDGCASCSGKSNFVCLNNQDCAIKTSNCKNHGGAVDCSLGIQL  208

Query  619  TFSGTDKHESVFNSWYEVK  675
             FSGTDKH SVFNSWYEV+
Sbjct  209  AFSGTDKHFSVFNSWYEVE  227



>gb|KDP36093.1| hypothetical protein JCGZ_08737 [Jatropha curcas]
Length=246

 Score =   305 bits (780),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 165/197 (84%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            S +TNHV++PCAD  VQ+SDGFTF I FA+R A F N+  N  +QLSPCD RLSL+  N+
Sbjct  26   SDNTNHVYNPCADAKVQRSDGFTFAIAFASRTAFFYNN--NGSLQLSPCDSRLSLSSQNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
              EFKKGRLQNLYWKRDGCA C G++ F CLN QDCA++TNSCKN GG VDCSLGIQL F
Sbjct  144  ALEFKKGRLQNLYWKRDGCAKCTGTNNFVCLNNQDCAIRTNSCKNHGGTVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH +V NSWYEV+
Sbjct  204  SGTDKHLAVLNSWYEVE  220



>ref|XP_004140172.1| PREDICTED: uncharacterized protein LOC101221211 [Cucumis sativus]
 ref|XP_004168664.1| PREDICTED: uncharacterized LOC101221211 [Cucumis sativus]
 gb|KGN48055.1| hypothetical protein Csa_6G426900 [Cucumis sativus]
Length=262

 Score =   305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 170/199 (85%), Gaps = 8/199 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            +++TN+V+ PCADT +Q+SDGFTFGI F++R++ F N S     QLSPCDRRLSL   N+
Sbjct  42   AANTNNVYQPCADTKIQRSDGFTFGIAFSSRDSFFANQSH----QLSPCDRRLSLASLNS  97

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRP+VD+ISLL++NTS FFPD+ GGYMVAFAGRKYAARS PAFVAN ++IV+SFTL
Sbjct  98   QLAVFRPRVDQISLLSINTSDFFPDAFGGYMVAFAGRKYAARSQPAFVANSTFIVTSFTL  157

Query  445  VFEFKKGRLQNLYWKRDGCASCKGS--SGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            V EF+KGRLQNLYWKRDGCASC G   S + CLN QDCA++T+SC+NRGGNVDCSLGIQL
Sbjct  158  VLEFQKGRLQNLYWKRDGCASCSGKSRSSYVCLNNQDCAIRTSSCRNRGGNVDCSLGIQL  217

Query  619  TFSGTDKHESVFNSWYEVK  675
            TFSGTDKH S  NSWYEVK
Sbjct  218  TFSGTDKHLSALNSWYEVK  236



>ref|XP_010514756.1| PREDICTED: uncharacterized protein LOC104790674 [Camelina sativa]
Length=258

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 168/196 (86%), Gaps = 6/196 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  156

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL FS
Sbjct  157  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKGRGGTVDCSLGIQLAFS  216

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH  V NSWYEV+
Sbjct  217  GTDKHLRVLNSWYEVE  232



>ref|XP_009121178.1| PREDICTED: uncharacterized protein LOC103846006 [Brassica rapa]
 ref|XP_009123290.1| PREDICTED: uncharacterized protein LOC103848053 [Brassica rapa]
Length=274

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+QL
Sbjct  58   NTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAAMNSQL  113

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN +Y V+SFTLV 
Sbjct  114  SIFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTYTVTSFTLVM  173

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T SCK RGG VDCSLGIQL FSG
Sbjct  174  EFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSG  233

Query  631  TDKHESVFNSWYEVK  675
            TDKH +V NSWYEV+
Sbjct  234  TDKHLAVLNSWYEVE  248



>ref|XP_010503072.1| PREDICTED: uncharacterized protein LOC104780270 isoform X1 [Camelina 
sativa]
Length=258

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 168/196 (86%), Gaps = 6/196 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  156

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL FS
Sbjct  157  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKVRGGTVDCSLGIQLAFS  216

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH  V NSWYEV+
Sbjct  217  GTDKHLRVLNSWYEVE  232



>ref|XP_008449601.1| PREDICTED: uncharacterized protein LOC103491438 [Cucumis melo]
Length=250

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 8/199 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            +++TN+V+ PCADT +Q+SDGFTFGI F++R++ F N S     QLSPCDRRLSL   N+
Sbjct  30   AANTNNVYQPCADTKIQRSDGFTFGIAFSSRDSFFSNQSH----QLSPCDRRLSLASLNS  85

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRP+VD+ISLL++NTS FFPD+ GGYMVAFAGRKYAARS PAFVAN ++IV+SFTL
Sbjct  86   QLAVFRPRVDQISLLSINTSDFFPDAFGGYMVAFAGRKYAARSQPAFVANNTFIVTSFTL  145

Query  445  VFEFKKGRLQNLYWKRDGCASCKGS--SGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            V EF+KGRLQNLYWKRDGCASC G   S + CLN QDCA++T+SC+NRGGNVDCSLGIQL
Sbjct  146  VLEFQKGRLQNLYWKRDGCASCSGKSRSSYVCLNNQDCAIRTSSCRNRGGNVDCSLGIQL  205

Query  619  TFSGTDKHESVFNSWYEVK  675
            TFSGTDKH +  NSWYEVK
Sbjct  206  TFSGTDKHLAALNSWYEVK  224



>ref|XP_006291737.1| hypothetical protein CARUB_v10017907mg [Capsella rubella]
 gb|EOA24635.1| hypothetical protein CARUB_v10017907mg [Capsella rubella]
Length=250

 Score =   303 bits (775),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 169/196 (86%), Gaps = 6/196 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            ++TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  33   TNTNHIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  88

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  89   LSLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  148

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL FS
Sbjct  149  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFS  208

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH +V NSWYEV+
Sbjct  209  GTDKHLAVLNSWYEVE  224



>ref|XP_010496864.1| PREDICTED: uncharacterized protein LOC104773893 [Camelina sativa]
Length=255

 Score =   303 bits (775),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 168/196 (86%), Gaps = 6/196 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            S+TNH++SPC+DT +Q+SDGFTFGI F++R++ F+N +    V LSPCDRRL+L   N+Q
Sbjct  38   SNTNHIYSPCSDTRIQRSDGFTFGIAFSSRSSFFLNQT----VLLSPCDRRLTLAAMNSQ  93

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L++FRPKVDEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  94   LSIFRPKVDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  153

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK  GG VDCSLGIQL FS
Sbjct  154  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKGHGGTVDCSLGIQLAFS  213

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH  V NSWYEV+
Sbjct  214  GTDKHLRVLNSWYEVE  229



>emb|CDY55301.1| BnaA06g38910D [Brassica napus]
Length=239

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+QL
Sbjct  23   NTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAAMNSQL  78

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN ++ V+SFTLV 
Sbjct  79   SLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTFTVTSFTLVM  138

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T SCK RGG VDCSLGIQL FSG
Sbjct  139  EFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSG  198

Query  631  TDKHESVFNSWYEVK  675
            TDKH +V NSWYEV+
Sbjct  199  TDKHLAVLNSWYEVE  213



>emb|CDX87939.1| BnaC03g54570D [Brassica napus]
Length=243

 Score =   301 bits (770),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 169/200 (85%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A    +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L  
Sbjct  22   AALGGNTNNVYSPCSDTRIQRSDGFTFGIAFSSRASFFLNQT----VLLSPCDRRLTLAA  77

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+QL++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN +Y V+S
Sbjct  78   MNSQLSIFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANSTYTVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRLQNL+WKRDGCASCKG+S F CLN QDCA++T SCK RGG VDCSLGIQ
Sbjct  138  FTLVMEFQKGRLQNLFWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTD H +V NSWYEV+
Sbjct  198  LAFSGTDTHLAVLNSWYEVE  217



>ref|XP_011046438.1| PREDICTED: uncharacterized protein LOC105141047 [Populus euphratica]
Length=246

 Score =   300 bits (769),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S +TNHV+SPCADTTVQ SDGFTF I F++RNA F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRNAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+SCK  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  204  SGTDKHFSALNSWYEVE  220



>ref|XP_011042566.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
 ref|XP_011042567.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
 ref|XP_011042568.1| PREDICTED: uncharacterized protein LOC105138225 [Populus euphratica]
Length=244

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S DTN VFSPC DTTVQ+SDGFTF I F++R + F N S     QLSPCDRRL+L   N+
Sbjct  26   SEDTNKVFSPCLDTTVQESDGFTFAIAFSSRTSFFFNSSH----QLSPCDRRLALTGQNS  81

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF+P++ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  82   QISVFRPKVDEISLLTINTSSFYPENYGGYMVAFAGRKYAARSLPAFVANNTYTVTSFTL  141

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T  CK+ GG+VDCSLGIQL F
Sbjct  142  VLEFKKGRLQNLYWKRDGCAKCSGNSNFVCLNNQDCAIRTALCKSNGGSVDCSLGIQLAF  201

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  202  SGTDKHFSALNSWYEVE  218



>ref|XP_011035616.1| PREDICTED: uncharacterized protein LOC105133355 isoform X2 [Populus 
euphratica]
Length=246

 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S +TNHV+SPCADTTVQ SDGFTF I F++R A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRTAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF P + GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPQNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+SCK  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  204  SGTDKHFSALNSWYEVE  220



>ref|XP_003538086.1| PREDICTED: uncharacterized protein LOC100814491 [Glycine max]
 gb|KHN30243.1| hypothetical protein glysoja_045628 [Glycine soja]
Length=240

 Score =   300 bits (767),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 168/196 (86%), Gaps = 4/196 (2%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  267
            ++TN+V+ PCAD  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  N+Q
Sbjct  21   TNTNNVYQPCADARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSFSNSQ  78

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRP+VDEISLLT+NTSSFFPDS GGYMVAFAGRKYAARSP AFVAN +Y V+SFTLV
Sbjct  79   LALFRPRVDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSPLAFVANSTYTVTSFTLV  138

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++GRLQN YWKRDGC+SCK  S F CLN QDCA++T+SCK RGG VDCSLGIQL FS
Sbjct  139  LEFQRGRLQNFYWKRDGCSSCKEKSNFICLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  198

Query  628  GTDKHESVFNSWYEVK  675
            GTD+H  V NSW+EV+
Sbjct  199  GTDRHLRVLNSWFEVE  214



>ref|XP_010535718.1| PREDICTED: uncharacterized protein LOC104810937 [Tarenaya hassleriana]
Length=250

 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  270
            +TN V+SPC+D  +Q+SDGF+FGI F++R + F+N++    V LSPCDRRL L+  NAQ 
Sbjct  34   NTNGVYSPCSDARIQRSDGFSFGIAFSSRQSFFLNET----VLLSPCDRRLGLSAMNAQF  89

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            A+FRPKVDEISLL+VNTS FFPD+ GGYMVAFAGRKYAARSPPAFVAN +YIV+SFTLVF
Sbjct  90   ALFRPKVDEISLLSVNTSDFFPDNYGGYMVAFAGRKYAARSPPAFVANSTYIVTSFTLVF  149

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KGRL NLYWKRDGC+SCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL FSG
Sbjct  150  EFQKGRLNNLYWKRDGCSSCKGNPSFVCLNNQDCAIRTPSCKGRGGPVDCSLGIQLAFSG  209

Query  631  TDKHESVFNSWYEVK  675
            TDKH SV NSWYEV+
Sbjct  210  TDKHLSVLNSWYEVE  224



>ref|XP_010247701.1| PREDICTED: uncharacterized protein LOC104590673 [Nelumbo nucifera]
Length=240

 Score =   300 bits (767),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 8/198 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  264
            +SDTN  F PC+DT +Q+SDGFTFGI FA+R++ F N S+    QLSPCDRRL L+++  
Sbjct  22   ASDTNRAFQPCSDTKIQRSDGFTFGIAFASRSSFFYNSSQ----QLSPCDRRLGLSSSSS  77

Query  265  QLAVFRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            QLAVFRPKVDEISLLT+NT+S FFP++ G YMVAFAGRKYAARSPPAFVAN +Y+V+SFT
Sbjct  78   QLAVFRPKVDEISLLTINTTSNFFPENYG-YMVAFAGRKYAARSPPAFVANSTYMVTSFT  136

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRLQNLYWKRDGCASC G S F CLN QDCA+ TNSCK RGG+ DCSLGIQL 
Sbjct  137  LVLEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKQDCAIGTNSCKGRGGSADCSLGIQLA  196

Query  622  FSGTDKHESVFNSWYEVK  675
            FSGTDKHE+V NSWYEVK
Sbjct  197  FSGTDKHEAVLNSWYEVK  214



>ref|XP_002322773.1| hypothetical protein POPTR_0016s06840g [Populus trichocarpa]
 gb|EEF04534.1| hypothetical protein POPTR_0016s06840g [Populus trichocarpa]
Length=244

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 164/197 (83%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S DTN VFSPC DTTVQ SDGFTF I F++R + F N S    +QLSPCDRRL+L   N+
Sbjct  26   SEDTNKVFSPCLDTTVQVSDGFTFAIAFSSRTSFFFNSS----LQLSPCDRRLALTGQNS  81

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF+P++ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  82   QISVFRPKVDEISLLTINTSSFYPENYGGYMVAFAGRKYAARSLPAFVANNTYSVTSFTL  141

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+ CK+ GG+VDCSLGIQL F
Sbjct  142  VLEFKKGRLQNLYWKRDGCAKCSGNSNFVCLNNQDCAIRTSLCKSNGGSVDCSLGIQLAF  201

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  202  SGTDKHFSALNSWYEVE  218



>gb|KFK33866.1| hypothetical protein AALP_AA5G070300 [Arabis alpina]
Length=243

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A +  +TN+V+SPC+DT +Q+SDGFTFGI F++R + F+N +    + LSPCD RLSL  
Sbjct  22   ALTGGNTNNVYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----LLLSPCDHRLSLAA  77

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             N+Q ++FRPK+DEISLL++NTSSFFPDS GGYMVAFAGRKYAARSPPAF+AN +YIV+S
Sbjct  78   INSQFSLFRPKIDEISLLSINTSSFFPDSYGGYMVAFAGRKYAARSPPAFIANSTYIVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRLQN +WKRDGCASCKG+  F CLN QDCA+ T SCK RGG VDCSLGIQ
Sbjct  138  FTLVMEFQKGRLQNFFWKRDGCASCKGNPNFVCLNKQDCAISTPSCKGRGGTVDCSLGIQ  197

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH +V NSWYEV+
Sbjct  198  LAFSGTDKHLAVLNSWYEVE  217



>ref|NP_190001.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38812.1| unknown protein [Arabidopsis thaliana]
 gb|AAN12895.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77869.1| uncharacterized protein AT3G44150 [Arabidopsis thaliana]
Length=246

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct  28   SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTL
Sbjct  84   QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL F
Sbjct  144  VMEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH +V NSWYEV+
Sbjct  204  SGTDKHLAVLNSWYEVE  220



>ref|XP_011035615.1| PREDICTED: uncharacterized protein LOC105133355 isoform X1 [Populus 
euphratica]
Length=246

 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 162/197 (82%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S +TNHV+SPCADTTVQ SDGFTF I F++R A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSRTAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+SCK  GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCKKNGGSVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  204  SGTDKHFSALNSWYEVE  220



>ref|XP_002875644.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51903.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 168/195 (86%), Gaps = 6/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            +TN+++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRLSL   N+Q 
Sbjct  36   NTNNIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLSLAAMNSQF  91

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV 
Sbjct  92   SLFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLVM  151

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG+VDCSLGIQL FSG
Sbjct  152  EFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGSVDCSLGIQLAFSG  211

Query  631  TDKHESVFNSWYEVK  675
            TDKH +V NSWYEV+
Sbjct  212  TDKHLAVLNSWYEVE  226



>gb|KHN21200.1| hypothetical protein glysoja_006679 [Glycine soja]
Length=233

 Score =   298 bits (762),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  267
            ++TN V+ PC+D  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  NAQ
Sbjct  14   TNTNSVYHPCSDARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSSSNAQ  71

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRP+VDEISLLT+NTSSFFPD+ GGYMVAFAG+KYAARSP AFVAN +Y V+SFTLV
Sbjct  72   LALFRPRVDEISLLTINTSSFFPDNYGGYMVAFAGKKYAARSPLAFVANSTYTVTSFTLV  131

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++GRL NLYWKRDGC+SCKG S   CLN QDCA++T+SCK RGG VDCSLGIQL FS
Sbjct  132  LEFQRGRLHNLYWKRDGCSSCKGKSNLVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  191

Query  628  GTDKHESVFNSWYEVK  675
            GTD+H  V NSW+EV+
Sbjct  192  GTDRHLRVLNSWFEVE  207



>ref|NP_001240927.1| uncharacterized protein LOC100818051 precursor [Glycine max]
 gb|ACU22975.1| unknown [Glycine max]
Length=242

 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 167/196 (85%), Gaps = 4/196 (2%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQ  267
            ++TN V+ PC+D  +Q+SDGFTFGI F++R++ F N  +N+ +QLSPCDRRLSL+  NAQ
Sbjct  23   TNTNSVYHPCSDARIQRSDGFTFGIAFSSRDSFFYN--QNQSLQLSPCDRRLSLSSSNAQ  80

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRP+VDEISLLT+NTSSFFPD+ GGYMVAFAG+KYAARSP AFVAN +Y V+SFTLV
Sbjct  81   LALFRPRVDEISLLTINTSSFFPDNYGGYMVAFAGKKYAARSPLAFVANSTYTVTSFTLV  140

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++GRL NLYWKRDGC+SCKG S   CLN QDCA++T+SCK RGG VDCSLGIQL FS
Sbjct  141  LEFQRGRLHNLYWKRDGCSSCKGKSNLVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAFS  200

Query  628  GTDKHESVFNSWYEVK  675
            GTD+H  V NSW+EV+
Sbjct  201  GTDRHLRVLNSWFEVE  216



>ref|XP_006404508.1| hypothetical protein EUTSA_v10010660mg [Eutrema salsugineum]
 gb|ESQ45961.1| hypothetical protein EUTSA_v10010660mg [Eutrema salsugineum]
Length=251

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 7/191 (4%)
 Frame = +1

Query  109  VFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQLAVFR  282
            V+SPC+DT +Q+SDGFTFGI F++R + F+N +      LSPCDRRLSL   N+QL+VFR
Sbjct  40   VYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQTV-----LSPCDRRLSLAAMNSQLSVFR  94

Query  283  PKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKK  462
            PK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARSPPAF+AN ++ V+SFTLV EF+K
Sbjct  95   PKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSPPAFIANTTFTVTSFTLVMEFQK  154

Query  463  GRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKH  642
            GRLQNLYWKRDGCASCKG+S F CLN QDCA++T SCK RGG VDCSLGIQL FSGTDKH
Sbjct  155  GRLQNLYWKRDGCASCKGNSNFVCLNKQDCAIRTPSCKGRGGTVDCSLGIQLAFSGTDKH  214

Query  643  ESVFNSWYEVK  675
             +V NSWYEV+
Sbjct  215  LAVLNSWYEVE  225



>ref|XP_007145779.1| hypothetical protein PHAVU_007G267000g [Phaseolus vulgaris]
 gb|ESW17773.1| hypothetical protein PHAVU_007G267000g [Phaseolus vulgaris]
Length=243

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 164/195 (84%), Gaps = 5/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  270
            D N VFSPC DT VQ+SDGFTFGIVFA ++  F+N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DNNRVFSPCTDTQVQRSDGFTFGIVFAPKDKFFLNN--NSSVQLSPCDTRLSLSNSNYQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            +VFRPKVDEISLLTVN+SSF  D+ G YMVAFAGRKYAARSPPAFVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLTVNSSSFTADTYG-YMVAFAGRKYAARSPPAFVANGTYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFKKGRLQNLYWKRDGCA C  +S   CLN QDCA++T+SCK+ GG VDCS+GIQL FSG
Sbjct  143  EFKKGRLQNLYWKRDGCAKCSSNSKAVCLNNQDCALQTSSCKSHGGTVDCSIGIQLAFSG  202

Query  631  TDKHESVFNSWYEVK  675
            TDKH +VFNSWYEVK
Sbjct  203  TDKHLAVFNSWYEVK  217



>gb|KHF98050.1| hypothetical protein F383_37453 [Gossypium arboreum]
Length=239

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 163/200 (82%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
             ESS D N+ ++PC+DTTVQ SDGFTFGI F +R + F + S     QLSPCDRRLSL+N
Sbjct  18   VESSDDMNNAYTPCSDTTVQLSDGFTFGIAFGSRQSFFFDSS----FQLSPCDRRLSLSN  73

Query  262  AQ--LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            +   +A+FRPKVDEISLLT+N SSF PDSVGGYMVAF+GRKYAARS PAFVAN SY V+S
Sbjct  74   SNSPVALFRPKVDEISLLTINVSSFSPDSVGGYMVAFSGRKYAARSLPAFVANSSYTVTS  133

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EFKKGRLQNL+WKRDGCA C G+S F CLN Q+CA+ T+SCKN GG+VDCSLGIQ
Sbjct  134  FTLVLEFKKGRLQNLFWKRDGCAQCSGNSNFVCLNKQNCAINTSSCKNHGGSVDCSLGIQ  193

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH S  NSWYE +
Sbjct  194  LAFSGTDKHLSALNSWYEAE  213



>ref|XP_004497641.1| PREDICTED: uncharacterized protein LOC101499989 isoform X1 [Cicer 
arietinum]
Length=243

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 5/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  270
            DTN+VFSPC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DTNNVFSPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNSNSQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAFVANGSY V+SFTLV 
Sbjct  84   SLFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGRKYAARSPPAFVANGSYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFKKGRLQNLYWKRDGCA C  ++   CLN QDCA++T+SCK+ GG VDCSLGIQL FSG
Sbjct  143  EFKKGRLQNLYWKRDGCAKCPKNTKAVCLNNQDCALQTSSCKSHGGPVDCSLGIQLAFSG  202

Query  631  TDKHESVFNSWYEVK  675
            TDKH S  NSWYEVK
Sbjct  203  TDKHLSALNSWYEVK  217



>ref|XP_002309260.1| hypothetical protein POPTR_0006s21620g [Populus trichocarpa]
 gb|EEE92783.1| hypothetical protein POPTR_0006s21620g [Populus trichocarpa]
Length=246

 Score =   293 bits (750),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 160/197 (81%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            S +TNHV+SPCADTTVQ SDGFTF I F++  A F N +    +QLSPCD RLSL   N+
Sbjct  28   SDNTNHVYSPCADTTVQVSDGFTFSIAFSSSKAFFFNST----LQLSPCDSRLSLTSQNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q++VFRPKVDEISLLT+NTSSF P   GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  84   QISVFRPKVDEISLLTINTSSFSPGDFGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  143

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKGRLQNLYWKRDGCA C G+S F CLN QDCA++T+SC   GG+VDCSLGIQL F
Sbjct  144  VLEFKKGRLQNLYWKRDGCAKCSGNSKFVCLNNQDCAIRTSSCIKNGGSVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  204  SGTDKHFSALNSWYEVE  220



>ref|XP_010106982.1| hypothetical protein L484_016911 [Morus notabilis]
 gb|EXC12980.1| hypothetical protein L484_016911 [Morus notabilis]
Length=246

 Score =   292 bits (747),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 165/197 (84%), Gaps = 8/197 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN V+SPC+D+ V+ SDGFTFGI FA+R+ +F N +K+   QLSPCD RL L  +NAQ+
Sbjct  28   DTNRVYSPCSDSKVEISDGFTFGITFASRD-SFFNGNKS---QLSPCDSRLGLRNSNAQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+NTSSFFP++ GGYMVAFAGRKYAARSP AFVAN +Y VSSFTLV 
Sbjct  84   AVFRPKVDEISLLTINTSSFFPENYGGYMVAFAGRKYAARSPLAFVANNTYTVSSFTLVL  143

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNR--GGNVDCSLGIQLTF  624
            EFKKGRLQNL+WKRDGCA C+  S F CLN QDCA+KT+SCKN   GG+VDCSLGIQL F
Sbjct  144  EFKKGRLQNLFWKRDGCAKCQSGSSFVCLNKQDCAIKTSSCKNHASGGSVDCSLGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH S  NSWYEV+
Sbjct  204  SGTDKHLSALNSWYEVE  220



>ref|XP_002524077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38287.1| conserved hypothetical protein [Ricinus communis]
Length=243

 Score =   292 bits (747),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 172/219 (79%), Gaps = 4/219 (2%)
 Frame = +1

Query  25   MARPSAilsllifptlfllAESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFIND  204
            MA  +AI+ +++     +L   S D NHV+SPC DT VQ+ DGFTF I FAARNA F N+
Sbjct  1    MAATTAIILVVVALASSVLIVESGDNNHVYSPCGDTKVQREDGFTFAIAFAARNAFFYNN  60

Query  205  SKNKDVQLSPCDRRLSLNNAQLA--VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRK  378
              N  +QLSPCD RLSL++      VFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRK
Sbjct  61   --NNSLQLSPCDSRLSLSSQSSQISVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRK  118

Query  379  YAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAM  558
            YAARS PAFVAN +Y V+SFTLV EFKKGRLQNLYWKRDGC+ C GS+ F CLN QDCA+
Sbjct  119  YAARSLPAFVANTTYTVTSFTLVLEFKKGRLQNLYWKRDGCSKCSGSNNFVCLNNQDCAI  178

Query  559  KTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEVK  675
            +T+SCKN GG VDCSLGIQL FSGTDKH SV NSWYEV+
Sbjct  179  RTSSCKNHGGTVDCSLGIQLAFSGTDKHLSVLNSWYEVE  217



>ref|XP_007202487.1| hypothetical protein PRUPE_ppa010561mg [Prunus persica]
 gb|EMJ03686.1| hypothetical protein PRUPE_ppa010561mg [Prunus persica]
Length=245

 Score =   292 bits (747),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 7/196 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQ  267
            S+ NHV+SPCADT V++SDGFTFGI FA+R++ F    +N  VQLSPCD RLSL+N  +Q
Sbjct  29   SNNNHVYSPCADTKVERSDGFTFGIAFASRDSFF----RNGSVQLSPCDSRLSLSNGNSQ  84

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            ++VFRPKVDEISLL+VN+SSF  DS G YMVAFAGRKYAARS PAFVAN +Y V+SFTLV
Sbjct  85   ISVFRPKVDEISLLSVNSSSFTADSYG-YMVAFAGRKYAARSIPAFVANATYTVTSFTLV  143

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF KGRLQNLYWKRDGC+ C GS+G  CLN QDCA KT+SCK  GG+VDCSLGIQL FS
Sbjct  144  LEFNKGRLQNLYWKRDGCSKCSGSTGLVCLNNQDCAFKTSSCKTHGGSVDCSLGIQLAFS  203

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH SV NSWYEV+
Sbjct  204  GTDKHLSVLNSWYEVE  219



>ref|XP_004303412.1| PREDICTED: uncharacterized protein LOC101306356 [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  270
            D N V+SPC+DT V +SDGF+FGI FA+++  F+ +  N   QLSPCD RLSL+  N+Q+
Sbjct  26   DNNRVYSPCSDTKVARSDGFSFGIAFASKDV-FLRNGANSTSQLSPCDTRLSLSSANSQI  84

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLL+VN+SSF PD+ GGYMVAFAG KYAARS  AFVAN +Y V+SFTLV 
Sbjct  85   AVFRPKVDEISLLSVNSSSFAPDNYGGYMVAFAGHKYAARSTAAFVANSTYTVTSFTLVL  144

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNLYWKRDGCA C G+S F CLN QDCA+KTNSCK+ GG VDCSLGIQL FSG
Sbjct  145  EFTKGRLQNLYWKRDGCAKCSGNSSFVCLNNQDCAIKTNSCKSHGGTVDCSLGIQLAFSG  204

Query  631  TDKHESVFNSWYEVK  675
            TDKH SV NSWYEV+
Sbjct  205  TDKHLSVLNSWYEVQ  219



>ref|XP_006481617.1| PREDICTED: uncharacterized protein LOC102630770 [Citrus sinensis]
Length=239

 Score =   290 bits (741),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 168/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  264
            SSD NH++SPC DT V++SDGFTF I FA+R++ F+N+S+    QLSPCDRRLSL+++  
Sbjct  21   SSDNNHMYSPCGDTKVERSDGFTFAIAFASRSSFFLNNSQ----QLSPCDRRLSLSSSTS  76

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  77   QIAVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  136

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
              EFKKGRLQNLYWKRDGC+ C G+S F CLN QDCA+++ SCKN GG+VDCSLGIQL F
Sbjct  137  ALEFKKGRLQNLYWKRDGCSKCSGNSNFVCLNNQDCAIRSTSCKNHGGSVDCSLGIQLAF  196

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  197  SGTDKHLSVLNSWYEVE  213



>ref|XP_006430044.1| hypothetical protein CICLE_v10012616mg [Citrus clementina]
 gb|ESR43284.1| hypothetical protein CICLE_v10012616mg [Citrus clementina]
 gb|KDO70650.1| hypothetical protein CISIN_1g026374mg [Citrus sinensis]
Length=239

 Score =   290 bits (741),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 168/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--  264
            SSD NH++SPC DT V++SDGFTF I FA+R++ F+N+S+    QLSPCDRRLSL+++  
Sbjct  21   SSDNNHMYSPCGDTKVERSDGFTFAIAFASRSSFFLNNSQ----QLSPCDRRLSLSSSTS  76

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+SFTL
Sbjct  77   QIAVFRPKVDEISLLTINTSSFSPDNYGGYMVAFAGRKYAARSLPAFVANSTYTVTSFTL  136

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
              EFKKGRLQNLYWKRDGC+ C G+S F CLN QDCA+++ SCKN GG+VDCSLGIQL F
Sbjct  137  ALEFKKGRLQNLYWKRDGCSKCSGNSNFVCLNNQDCAIRSTSCKNHGGSVDCSLGIQLAF  196

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  197  SGTDKHLSVLNSWYEVE  213



>ref|XP_004497642.1| PREDICTED: uncharacterized protein LOC101499989 isoform X2 [Cicer 
arietinum]
Length=241

 Score =   289 bits (739),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 162/195 (83%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  270
            DTN+VFSPC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+N+  Q+
Sbjct  26   DTNNVFSPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNSNSQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAFVANGSY V+SFTLV 
Sbjct  84   SLFRPKVDEISLLTVNSSSF--DSYG-YMVAFAGRKYAARSPPAFVANGSYTVTSFTLVL  140

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFKKGRLQNLYWKRDGCA C  ++   CLN QDCA++T+SCK+ GG VDCSLGIQL FSG
Sbjct  141  EFKKGRLQNLYWKRDGCAKCPKNTKAVCLNNQDCALQTSSCKSHGGPVDCSLGIQLAFSG  200

Query  631  TDKHESVFNSWYEVK  675
            TDKH S  NSWYEVK
Sbjct  201  TDKHLSALNSWYEVK  215



>ref|XP_007132505.1| hypothetical protein PHAVU_011G099900g [Phaseolus vulgaris]
 gb|ESW04499.1| hypothetical protein PHAVU_011G099900g [Phaseolus vulgaris]
Length=239

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            +++TN V+ PCAD+ +Q+SDGFTFGI F++R++ F N S    +QLSPCD RLSL+++  
Sbjct  21   ATNTNSVYQPCADSKIQRSDGFTFGIAFSSRDSFFFNQS----LQLSPCDHRLSLSSSNS  76

Query  271  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
             +  FRPKVDEISLLT+NTSSFFPD+ GGYMVAFAGRKYAARSP AFVAN +Y V+SFTL
Sbjct  77   QLALFRPKVDEISLLTINTSSFFPDTYGGYMVAFAGRKYAARSPLAFVANSTYTVTSFTL  136

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGC+SCKG+S F CLN QDCA++T+SCK RGG VDCSLGIQL F
Sbjct  137  VLEFQKGRLQNLYWKRDGCSSCKGNSNFVCLNKQDCAIRTSSCKGRGGAVDCSLGIQLAF  196

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  197  SGTDKHLSVLNSWYEVE  213



>ref|XP_009336403.1| PREDICTED: uncharacterized protein LOC103928991 [Pyrus x bretschneideri]
Length=249

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 167/197 (85%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            +S+TN V++PCADT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  29   ASNTNSVYNPCADTKIQRSDGFTFGIAFSSKTSFTLNG--NQSHQLSPCDRRLSLSSSNS  86

Query  271  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  146

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA++T+ CKNRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIETSGCKNRGGSVDCSLGIQLAF  206

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  207  SGTDKHLSVLNSWYEVE  223



>ref|XP_009336402.1| PREDICTED: uncharacterized protein LOC103928990 [Pyrus x bretschneideri]
Length=230

 Score =   286 bits (733),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 167/197 (85%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            +S+TN V++PCADT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  10   ASNTNSVYNPCADTKIQRSDGFTFGIAFSSKTSFTLNG--NQSHQLSPCDRRLSLSSSNS  67

Query  271  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  68   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVANSTYIVTSFTL  127

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA++T+ CKNRGG+VDCSLGIQL F
Sbjct  128  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIETSGCKNRGGSVDCSLGIQLAF  187

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  188  SGTDKHLSVLNSWYEVE  204



>ref|XP_007015648.1| Uncharacterized protein TCM_041214 [Theobroma cacao]
 gb|EOY33267.1| Uncharacterized protein TCM_041214 [Theobroma cacao]
Length=247

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 165/199 (83%), Gaps = 6/199 (3%)
 Frame = +1

Query  85   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA  264
            ++S++T  V+ PC+DT VQ SD FTFGI F++R++   N S     QLSPCDRRLSL++ 
Sbjct  27   KASTNTKGVYQPCSDTKVQISDEFTFGIAFSSRDSFLFNQSH----QLSPCDRRLSLSSL  82

Query  265  QL--AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  438
                AVFRPK+DEISLLT+NTSSFFPDS GGYMVAFAGRKYAARS PAFVAN +Y V+SF
Sbjct  83   NSQLAVFRPKLDEISLLTINTSSFFPDSYGGYMVAFAGRKYAARSIPAFVANSTYTVTSF  142

Query  439  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            TLV EFKKGRLQNL+WKRDGCASC G+S F CLN QDCA+KT+ CKNRGG+VDCSLGIQL
Sbjct  143  TLVLEFKKGRLQNLFWKRDGCASCAGNSNFVCLNKQDCAIKTSDCKNRGGSVDCSLGIQL  202

Query  619  TFSGTDKHESVFNSWYEVK  675
             FSGTDKH +V NSWYEV+
Sbjct  203  AFSGTDKHLAVLNSWYEVE  221



>ref|XP_008360605.1| PREDICTED: uncharacterized protein LOC103424296 [Malus domestica]
Length=243

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 160/194 (82%), Gaps = 6/194 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  270
            SD N V+SPCADT V++SDGFTFGI FA++ +      +N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDXNPVYSPCADTKVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLSLSSNAQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            +VFRPKVDEISLL+VN+SSF PD+ G +MVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-FMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNLYWK+DGC+ C GSS F CLN Q CA KT+SCKN GG+VDCSLGIQL FSG
Sbjct  143  EFNKGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  631  TDKHESVFNSWYEV  672
            TDKH SV NSWYEV
Sbjct  203  TDKHLSVLNSWYEV  216



>ref|XP_008367354.1| PREDICTED: uncharacterized protein LOC103430985 [Malus domestica]
Length=243

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 160/194 (82%), Gaps = 6/194 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  270
            SD N V+SPCADT V++SDGFTFGI FA++ +      +N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDXNPVYSPCADTKVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLSLSSNAQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            +VFRPKVDEISLL+VN+SSF PD+ G +MVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-FMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNLYWK+DGC+ C GSS F CLN Q CA KT+SCKN GG+VDCSLGIQL FSG
Sbjct  143  EFNKGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  631  TDKHESVFNSWYEV  672
            TDKH SV NSWYEV
Sbjct  203  TDKHLSVLNSWYEV  216



>ref|XP_003519108.1| PREDICTED: uncharacterized protein LOC100807300 isoform 1 [Glycine 
max]
Length=243

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 5/193 (3%)
 Frame = +1

Query  103  NHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QLAV  276
            N VF+PC+DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+NA  Q++V
Sbjct  28   NRVFAPCSDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSNANSQISV  85

Query  277  FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEF  456
            FRPKVDEISLLTVN+SSF  DS G YMVAFAG +YAARSPPAFVANG+Y V+SFTLV EF
Sbjct  86   FRPKVDEISLLTVNSSSFVADSYG-YMVAFAGHRYAARSPPAFVANGTYTVTSFTLVLEF  144

Query  457  KKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTD  636
            K+GRLQNLYWKRDGCA C  +S   CLN QDCA++T++CK+ GG VDCS+GIQL FSGTD
Sbjct  145  KRGRLQNLYWKRDGCAKCSSNSKAVCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSGTD  204

Query  637  KHESVFNSWYEVK  675
            +H +V NSWYEVK
Sbjct  205  RHLAVLNSWYEVK  217



>ref|XP_009348837.1| PREDICTED: uncharacterized protein LOC103940443 [Pyrus x bretschneideri]
Length=243

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 6/194 (3%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQL  270
            SD N V+SPCADT V++SDGFTFGI FA++ +       N  VQLSPCD RLSL+ NAQ+
Sbjct  28   SDNNPVYSPCADTKVERSDGFTFGIAFASKESF----QPNGTVQLSPCDSRLSLSSNAQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            +VFRPKVDEISLL+VN+SSF PD+ G YMVAFAGRKYAARS P FVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLSVNSSSFNPDTYG-YMVAFAGRKYAARSLPTFVANGTYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF +GRLQNLYWK+DGC+ C GSS F CLN Q CA KT+SCKN GG+VDCSLGIQL FSG
Sbjct  143  EFNRGRLQNLYWKKDGCSKCSGSSDFVCLNNQHCAFKTSSCKNHGGSVDCSLGIQLAFSG  202

Query  631  TDKHESVFNSWYEV  672
            TDKH SV NSWYEV
Sbjct  203  TDKHLSVLNSWYEV  216



>ref|XP_006842158.1| hypothetical protein AMTR_s00078p00138630 [Amborella trichopoda]
 gb|ERN03833.1| hypothetical protein AMTR_s00078p00138630 [Amborella trichopoda]
Length=242

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 159/196 (81%), Gaps = 6/196 (3%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            + D N+VF PC D  +QKSDGFTFGI F+ R + F+ND+     QLSPCDRRLSL+  NA
Sbjct  25   ADDNNNVFQPCEDAKIQKSDGFTFGIAFSLRPSFFVNDT----TQLSPCDRRLSLSTSNA  80

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVD+ISLLT+NT++F P++ GGYMVAFAG++YAARS P FVAN ++IV+SFTL
Sbjct  81   QLAIFRPKVDQISLLTINTTTFTPEAFGGYMVAFAGQRYAARSTPTFVANSTFIVTSFTL  140

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNLYWKRDGCASCK +  FTCLN QDCA+  +SC   GG+VDCSLGIQ  F
Sbjct  141  VLEFEKGTLQNLYWKRDGCASCKRNPNFTCLNSQDCAINQSSCMGHGGSVDCSLGIQTAF  200

Query  625  SGTDKHESVFNSWYEV  672
            SGTDKH+ V NSWYEV
Sbjct  201  SGTDKHQVVLNSWYEV  216



>ref|XP_010677555.1| PREDICTED: uncharacterized protein LOC104893168 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score =   284 bits (726),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 161/195 (83%), Gaps = 4/195 (2%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  270
            D NH +SPC DT +QKSDGF+FGI F++R + F   + N  +QLSPCDRRLSL+  N+Q+
Sbjct  24   DNNHAYSPCRDTKIQKSDGFSFGIAFSSRLSFF--STNNPSIQLSPCDRRLSLSSTNSQV  81

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            A+FRPKVDEISLLT+NTSSF PDS GG+MVAFAG KYAARS P FVAN ++IV+SFTL+ 
Sbjct  82   ALFRPKVDEISLLTINTSSFSPDSAGGFMVAFAGSKYAARSLPTFVANSTHIVTSFTLIL  141

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            +FK+GRLQNL+WKRDGCASC+G S F C+N   C ++ + CKNRGGN+DCSLGIQ+ FSG
Sbjct  142  DFKQGRLQNLFWKRDGCASCEGKSKFVCMNNLYCGVRMSDCKNRGGNMDCSLGIQVAFSG  201

Query  631  TDKHESVFNSWYEVK  675
            TDKH +V NSWYEV+
Sbjct  202  TDKHYTVLNSWYEVE  216



>gb|EPS69588.1| expp1 protein, partial [Genlisea aurea]
Length=219

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 163/197 (83%), Gaps = 8/197 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN+VFSPC+D  VQ+SDGFTFGI FAAR A       N  +QLSPCD RLSL   N+QL
Sbjct  1    DTNNVFSPCSDAVVQRSDGFTFGIAFAARTAF----FFNATLQLSPCDHRLSLPSGNSQL  56

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPK+DEISLLTVNTSSF PDSVGGYMVAFAGR+YAARS PAFVAN +Y V+SFTLV 
Sbjct  57   AVFRPKIDEISLLTVNTSSFQPDSVGGYMVAFAGRRYAARSNPAFVANSTYTVTSFTLVL  116

Query  451  EFKKGRLQNLYWKRDGCASC--KGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            +F KGRLQN YWKRDGC++C   G S F CLN QDCA++TN CK+RGG+VDCS+GIQL F
Sbjct  117  DFDKGRLQNSYWKRDGCSACPSSGKSNFVCLNNQDCAIRTNDCKSRGGSVDCSIGIQLAF  176

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKHESV NSWYEV+
Sbjct  177  SGTDKHESVLNSWYEVR  193



>ref|XP_008361648.1| PREDICTED: uncharacterized protein LOC103425346 [Malus domestica]
Length=242

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 165/197 (84%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            +S+TN V++PC DT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  22   ASNTNSVYNPCTDTKIQRSDGFTFGIAFSSKTSFSLNG--NQSHQLSPCDRRLSLSSSNS  79

Query  271  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFV N +YIV+SFTL
Sbjct  80   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVGNSTYIVTSFTL  139

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+KT+ CKNRGG+VDCSLGIQL F
Sbjct  140  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKTSGCKNRGGSVDCSLGIQLAF  199

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  200  SGTDKHLSVLNSWYEVE  216



>ref|XP_008344952.1| PREDICTED: uncharacterized protein LOC103407860 [Malus domestica]
Length=249

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 165/197 (84%), Gaps = 4/197 (2%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            +S+TN V++PC DT +Q+SDGFTFGI F+++ +  +N   N+  QLSPCDRRLSL+++  
Sbjct  29   ASNTNSVYNPCTDTKIQRSDGFTFGIAFSSKTSFSLNG--NQSHQLSPCDRRLSLSSSNS  86

Query  271  AV--FRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
             +  FRPKVDEISLLT+NTSSF PDS GGYMVAFAGRKYAARS PAFV N +YIV+SFTL
Sbjct  87   QLALFRPKVDEISLLTINTSSFQPDSYGGYMVAFAGRKYAARSLPAFVGNSTYIVTSFTL  146

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQNLYWKRDGCA C G+S F CLN QDCA+KT+ CKNRGG+VDCSLGIQL F
Sbjct  147  VLEFQKGRLQNLYWKRDGCAKCTGNSNFVCLNKQDCAIKTSGCKNRGGSVDCSLGIQLAF  206

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH SV NSWYEV+
Sbjct  207  SGTDKHLSVLNSWYEVE  223



>ref|XP_010534378.1| PREDICTED: uncharacterized protein LOC104809944 [Tarenaya hassleriana]
Length=242

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = +1

Query  25   MARPSAilsllifptlfllAESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFIND  204
            MAR   +  +L        AE+S D N V+SPC+D+ V   DGF+FG+ FAA+ + F   
Sbjct  1    MARSVILCLILAAVLTSSPAEASGDDNRVYSPCSDSRVAVGDGFSFGLAFAAKESFF---  57

Query  205  SKNKDVQLSPCDRRLSLNNA--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRK  378
            + N+ VQ SPCDRRLSL+N+  Q+AVFRPKVDEI+LLT+NTSSF PDS GG+MVAFAG K
Sbjct  58   NSNRSVQFSPCDRRLSLSNSGSQVAVFRPKVDEITLLTINTSSFRPDSTGGFMVAFAGSK  117

Query  379  YAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAM  558
            YAARS P FVA+ + IV+SFTLV EF+KGRLQNLYWKRDGCA C G + F C N Q+CA+
Sbjct  118  YAARSVPVFVADNNLIVTSFTLVLEFQKGRLQNLYWKRDGCAKCAGDAKFVCFNKQECAI  177

Query  559  KTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            +T +CKNRGG VDCSLGIQL FSGTDKH +  NSWYEV
Sbjct  178  RTQNCKNRGGQVDCSLGIQLAFSGTDKHYTALNSWYEV  215



>ref|XP_003535822.1| PREDICTED: uncharacterized protein LOC100795287 isoform 1 [Glycine 
max]
Length=243

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 160/195 (82%), Gaps = 5/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NAQL  270
            D N VF+PC DT VQ+SDGFTFGI FA ++  F N+  N  VQLSPCD RLSL+  N+Q+
Sbjct  26   DDNRVFAPCTDTRVQRSDGFTFGIAFAPKDKFFYNN--NNSVQLSPCDTRLSLSSANSQI  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            +VFRPKVDEISLLTVN+SSF  DS G YMVAFAG +YAARSPPAFVANG+Y V+SFTLV 
Sbjct  84   SVFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGHRYAARSPPAFVANGTYTVTSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFK+GRLQNLYWKRDGC+ C  +S   CLN QDCA++T++CK+ GG VDCS+GIQL FSG
Sbjct  143  EFKRGRLQNLYWKRDGCSKCSSNSKAVCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSG  202

Query  631  TDKHESVFNSWYEVK  675
            TD+H +V NSWYEVK
Sbjct  203  TDRHLAVLNSWYEVK  217



>emb|CAB88423.1| putative protein [Arabidopsis thaliana]
Length=240

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 161/197 (82%), Gaps = 12/197 (6%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct  28   SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS  83

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV     
Sbjct  84   QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIV-----  138

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
              EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL F
Sbjct  139  -MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF  197

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH +V NSWYEV+
Sbjct  198  SGTDKHLAVLNSWYEVE  214



>ref|XP_010263047.1| PREDICTED: uncharacterized protein LOC104601426 [Nelumbo nucifera]
Length=269

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 166/197 (84%), Gaps = 8/197 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLA  273
            SDTN  F PC+DT +Q+SDGFTFGI FA RN+   N+S+N    LSPCDRRLSL+++  +
Sbjct  52   SDTNRAFQPCSDTKIQRSDGFTFGIAFAPRNSFLYNNSQN----LSPCDRRLSLSSSGSS  107

Query  274  V--FRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            +  FRPKVDEISLLT+NT+S FFPDS  GYMVAFAGRKYAARSPPAFVAN +YIV+SFTL
Sbjct  108  LALFRPKVDEISLLTINTTSNFFPDS-SGYMVAFAGRKYAARSPPAFVANSTYIVTSFTL  166

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KGRLQN YWKRDGCASC G+S F CLN QDCA++T+SCK+R G+VDCSLGIQL F
Sbjct  167  VLEFQKGRLQNFYWKRDGCASCSGNSKFVCLNKQDCAIRTSSCKSRRGSVDCSLGIQLAF  226

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH+ V NSWYEV+
Sbjct  227  SGTDKHDVVLNSWYEVE  243



>ref|XP_002271183.1| PREDICTED: uncharacterized protein LOC100249592 [Vitis vinifera]
 emb|CBI39123.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 161/200 (81%), Gaps = 10/200 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            S D N VFSPCADTTVQKSDGFTFGI FA+R+    N++      LSPCDRRL+L+  N+
Sbjct  22   SGDNNRVFSPCADTTVQKSDGFTFGIAFASRDKFSYNNT-----LLSPCDRRLALSSQNS  76

Query  265  QLAVFRPKVDEISLLTVNT-SSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            Q+A FRPKVDEISLL++NT SSFFP + GGYMVAFAGRKYAARS  AFV+N +Y V+SFT
Sbjct  77   QIAAFRPKVDEISLLSINTTSSFFPANYGGYMVAFAGRKYAARSSLAFVSNSTYTVTSFT  136

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQ  615
            LV EFKKGRLQNLYWKRDGC++C G + F CLN QDCA+KT  CK   +G +VDCSLGIQ
Sbjct  137  LVLEFKKGRLQNLYWKRDGCSACSGDNKFVCLNNQDCAIKTTDCKGQGQGASVDCSLGIQ  196

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH SV NSWYEVK
Sbjct  197  LAFSGTDKHYSVLNSWYEVK  216



>ref|XP_010907712.1| PREDICTED: uncharacterized protein LOC105034308 [Elaeis guineensis]
Length=246

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 158/197 (80%), Gaps = 10/197 (5%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQ  267
            D N VF PCAD  +Q+ DGFTFGI F+ R + F N +     QLSPCDRRLSL    NAQ
Sbjct  28   DNNRVFQPCADAKIQRGDGFTFGIAFSTRESFFFNQT-----QLSPCDRRLSLASGANAQ  82

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRPKVDEISLLTVNT+S+   + GG+MVAFAGRKYAARS PAFV+N SY V+SFTLV
Sbjct  83   LALFRPKVDEISLLTVNTTSYPAVTNGGFMVAFAGRKYAARSLPAFVSNSSYTVTSFTLV  142

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQLT  621
             EF+KG LQNLYWKRDGCASC G S F CLN Q+CA+KT++CK  N+GG+VDCS+GIQL 
Sbjct  143  LEFQKGTLQNLYWKRDGCASCSGKSNFVCLNKQECAIKTSNCKSANQGGSVDCSIGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH++V NSWYEV
Sbjct  203  FSGTDKHDAVLNSWYEV  219



>ref|XP_008787836.1| PREDICTED: uncharacterized protein LOC103705763, partial [Phoenix 
dactylifera]
Length=234

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 10/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL---NN  261
            + D N VF PCAD  +QK DGFTFGI F+ R + F N +     QLSPCDRRLSL    N
Sbjct  14   AGDNNRVFQPCADAKIQKGDGFTFGIAFSTRESFFFNQT-----QLSPCDRRLSLASGGN  68

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLA+FRPKVDEISLLTVNT+S+   + GG+MVAFAGRKYAARS P FV+N SY V+SFT
Sbjct  69   AQLALFRPKVDEISLLTVNTTSYPAVTNGGFMVAFAGRKYAARSLPTFVSNSSYTVTSFT  128

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQ  615
            LV EF+KG LQNLYWKRDGCASC G S F CLN Q+CA+KT++CK  N+GG+VDCS+GIQ
Sbjct  129  LVLEFQKGTLQNLYWKRDGCASCSGKSDFVCLNKQECAIKTSNCKSANQGGSVDCSIGIQ  188

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDKH +V NSWYEV
Sbjct  189  LAFSGTDKHYAVLNSWYEV  207



>gb|AEZ00912.1| putative expp1 protein [Elaeis guineensis]
Length=248

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 159/199 (80%), Gaps = 10/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---N  261
            + D N VF PCADT +Q+ DGFTFGI F+ R++ F N +     QLSPCD RL+L    N
Sbjct  28   AGDNNRVFQPCADTKIQRGDGFTFGIAFSTRDSFFFNQT-----QLSPCDSRLALASNAN  82

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLA+FRPKVDEISLLTVNT+ +   + GG+MVAFAGRKYAARS PAFV N SYIV+SFT
Sbjct  83   AQLALFRPKVDEISLLTVNTTVYPAVTNGGFMVAFAGRKYAARSLPAFVGNSSYIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQ  615
            LV EF+KGRLQNLYWKRDGCASC G S F CLN  +CA+KT+SCK  N+GG+VDCS+GIQ
Sbjct  143  LVLEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKLECAIKTSSCKNANQGGSVDCSIGIQ  202

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTD+H++V NSWYEV
Sbjct  203  LAFSGTDEHDAVLNSWYEV  221



>ref|XP_010906029.1| PREDICTED: uncharacterized protein LOC105033073 [Elaeis guineensis]
Length=248

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 159/199 (80%), Gaps = 10/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---N  261
            + D N VF PCADT +Q+ DGFTFGI F+ R++ F N +     QLSPCD RL+L    N
Sbjct  28   AGDNNRVFQPCADTKIQRGDGFTFGIAFSTRDSFFFNQT-----QLSPCDSRLALASNAN  82

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLA+FRPKVDEISLLTVNT+ +   + GG+MVAFAGRKYAARS PAFV N SYIV+SFT
Sbjct  83   AQLALFRPKVDEISLLTVNTTVYPAVTNGGFMVAFAGRKYAARSLPAFVGNSSYIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQ  615
            LV EF+KGRLQNLYWKRDGCASC G S F CLN  +CA+KT+SCK  N+GG+VDCS+GIQ
Sbjct  143  LVLEFQKGRLQNLYWKRDGCASCSGKSNFVCLNKLECAIKTSSCKNANQGGSVDCSIGIQ  202

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTD+H++V NSWYEV
Sbjct  203  LAFSGTDEHDAVLNSWYEV  221



>ref|XP_009381303.1| PREDICTED: uncharacterized protein LOC103969490 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 155/196 (79%), Gaps = 7/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + D N VF+PCAD  +Q+ DGF FGI F++  + F N      V+LSPCD RLSL  N A
Sbjct  21   AGDQNGVFTPCADAKIQRWDGFAFGIAFSSYESFFSNG-----VKLSPCDTRLSLSSNGA  75

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLT+NTS+    + GGYMVAFAG+KYAARS PAF+ N +Y+V+SFTL
Sbjct  76   QLAVFRPKVDEISLLTINTSNNPSVTSGGYMVAFAGKKYAARSLPAFIGNSTYVVTSFTL  135

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF KG LQNLYWKRDGCASCKG S F CLN QDCA+KT+SCK +GG VDCS+GIQL F
Sbjct  136  VLEFHKGTLQNLYWKRDGCASCKGKSSFVCLNNQDCAIKTSSCKTQGGAVDCSIGIQLAF  195

Query  625  SGTDKHESVFNSWYEV  672
            SGTDKH++V NSWYEV
Sbjct  196  SGTDKHDAVLNSWYEV  211



>ref|XP_004161289.1| PREDICTED: uncharacterized LOC101209667 isoform 1 [Cucumis sativus]
 ref|XP_004161290.1| PREDICTED: uncharacterized LOC101209667 isoform 2 [Cucumis sativus]
Length=245

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 152/199 (76%), Gaps = 9/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ-  267
            +SD N VFSPC DTTV+ SDGFT G  FA     F N    K +QLSPCD RL L N   
Sbjct  24   ASDNNRVFSPCTDTTVENSDGFTLGFAFATEQKFFFN----KTLQLSPCDSRLGLTNGNS  79

Query  268  -LAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             ++VFRPKVDEISLLT+NTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+S
Sbjct  80   LISVFRPKVDEISLLTINTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTS  139

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRLQNL+WKRDGCA C  +S F C++ QDCA++TNSCKN GG+VDCSL IQ
Sbjct  140  FTLVLEFEKGRLQNLFWKRDGCARCSNNSTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQ  199

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDKH SVFNSWYEV
Sbjct  200  LAFSGTDKHLSVFNSWYEV  218



>ref|XP_004136522.1| PREDICTED: uncharacterized protein LOC101209667 [Cucumis sativus]
 gb|KGN59226.1| hypothetical protein Csa_3G782730 [Cucumis sativus]
Length=245

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 152/199 (76%), Gaps = 9/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ-  267
            +SD N VFSPC DTTV+ SDGFT G  FA     F N    K +QLSPCD RL L N   
Sbjct  24   ASDNNRVFSPCTDTTVENSDGFTLGFAFATEQKFFFN----KTLQLSPCDSRLGLTNGNS  79

Query  268  -LAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             ++VFRPKVDEISLLT+NTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+S
Sbjct  80   LISVFRPKVDEISLLTINTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTS  139

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRLQNL+WKRDGCA C  +S F C++ QDCA++TNSCKN GG+VDCSL IQ
Sbjct  140  FTLVLEFEKGRLQNLFWKRDGCARCSNNSTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQ  199

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDKH SVFNSWYEV
Sbjct  200  LAFSGTDKHLSVFNSWYEV  218



>ref|XP_003590316.1| hypothetical protein MTR_1g056390 [Medicago truncatula]
 gb|ACJ84303.1| unknown [Medicago truncatula]
 gb|AES60567.1| CSL zinc finger protein [Medicago truncatula]
 gb|AFK33399.1| unknown [Medicago truncatula]
 gb|AFK39356.1| unknown [Medicago truncatula]
Length=240

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 158/195 (81%), Gaps = 5/195 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QL  270
            DTN VFSPC DT VQ+SDGFT G  FA+++  F N+  N  +QLSPCD RLSL+N+  Q+
Sbjct  23   DTNKVFSPCTDTRVQRSDGFTLGFAFASKDKFFYNN--NNSIQLSPCDSRLSLSNSNSQI  80

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRPKVDEISLLTVN+SSF  DS G YMVAFAGRKYAARSPPAF+ANGSY V+SFTLV 
Sbjct  81   SLFRPKVDEISLLTVNSSSFVADSYG-YMVAFAGRKYAARSPPAFIANGSYTVTSFTLVL  139

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EFKKGRLQNL+WKRDGC+ C  +S   CLNGQDCA+ T+SCK   G VDCSLGIQL FSG
Sbjct  140  EFKKGRLQNLFWKRDGCSKCPKNSKAVCLNGQDCALPTSSCKTHSGTVDCSLGIQLAFSG  199

Query  631  TDKHESVFNSWYEVK  675
            TDKH S  NSWYEVK
Sbjct  200  TDKHLSALNSWYEVK  214



>ref|XP_010036587.1| PREDICTED: uncharacterized protein LOC104425564 [Eucalyptus grandis]
 gb|KCW48197.1| hypothetical protein EUGRSUZ_K01919 [Eucalyptus grandis]
Length=247

 Score =   271 bits (694),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A  SSDTN  +S CADTTVQ+SDGF+F I FAAR A F N ++    QLSPCD RLSL++
Sbjct  26   AVRSSDTNGAYSTCADTTVQRSDGFSFAIAFAARTAFFFNSTQ----QLSPCDSRLSLSS  81

Query  262  A--QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            +  Q+AVFRPKVDEISLLT+NTSSF PD+ GGYMVAFAGRKYAARS PAFVAN +Y V+S
Sbjct  82   SGSQIAVFRPKVDEISLLTINTSSFSPDTSGGYMVAFAGRKYAARSLPAFVANSTYTVTS  141

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRLQNLYWKRDGC+SC G+S F CLN QDCA+KT+ CKNRGG+VDCSLGIQ
Sbjct  142  FTLVLEFQKGRLQNLYWKRDGCSSCSGNSNFVCLNNQDCALKTSDCKNRGGSVDCSLGIQ  201

Query  616  LTFSGTDKHESVFNSWYEVK  675
            L FSGTDKH  V NSWYEV+
Sbjct  202  LAFSGTDKHFKVLNSWYEVE  221



>ref|XP_008811297.1| PREDICTED: uncharacterized protein LOC103722495 [Phoenix dactylifera]
Length=237

 Score =   271 bits (693),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 155/191 (81%), Gaps = 10/191 (5%)
 Frame = +1

Query  115  SPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---NAQLAVFRP  285
            SPCADT +Q+ DGFTFGI F+ R++ F N      +QLSPCDRRLSL    N+QLA+FRP
Sbjct  25   SPCADTKIQRGDGFTFGIAFSTRDSFFFNQ-----IQLSPCDRRLSLASSANSQLALFRP  79

Query  286  KVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKG  465
            KVDEISLLT+NT+++   + GG+MVAFAGRKYAARS PAF+ N SY V+SFTLV EF KG
Sbjct  80   KVDEISLLTINTTTYPAVTNGGFMVAFAGRKYAARSLPAFIGNSSYTVTSFTLVLEFHKG  139

Query  466  RLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK--NRGGNVDCSLGIQLTFSGTDK  639
             LQNLYWKRDGCASC G S F CLN Q+CA+KT++CK  N+GG+VDCS+GIQL FSGTDK
Sbjct  140  TLQNLYWKRDGCASCSGKSNFVCLNKQECAIKTSNCKNANQGGSVDCSIGIQLAFSGTDK  199

Query  640  HESVFNSWYEV  672
            H++V NSWYEV
Sbjct  200  HDAVLNSWYEV  210



>ref|XP_010263787.1| PREDICTED: uncharacterized protein LOC104601968 isoform X1 [Nelumbo 
nucifera]
Length=251

 Score =   271 bits (694),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  36   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  90

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  91   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  150

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++C++ GG  DCSLGIQL FSG
Sbjct  151  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  210

Query  631  TDKHESVFNSWYEVK  675
            TDK + V NSWYEVK
Sbjct  211  TDKSDEVLNSWYEVK  225



>ref|XP_010263788.1| PREDICTED: uncharacterized protein LOC104601968 isoform X2 [Nelumbo 
nucifera]
Length=249

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  34   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  88

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  89   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  148

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++C++ GG  DCSLGIQL FSG
Sbjct  149  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  208

Query  631  TDKHESVFNSWYEVK  675
            TDK + V NSWYEVK
Sbjct  209  TDKSDEVLNSWYEVK  223



>ref|XP_010263789.1| PREDICTED: uncharacterized protein LOC104601968 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010263790.1| PREDICTED: uncharacterized protein LOC104601968 isoform X3 [Nelumbo 
nucifera]
Length=238

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  23   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  77

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+N S F PD  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  78   AVFRPKVDEISLLTINGSKFSPDMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  137

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++C++ GG  DCSLGIQL FSG
Sbjct  138  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  197

Query  631  TDKHESVFNSWYEVK  675
            TDK + V NSWYEVK
Sbjct  198  TDKSDEVLNSWYEVK  212



>ref|XP_008442938.1| PREDICTED: uncharacterized protein LOC103486692 [Cucumis melo]
Length=245

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 151/197 (77%), Gaps = 9/197 (5%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQ--L  270
            D N VFSPC DTTV+ SDGFT G  FA +   F N    K +QLSPCD RL L N    +
Sbjct  26   DNNRVFSPCTDTTVETSDGFTLGFAFATQQKFFFN----KTLQLSPCDSRLGLTNGNSLI  81

Query  271  AVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            +VFRPKVDEISLLTVNTS   S F  S  GYMVAFAGRKYAARSPP FVA+  +IV+SFT
Sbjct  82   SVFRPKVDEISLLTVNTSRSVSSFDPSSNGYMVAFAGRKYAARSPPIFVADQQHIVTSFT  141

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRLQNL+WKRDGCA C  ++ F C++ QDCA++TNSCKN GG+VDCSL IQL 
Sbjct  142  LVLEFEKGRLQNLFWKRDGCAQCSNNNTFVCIHNQDCAIRTNSCKNNGGSVDCSLAIQLA  201

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH SVFNSWYEV
Sbjct  202  FSGTDKHLSVFNSWYEV  218



>gb|ABK22043.1| unknown [Picea sitchensis]
Length=241

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 154/194 (79%), Gaps = 7/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAV  276
            DTN VF+PC+DT VQKSDGFTFG+ FAAR++ + N      V+ SPCD RL L+ + LAV
Sbjct  26   DTNSVFNPCSDTLVQKSDGFTFGVTFAARDSFYSNT-----VEYSPCDSRLGLSASHLAV  80

Query  277  FRPKVDEISLLTVNTS--SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            FRPKVDEI+LLT+NT+  SF P+  GGYMVAFAG  +AARS P FVAN + I++SFTLV 
Sbjct  81   FRPKVDEITLLTINTTAGSFSPEQDGGYMVAFAGHNHAARSTPTFVANQTLIITSFTLVL  140

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            +F KGRLQNL+WK DGC SC+G S F C  GQ CA+K + CKN+GG+VDCSLGIQL FSG
Sbjct  141  DFNKGRLQNLFWKTDGCNSCQGKSSFVCYRGQSCAIKLSDCKNKGGSVDCSLGIQLAFSG  200

Query  631  TDKHESVFNSWYEV  672
            TDKH+SVFNSWYE+
Sbjct  201  TDKHDSVFNSWYEI  214



>ref|XP_008241077.1| PREDICTED: uncharacterized protein LOC103339548 [Prunus mume]
Length=244

 Score =   267 bits (682),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 154/196 (79%), Gaps = 8/196 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQ  267
            S+ NHV+SPCADT V++SDGFTFGI FA+R++ F    +N  VQLSPCD RLSL+N  +Q
Sbjct  29   SNNNHVYSPCADTKVERSDGFTFGIAFASRDSFF----RNGSVQLSPCDSRLSLSNGNSQ  84

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            ++VFRPKVDEISLL+VN+SSF  DS G YMVAF          PAFVAN +Y V+SFTLV
Sbjct  85   ISVFRPKVDEISLLSVNSSSFTADSYG-YMVAFXXXX-XXXXXPAFVANATYTVTSFTLV  142

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF KGRLQNLYWKRDGC+ C GS+G  CLN QDCA +T+SCK  GG+VDCSLGIQL FS
Sbjct  143  LEFNKGRLQNLYWKRDGCSKCSGSTGLVCLNNQDCAFRTSSCKTHGGSVDCSLGIQLAFS  202

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH SV NSWYEV+
Sbjct  203  GTDKHLSVLNSWYEVE  218



>ref|XP_010503073.1| PREDICTED: uncharacterized protein LOC104780270 isoform X2 [Camelina 
sativa]
Length=242

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 152/196 (78%), Gaps = 22/196 (11%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            S+TNH++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCDRRL+L   N+Q
Sbjct  41   SNTNHIYSPCSDTKIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDRRLTLAAMNSQ  96

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L++FRPK                D+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTLV
Sbjct  97   LSIFRPK----------------DNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTLV  140

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL FS
Sbjct  141  MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNRQDCAIRTPSCKVRGGTVDCSLGIQLAFS  200

Query  628  GTDKHESVFNSWYEVK  675
            GTDKH  V NSWYEV+
Sbjct  201  GTDKHLRVLNSWYEVE  216



>ref|XP_004982307.1| PREDICTED: uncharacterized protein LOC101777564 [Setaria italica]
Length=246

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 157/197 (80%), Gaps = 8/197 (4%)
 Frame = +1

Query  88   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNA  264
            ++ DTN V+ PC+D  +Q+ DGF+FG+VFA  NA F     + + QLSPCDRRL+L ++A
Sbjct  29   AAGDTNGVYEPCSDAWIQRGDGFSFGVVFAGYNAFF-----SGNTQLSPCDRRLNLASSA  83

Query  265  QLAVFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            QLAVFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S+ VSSFT
Sbjct  84   QLAVFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSAPIFVSNTSFTVSSFT  143

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EFKKGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK + G VDCS+GIQL 
Sbjct  144  LVLEFKKGRLQNLHWKKDGCGACTGKSNFVCLGKQTCAIRTQSCKTQ-GPVDCSIGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTD+HESV NSWYEV
Sbjct  203  FSGTDRHESVLNSWYEV  219



>ref|XP_002882747.1| hypothetical protein ARALYDRAFT_478525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59006.1| hypothetical protein ARALYDRAFT_478525 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 158/197 (80%), Gaps = 6/197 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDR-RLSLN-NAQL  270
            D N V+SPC+D+TV   DGFTFGI FAAR+ +F + +++  VQ SPCDR RLSLN N+++
Sbjct  24   DNNQVYSPCSDSTVAIGDGFTFGIAFAARD-SFFSTNRSDHVQYSPCDRHRLSLNGNSEV  82

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSIPIMVADSNHIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRL+ ++WK+DGC+ C G S F CLN ++CA+KT SCKN+GG VDCSLGIQL 
Sbjct  143  LVLEFQKGRLEEMFWKKDGCSKCSGDSKFVCLNKEECAIKTQSCKNQGGQVDCSLGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH +  NSWYEV
Sbjct  203  FSGTDKHYTALNSWYEV  219



>ref|XP_009407725.1| PREDICTED: uncharacterized protein LOC103990346 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score =   264 bits (674),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 155/193 (80%), Gaps = 6/193 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  273
            D N VF+PC D  +Q+ DGFTFGI F+  ++ F     +  VQLSPCD RLSL+N AQLA
Sbjct  20   DQNDVFTPCDDAKIQRWDGFTFGIAFSNHDSFF-----SDRVQLSPCDSRLSLSNVAQLA  74

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRPKVDEISLLTV+TS+    + GGYMVAFAGRKYAARS P FV++ + IV+SFTLV E
Sbjct  75   VFRPKVDEISLLTVDTSANPAVTSGGYMVAFAGRKYAARSVPVFVSDNTNIVTSFTLVLE  134

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KG LQNL+WKRDGCASC G S F CLN Q CA+KT+SCK++GG+VDC++GIQL FSGT
Sbjct  135  FQKGTLQNLHWKRDGCASCSGKSSFVCLNNQVCAIKTSSCKHQGGSVDCNIGIQLAFSGT  194

Query  634  DKHESVFNSWYEV  672
            DKH++V NSWYEV
Sbjct  195  DKHDAVLNSWYEV  207



>ref|NP_001148355.1| expp1 protein precursor [Zea mays]
 gb|ACG31007.1| expp1 protein precursor [Zea mays]
Length=244

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNSVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSTPIFVSNTSVTVSSFTLVL  144

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  204  TDKHESVLNSWYEV  217



>gb|AAT75254.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE60063.1| hypothetical protein OsJ_12869 [Oryza sativa Japonica Group]
Length=253

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 11/197 (6%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRP+VDEISLLTVNTS+   F P + GGYMVAFAGRKYAARSPP FV+N SY V+SFT
Sbjct  91   AVFRPEVDEISLLTVNTSAAGGFDPATSGGYMVAFAGRKYAARSPPVFVSNSSYTVTSFT  150

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LVFEF KG LQNLYWK +GC++C G   FTC++ Q+CA+ T +C  +GG+VDCS GIQL 
Sbjct  151  LVFEFNKGTLQNLYWKANGCSACSGQPSFTCVD-QNCAISTANCTGKGGSVDCSPGIQLA  209

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKHE+V NSWYEV
Sbjct  210  FSGTDKHEAVLNSWYEV  226



>ref|NP_001148709.1| expp1 protein precursor [Zea mays]
 gb|ACG32616.1| expp1 protein precursor [Zea mays]
Length=244

 Score =   262 bits (669),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  204  TDKHESVLNSWYEV  217



>ref|NP_001140927.1| expp1 protein precursor [Zea mays]
 gb|ACF84982.1| unknown [Zea mays]
 tpg|DAA50289.1| TPA: expp1 protein [Zea mays]
Length=244

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  204  TDKHESVLNSWYEV  217



>ref|XP_006356594.1| PREDICTED: uncharacterized protein LOC102601073 isoform X1 [Solanum 
tuberosum]
 ref|XP_006356595.1| PREDICTED: uncharacterized protein LOC102601073 isoform X2 [Solanum 
tuberosum]
Length=240

 Score =   261 bits (667),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 156/197 (79%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN VF PC+DT VQ+ DGFTFG+VF+++ + F N+S     QLSPCDRRLSL  N+A
Sbjct  24   AGDTNSVFDPCSDTRVQRWDGFTFGLVFSSKESFFFNES-----QLSPCDRRLSLTGNSA  78

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            +LAVFRPKVDEISLLT+N S+F P   GGYMVAFAGRKYAARS PAFVA+ ++ V+SFTL
Sbjct  79   ELAVFRPKVDEISLLTINISNFNPSKSGGYMVAFAGRKYAARSLPAFVADSTHTVTSFTL  138

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK+ GC SCKG S F CLN  DCA+  N C   GG++DC++ IQL F
Sbjct  139  VLEFQKGTLQNLFWKKFGCDSCKGDS-FVCLNKTDCAVPNNKCNGNGGSIDCNVSIQLAF  197

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+E+V NSWYEVK
Sbjct  198  SGTDKNENVLNSWYEVK  214



>ref|NP_566401.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK76686.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85130.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75100.1| uncharacterized protein AT3G11800 [Arabidopsis thaliana]
Length=246

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 158/197 (80%), Gaps = 6/197 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  270
            D N V+SPC+D+TV   DGFTFGI FAA++ +F + +++K VQ SPCD R LSLN N+++
Sbjct  24   DNNQVYSPCSDSTVAIGDGFTFGIAFAAKD-SFFSTNRSKSVQYSPCDHRHLSLNGNSEV  82

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSLPIMVADSNHIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRL+N++WK+DGC+ C G S F CLN ++CA+K  +CKN+GG VDCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDSKFVCLNKEECAIKPQNCKNQGGQVDCSLGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH +  NSWYEV
Sbjct  203  FSGTDKHYTALNSWYEV  219



>ref|XP_008667260.1| PREDICTED: expp1 protein isoform X2 [Zea mays]
Length=298

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  84   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  138

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  139  VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  198

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  199  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  257

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  258  TDKHESVLNSWYEV  271



>ref|XP_008667257.1| PREDICTED: expp1 protein isoform X1 [Zea mays]
Length=320

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  106  DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  160

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  161  VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  220

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  221  EFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  279

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  280  TDKHESVLNSWYEV  293



>ref|XP_002464167.1| hypothetical protein SORBIDRAFT_01g013420 [Sorghum bicolor]
 gb|EER91165.1| hypothetical protein SORBIDRAFT_01g013420 [Sorghum bicolor]
Length=244

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 153/197 (78%), Gaps = 8/197 (4%)
 Frame = +1

Query  88   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NA  264
            +++DTN V+ PC+D  +Q+ DGFTFG+VFA  N  F     + + QLSPCDRRL+L  + 
Sbjct  27   AAADTNGVYEPCSDARIQRGDGFTFGVVFAGYNTFF-----SGNTQLSPCDRRLNLAASG  81

Query  265  QLAVFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            QLA+FRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFT
Sbjct  82   QLALFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSVPIFVSNTSVTVSSFT  141

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK + G VDCS+GIQL 
Sbjct  142  LVLEFNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKTQ-GPVDCSIGIQLA  200

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKHESV NSWYEV
Sbjct  201  FSGTDKHESVLNSWYEV  217



>ref|XP_010464889.1| PREDICTED: uncharacterized protein LOC104745376 [Camelina sativa]
Length=246

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 155/197 (79%), Gaps = 6/197 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  270
            D N V+SPC+D+TV   DGFTFGI FA+++ TF   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-TFFGGSTNHTVQYSPCDRRRLSLNGNSEI  82

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRL+N++WK+DGC+ C G + F CLNG  CA+K+ +CKN+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNGDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH +  NSWYEV
Sbjct  203  FSGTDKHYTALNSWYEV  219



>ref|XP_010276279.1| PREDICTED: uncharacterized protein LOC104611063 [Nelumbo nucifera]
Length=235

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 153/205 (75%), Gaps = 17/205 (8%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN ++ PC+D  + KSDGFT G+ F+++ +        + +QLSPCDRRLSL++  AQL
Sbjct  10   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFLF-----EQIQLSPCDRRLSLSSKIAQL  64

Query  271  AVFRPKVDEISLLTVNTSSF----------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  420
            AVFRPKVDEISLLT+N S+F          F D  GGYMVAFAG+KYAARS P FVAN +
Sbjct  65   AVFRPKVDEISLLTINGSNFSLVLLQLVFTFRDMYGGYMVAFAGQKYAARSQPTFVANST  124

Query  421  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDC  600
            YI++SFTLV EF+KG LQNLYWK+DGCA C G S F CLN QDCA+  +SC++ GG  DC
Sbjct  125  YIITSFTLVLEFQKGTLQNLYWKKDGCAPCAGKSSFICLNLQDCAIGISSCQSHGGPFDC  184

Query  601  SLGIQLTFSGTDKHESVFNSWYEVK  675
            SLGIQLTFSGT+K + + NSWYEVK
Sbjct  185  SLGIQLTFSGTNKSDEILNSWYEVK  209



>ref|XP_006298425.1| hypothetical protein CARUB_v10014494mg [Capsella rubella]
 gb|EOA31323.1| hypothetical protein CARUB_v10014494mg [Capsella rubella]
Length=244

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 8/199 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NA  264
            + D N V+SPC+D+TV   DGFTFGI FAA+++ F     N+ VQ SPCDRR LSLN N+
Sbjct  22   AGDDNRVYSPCSDSTVGIGDGFTFGIAFAAKDSFF---GTNRSVQYSPCDRRRLSLNGNS  78

Query  265  QLAVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
            ++AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+S
Sbjct  79   EVAVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSVPIMVADSNHIVTS  138

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+KT +CKN+GG VDCSLGIQ
Sbjct  139  FTLVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNKDQCAIKTQNCKNQGGQVDCSLGIQ  198

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDKH +  NSWYEV
Sbjct  199  LAFSGTDKHYTALNSWYEV  217



>gb|ACL53994.1| unknown [Zea mays]
Length=244

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  85   VFRPKVDEISLLTINTTTGFNPASAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVL  144

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRL+NL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSG
Sbjct  145  EFNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSG  203

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  204  TDKHESVLNSWYEV  217



>ref|XP_004290389.1| PREDICTED: uncharacterized protein LOC101301448 [Fragaria vesca 
subsp. vesca]
Length=237

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A++ SDTN VF PC+D T+Q+ DGFTFG+ F+ +++ F N +     QLSPCD+RLSL+ 
Sbjct  30   ADAGSDTNGVFDPCSDATIQRWDGFTFGLAFSTKDSFFSNQT-----QLSPCDKRLSLST  84

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLA+FRPKVDEISLL++N+S+F P   GGYMVAFAGRKYAARSPP  VA+ S  ++SFT
Sbjct  85   AQLALFRPKVDEISLLSINSSNFNPARAGGYMVAFAGRKYAARSPPILVADDSNTITSFT  144

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF +G LQNLYWK+ GC +C G     CLNG+DCA+  + CK+ GG+ DC+L IQLT
Sbjct  145  LVLEFDRGILQNLYWKKFGCKACSGDYS-VCLNGEDCAVPNSKCKSNGGSFDCNLSIQLT  203

Query  622  FSGTDKHESVFNSWYEVK  675
            FSGTDKH  V NSWYEVK
Sbjct  204  FSGTDKHLQVLNSWYEVK  221



>gb|ABF97892.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG91851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87811.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59593.1| hypothetical protein OsJ_11902 [Oryza sativa Japonica Group]
Length=245

 Score =   259 bits (662),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 7/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  30   DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  85

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  86   VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  145

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T SCK++ G VDCS+GIQL FSG
Sbjct  146  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  204

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  205  TDKHESVLNSWYEV  218



>gb|KFK38545.1| hypothetical protein AALP_AA3G127900 [Arabis alpina]
Length=250

 Score =   259 bits (662),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATF--INDSKNKDVQLSPCD-RRLSLN-NA  264
            D N V+SPC+D+TV   DGFTFGI FAAR++ F   N+     VQ SPCD RRLSLN N+
Sbjct  24   DENRVYSPCSDSTVAIGDGFTFGIAFAARDSFFGTTNNRSVPPVQYSPCDHRRLSLNGNS  83

Query  265  QLAVFRPKVDEISLLTVNTSS----FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVS  432
            +LAVFRPKVDEI+LLT+NTSS    F PD+   +MVAFAG KYAARS P  VA+ ++IV+
Sbjct  84   ELAVFRPKVDEITLLTINTSSGSSSFRPDASKSHMVAFAGAKYAARSVPIMVADSNHIVT  143

Query  433  SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGI  612
            SFTLV EFKKGRL+NL+WK+DGC+ C G + F CLN ++CA+K+ +CKN+GG VDCSLGI
Sbjct  144  SFTLVLEFKKGRLENLFWKKDGCSKCSGDAKFVCLNKEECAIKSQNCKNQGGQVDCSLGI  203

Query  613  QLTFSGTDKHESVFNSWYEV  672
            QL FSGTDKH +  NSWYEV
Sbjct  204  QLAFSGTDKHYTAMNSWYEV  223



>ref|XP_004248747.1| PREDICTED: uncharacterized protein LOC101250348 [Solanum lycopersicum]
Length=238

 Score =   258 bits (660),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 153/197 (78%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN VF PC+DT VQ+ DGFTFG+VF+++ + F N++     QLSPCDRRLSL  N+A
Sbjct  22   AGDTNSVFDPCSDTRVQRWDGFTFGLVFSSKESFFFNET-----QLSPCDRRLSLTGNSA  76

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            +LAVFRPKVDEISLL +N S+F P   GGYMVAFAGRKYAARS PAFVA+ ++ V+SFTL
Sbjct  77   ELAVFRPKVDEISLLKINNSNFNPSKSGGYMVAFAGRKYAARSLPAFVADSTHTVTSFTL  136

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK+ GC SCKG S F CLN  DCA+  N C   GG++DC + IQL F
Sbjct  137  VLEFQKGTLQNLFWKKFGCDSCKGDS-FVCLNKTDCAVPNNKCNGNGGSIDCDVSIQLAF  195

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+E V NSWYEVK
Sbjct  196  SGTDKNEDVLNSWYEVK  212



>gb|EEC77546.1| hypothetical protein OsI_16454 [Oryza sativa Indica Group]
Length=247

 Score =   259 bits (661),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 151/194 (78%), Gaps = 7/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PC+DT +Q+ DGF+FGI FA+  A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  32   DENGVYDPCSDTRIQRGDGFSFGIAFASLGAFYSGGS----VQLSPCDRRLSLASSGQLA  87

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  88   VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  147

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T SCK++ G VDCS+GIQL FSG
Sbjct  148  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  206

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  207  TDKHESVLNSWYEV  220



>ref|NP_001050775.2| Os03g0647800 [Oryza sativa Japonica Group]
 dbj|BAF12689.2| Os03g0647800, partial [Oryza sativa Japonica Group]
Length=263

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 7/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  48   DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  103

Query  274  VFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLT+NT++ F P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV 
Sbjct  104  VFRPKVDEISLLTINTTTGFNPATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVL  163

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KGRLQNL+WK+DGC +C  SS   C+  Q CA +T SCK++ G VDCS+GIQL FSG
Sbjct  164  EFNKGRLQNLHWKKDGCGACAKSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSG  222

Query  631  TDKHESVFNSWYEV  672
            TDKHESV NSWYEV
Sbjct  223  TDKHESVLNSWYEV  236



>ref|XP_002281560.2| PREDICTED: uncharacterized protein LOC100243476 [Vitis vinifera]
Length=241

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 7/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            + DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+
Sbjct  24   ADDTNDVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNS  78

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLTVN+++F P S GGYMVAFAGRKYAARS P  VA+G + ++SFTL
Sbjct  79   QLAVFRPKVDEISLLTVNSTNFNPISNGGYMVAFAGRKYAARSTPVLVADGQHTITSFTL  138

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++ CKN+GG++DC++ IQL F
Sbjct  139  VLEFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGSIDCNISIQLIF  198

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK     NSWYE+K
Sbjct  199  SGTDKKLVALNSWYELK  215



>emb|CBI32499.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 7/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            + DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+
Sbjct  23   ADDTNDVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNS  77

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLTVN+++F P S GGYMVAFAGRKYAARS P  VA+G + ++SFTL
Sbjct  78   QLAVFRPKVDEISLLTVNSTNFNPISNGGYMVAFAGRKYAARSTPVLVADGQHTITSFTL  137

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++ CKN+GG++DC++ IQL F
Sbjct  138  VLEFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGSIDCNISIQLIF  197

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK     NSWYE+K
Sbjct  198  SGTDKKLVALNSWYELK  214



>ref|XP_010498123.1| PREDICTED: uncharacterized protein LOC104775868 [Camelina sativa]
Length=246

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 6/197 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  270
            D N V+SPC+D+TV   DGFTFGI FA+++ +F   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-SFFGGSTNHTVQYSPCDRRRLSLNGNSEV  82

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+K+ +CKN+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDTKFVCLNNDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH +  NSWYEV
Sbjct  203  FSGTDKHYTALNSWYEV  219



>ref|XP_010486846.1| PREDICTED: uncharacterized protein LOC104764937 [Camelina sativa]
Length=246

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 6/197 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQL  270
            D N V+SPC+D+TV   DGFTFGI FA+++ +F   S N  VQ SPCDRR LSLN N+++
Sbjct  24   DDNGVYSPCSDSTVGIGDGFTFGIAFASKD-SFFGGSTNHTVQYSPCDRRRLSLNGNSEV  82

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+SFT
Sbjct  83   AVFRPKVDEITLLTINTSSSNNFRPDASKGYMVAFAGSKYAARSVPIMVADSNHIVTSFT  142

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EF+KGRL+N++WK+DGC+ C G + F CLN   CA+K+ +CKN+GG  DCSLGIQL 
Sbjct  143  LVLEFQKGRLENMFWKKDGCSKCSGDAKFVCLNTDQCAIKSQNCKNQGGQADCSLGIQLA  202

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKH +  NSWYEV
Sbjct  203  FSGTDKHYTALNSWYEV  219



>ref|XP_009759897.1| PREDICTED: uncharacterized protein LOC104212369 [Nicotiana sylvestris]
Length=237

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN VF PC+DT +Q+ DGFTFG+ F+++ + F N +     QLSPCD+RLSL  N+A
Sbjct  21   AGDTNPVFDPCSDTKIQRLDGFTFGLAFSSKESFFSNGT-----QLSPCDQRLSLSGNSA  75

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLT+ +S F P   GGYMVAFAGRKYAARS PAFVA+ ++ ++SFTL
Sbjct  76   QLAVFRPKVDEISLLTITSSDFNPSKAGGYMVAFAGRKYAARSLPAFVADNTHTITSFTL  135

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK+ GC SC G S F CLN  DCA+  N C   GG+VDC++GIQL F
Sbjct  136  VLEFQKGTLQNLFWKKFGCGSCTGGS-FVCLNKTDCAVPNNKCSGNGGSVDCNVGIQLAF  194

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK++ V NSWYEVK
Sbjct  195  SGTDKNDDVLNSWYEVK  211



>gb|EYU37728.1| hypothetical protein MIMGU_mgv1a012673mg [Erythranthe guttata]
 gb|EYU37729.1| hypothetical protein MIMGU_mgv1a012673mg [Erythranthe guttata]
Length=243

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 152/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN VF PC+DT VQKSDGFTFG+ F+++++ F N +     QLSPCDRRLSL   +AQL
Sbjct  29   DTNIVFDPCSDTKVQKSDGFTFGLAFSSKDSFFFNQT-----QLSPCDRRLSLAGTSAQL  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+N+++F P   GGYMVAFAGR+YAARSPP FV + S+ ++SFTLV 
Sbjct  84   AVFRPKVDEISLLTINSTTFNPSLFGGYMVAFAGRQYAARSPPVFVGDSSHTITSFTLVL  143

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+ GC+SC G S   CLN  DCA+  + CK   G++DC +G+QL FSG
Sbjct  144  EFQKGILQNLFWKKFGCSSCSGPS-LVCLNNTDCAVLNSKCKGNDGDIDCGVGVQLAFSG  202

Query  631  TDKHESVFNSWYEV  672
            TDK+E+V NSWYEV
Sbjct  203  TDKNENVLNSWYEV  216



>ref|XP_003559352.1| PREDICTED: uncharacterized protein LOC100825968 [Brachypodium 
distachyon]
Length=248

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 152/201 (76%), Gaps = 11/201 (5%)
 Frame = +1

Query  85   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-  261
            E+  D N V+ PCAD TVQ+ DGFTFG+ F++R++ F     + DVQLSPCD RL+L + 
Sbjct  27   EARGDGNGVYEPCADATVQRGDGFTFGVAFSSRDSFF-----SGDVQLSPCDSRLNLQSR  81

Query  262  AQLAVFRPKVDEISLLTVNTS---SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVS  432
            A LA+FRP VDEISLLT+N S   +F P S GGYMVAFAGRKYAARSPP FV+N SY V+
Sbjct  82   APLALFRPMVDEISLLTINASGGTAFDPASAGGYMVAFAGRKYAARSPPVFVSNSSYTVT  141

Query  433  SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRG-GNVDCSLG  609
             FTLV EF+KG LQN +WK DGC+SC G S F C++ Q CA+KT+SCK  G G VDCS G
Sbjct  142  GFTLVLEFQKGILQNFFWKTDGCSSCSGQSDFACVD-QSCAIKTSSCKGNGAGQVDCSPG  200

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQL FSGTDKHE V NSWYEV
Sbjct  201  IQLAFSGTDKHEEVLNSWYEV  221



>ref|XP_006651640.1| PREDICTED: uncharacterized protein LOC102702926, partial [Oryza 
brachyantha]
Length=217

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 151/196 (77%), Gaps = 8/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQ  267
            + D N V+ PC+D  +Q+ DGF+FGI FA   A F + S    V+LSPCDRRL+L + AQ
Sbjct  1    AGDGNGVYDPCSDARIQRGDGFSFGIAFA-NAAAFYSGS----VELSPCDRRLNLASPAQ  55

Query  268  LAVFRPKVDEISLLTVNTSSFF-PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            LAVFRPKVDEISLLT+NT++ F P S GGYMVAFAGRKYAARS P FV+N S+ VSSFTL
Sbjct  56   LAVFRPKVDEISLLTINTTTGFNPASAGGYMVAFAGRKYAARSTPTFVSNSSFTVSSFTL  115

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF KGRLQNL+WK+DGC +C  SS   CL  Q CA +T SCK++ G VDCS+GIQL F
Sbjct  116  VLEFNKGRLQNLHWKKDGCGACAKSSNLVCLGKQTCAFRTQSCKSQ-GPVDCSIGIQLAF  174

Query  625  SGTDKHESVFNSWYEV  672
            SGTDKHESV NSWYEV
Sbjct  175  SGTDKHESVLNSWYEV  190



>ref|XP_006651887.1| PREDICTED: uncharacterized protein LOC102713815, partial [Oryza 
brachyantha]
Length=222

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 150/197 (76%), Gaps = 11/197 (6%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            +TN V+ PCAD TVQ+ DGFTFG+ F+ R+A F     +  VQLSPCD RLSL    A+L
Sbjct  5    ETNGVYEPCADATVQRGDGFTFGVAFSGRDAFF-----SGGVQLSPCDSRLSLASGGAKL  59

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRPKVDEISLLTVNTS      P +  GYMVAFAGRKYAARS P FV+N SY V+S+T
Sbjct  60   AVFRPKVDEISLLTVNTSGGGGVDPATSDGYMVAFAGRKYAARSSPVFVSNISYTVTSYT  119

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LVFEFKKG LQNLYWK +GC++C G   F C++ Q+CA+ T +C  +GG+VDCS GIQL 
Sbjct  120  LVFEFKKGTLQNLYWKANGCSACSGQPSFACVD-QNCAISTANCTGKGGSVDCSPGIQLA  178

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKHE+V NSWYEV
Sbjct  179  FSGTDKHEAVLNSWYEV  195



>ref|XP_009590990.1| PREDICTED: uncharacterized protein LOC104088076 [Nicotiana tomentosiformis]
 ref|XP_009590991.1| PREDICTED: uncharacterized protein LOC104088076 [Nicotiana tomentosiformis]
Length=237

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN VF PC+DT +Q+ DGFTFG+ F+++ + F N +     QLSPCD+RLSL  N+AQL
Sbjct  23   DTNPVFDPCSDTKIQRWDGFTFGLAFSSKESFFSNGT-----QLSPCDQRLSLSANSAQL  77

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLT+ +S F P   G YMVAFAGRKYAARS PAFVA+ ++ ++SFTLV 
Sbjct  78   AVFRPKVDEISLLTITSSDFNPSKAGSYMVAFAGRKYAARSLPAFVADNTHTITSFTLVL  137

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+ GC SC G S F CLN  DCA+  N C   GG+VDC++GIQL FSG
Sbjct  138  EFQKGALQNLFWKKFGCGSCTGGS-FVCLNKTDCAVPNNKCNGNGGSVDCNVGIQLAFSG  196

Query  631  TDKHESVFNSWYEVK  675
            TDK++ V NSWYEVK
Sbjct  197  TDKNDDVLNSWYEVK  211



>emb|CDY08494.1| BnaA05g27300D [Brassica napus]
 emb|CDY01059.1| BnaC05g41410D [Brassica napus]
Length=245

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 9/201 (4%)
 Frame = +1

Query  88   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-N  261
            S+ D NHV+SPC+D+TV   DGFTFGI FAA+++       N+ VQ SPCDRR LSLN N
Sbjct  21   SAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFL---GTNRSVQYSPCDRRRLSLNGN  77

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIV  429
            ++LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V
Sbjct  78   SELAVFRPKVDEITLLTINTSSSSSSYRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVV  137

Query  430  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLG  609
            +SFTLV EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+K  SC N+GG VDCSLG
Sbjct  138  TSFTLVLEFQKGRLENLFWKKDGCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLG  197

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQL FSGTDKH +  NSWYEV
Sbjct  198  IQLAFSGTDKHYTALNSWYEV  218



>ref|XP_009146681.1| PREDICTED: uncharacterized protein LOC103870308 [Brassica rapa]
Length=247

 Score =   251 bits (642),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 9/201 (4%)
 Frame = +1

Query  88   SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-N  261
            S+ D NHV+SPC+D+TV   DGFTFGI FAA+++       N+ VQ SPCDRR LSLN N
Sbjct  23   SAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFL---GTNRSVQYSPCDRRRLSLNGN  79

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSV----GGYMVAFAGRKYAARSPPAFVANGSYIV  429
            ++LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V
Sbjct  80   SELAVFRPKVDEITLLTINTSSSSSSYRPDSSNGYMVAFAGAKYAARSVPIMVADNDHVV  139

Query  430  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLG  609
            +SFTLV EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+K  SC N+GG VDCSLG
Sbjct  140  TSFTLVLEFQKGRLENLFWKKDGCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLG  199

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQL FSGTDKH +  NSWYEV
Sbjct  200  IQLAFSGTDKHYTALNSWYEV  220



>ref|XP_009135184.1| PREDICTED: uncharacterized protein LOC103859409 [Brassica rapa]
 emb|CDX73852.1| BnaA03g31950D [Brassica napus]
Length=245

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 152/200 (76%), Gaps = 9/200 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NA  264
            + D N V+SPC+D+TV   DGFTFGI FAAR + F     N+ VQ SPCDRR LSL+ N+
Sbjct  22   AGDDNRVYSPCSDSTVAVGDGFTFGIAFAARASFF---GTNRSVQYSPCDRRRLSLSGNS  78

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIVS  432
            +LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  ++V+
Sbjct  79   ELAVFRPKVDEITLLTINTSSSSSSFRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVVT  138

Query  433  SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGI  612
            SFTLV EF+KGRL+NL+WK+DGC+ C G++ F CLN ++CA+K  SCKN+GG VDCSLGI
Sbjct  139  SFTLVLEFQKGRLENLFWKKDGCSKCSGNAKFVCLNKEECAIKRQSCKNQGGQVDCSLGI  198

Query  613  QLTFSGTDKHESVFNSWYEV  672
            QL FSGTDKH +  NSWYEV
Sbjct  199  QLAFSGTDKHYTALNSWYEV  218



>emb|CAN82373.1| hypothetical protein VITISV_027624 [Vitis vinifera]
Length=249

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 153/208 (74%), Gaps = 18/208 (9%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            + DTN VF PC+D  V++ DGFTFG+ F+ +++ F N +     QLSPCDRRLSL+  N+
Sbjct  21   ADDTNXVFDPCSDAKVKRFDGFTFGLAFSTKDSFFFNQT-----QLSPCDRRLSLSSTNS  75

Query  265  QLAVFRPKVDEISLLTVNTSSFFP-----------DSVGGYMVAFAGRKYAARSPPAFVA  411
            QLAVFRPKVDEISLLTVN+++F P            S GGYMVAFAGRKYAARS P  VA
Sbjct  76   QLAVFRPKVDEISLLTVNSTNFNPVWFNDFLVFSQISNGGYMVAFAGRKYAARSTPVLVA  135

Query  412  NGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGN  591
            +G + ++SFTLV EFKKG LQ+ YWK+ GC+ C  SS F CLN QDCA+K++ CKN+GG+
Sbjct  136  DGQHTITSFTLVLEFKKGTLQSFYWKKFGCSKCSKSSAFVCLNEQDCAVKSSHCKNQGGS  195

Query  592  VDCSLGIQLTFSGTDKHESVFNSWYEVK  675
            +DC++ IQL FSGTDK     NSWYE+K
Sbjct  196  IDCNISIQLIFSGTDKKLVALNSWYELK  223



>emb|CDO97124.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 155/199 (78%), Gaps = 8/199 (4%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-  258
            A  + DTN  F PC+D  VQ+SDGF+FG+ F+++++ F N +     QLSPCD+RLSL+ 
Sbjct  18   AVHAGDTNPEFDPCSDAKVQRSDGFSFGLAFSSKDSFFFNQT-----QLSPCDQRLSLSA  72

Query  259  -NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             +AQLA+FRPKVDE+SLLT+N+S+F P + GGYMVAFAGR+YAARS P FVA+ +  V+S
Sbjct  73   KSAQLAIFRPKVDEMSLLTINSSTFDPRNSGGYMVAFAGRRYAARSIPVFVADNAQTVTS  132

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF+KG LQNL+WK+ GC +C G S F C+N  DCA++ + CK  GG++DC++GIQ
Sbjct  133  FTLVLEFQKGTLQNLFWKKYGCDACSGDS-FVCMNNTDCAIRNSKCKGNGGSLDCNIGIQ  191

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDK++ V NSWYEV
Sbjct  192  LAFSGTDKNDDVLNSWYEV  210



>ref|XP_002519146.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43357.1| conserved hypothetical protein [Ricinus communis]
Length=237

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 151/199 (76%), Gaps = 9/199 (5%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--  255
            A +++D+N VFSPC+D  ++KSDGFTFG+ F+++ + F +      VQLSPCD RL+L  
Sbjct  20   AANAADSNDVFSPCSDAKIEKSDGFTFGLAFSSKESFFFDH-----VQLSPCDSRLALFS  74

Query  256  NNAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
              AQLAVFRPKVDEISLLT+N+S+F P   GGYMVAFAGRKYAARS P  VA+   IV+S
Sbjct  75   KMAQLAVFRPKVDEISLLTINSSTFNPGMSGGYMVAFAGRKYAARSFPVMVADNGIIVTS  134

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF++G LQNLYWK  GC  C  S  F CLNG+DCA+  + C++ GG++DC+LG+Q
Sbjct  135  FTLVLEFQQGILQNLYWKSFGCDKC--SKDFVCLNGKDCAVHNSKCRSNGGHIDCNLGVQ  192

Query  616  LTFSGTDKHESVFNSWYEV  672
            LTFSGTDK+    NSWYEV
Sbjct  193  LTFSGTDKNLETLNSWYEV  211



>ref|XP_008374037.1| PREDICTED: uncharacterized protein LOC103437345 [Malus domestica]
 ref|XP_008374038.1| PREDICTED: uncharacterized protein LOC103437345 [Malus domestica]
Length=239

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 146/197 (74%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            ++DTN V+ PC+D  +Q+ DGFTFG+ F+ ++  F N +     QLSPCD+RLSL  N+A
Sbjct  33   AADTNSVYDPCSDAKIQRLDGFTFGLAFSKKDKFFFNQT-----QLSPCDKRLSLTGNDA  87

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDE+S L++N S+F P   GGYMVAFAGRKYAARSPP  VA+ S+ ++SFTL
Sbjct  88   QLAVFRPKVDEMSFLSINNSTFSPIKAGGYMVAFAGRKYAARSPPILVADDSHTITSFTL  147

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G L NLYWK+ GC +C G     CLN +DCA+  + CK  GG+ DC+L IQL F
Sbjct  148  VLEFERGTLLNLYWKKFGCKACSGDYS-VCLNDEDCAVPNSKCKGSGGSFDCNLSIQLAF  206

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH  V NSWYEVK
Sbjct  207  SGTDKHLQVLNSWYEVK  223



>ref|XP_011088314.1| PREDICTED: uncharacterized protein LOC105169588 [Sesamum indicum]
Length=242

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 152/196 (78%), Gaps = 8/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            + DTN  FSPC+D  VQ+ DGFTFG+ F+++ + F N +     QLSPCDRRLSL+  NA
Sbjct  26   AGDTNIEFSPCSDAKVQRFDGFTFGLAFSSKESFFFNQT-----QLSPCDRRLSLSGYNA  80

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLT+N+++F P   GGYMVAFAGR+YAARS P FVA+    ++SFTL
Sbjct  81   QLAVFRPKVDEISLLTINSAAFNPSKAGGYMVAFAGRQYAARSIPVFVADDINTITSFTL  140

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V +F+KG LQNL+WK+ GC SC G+S F CLN  DCA+  + CK+ GG++ C LGIQ+TF
Sbjct  141  VLDFRKGTLQNLFWKKFGCGSCTGNS-FVCLNNTDCAVPNSKCKSNGGSIGCDLGIQVTF  199

Query  625  SGTDKHESVFNSWYEV  672
            SGTD++++V NSWYEV
Sbjct  200  SGTDRNDNVLNSWYEV  215



>ref|XP_004981507.1| PREDICTED: uncharacterized protein LOC101763233 [Setaria italica]
Length=244

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 147/193 (76%), Gaps = 7/193 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  273
            D N V+ PCADTTV + DGFTFG+ F  R+A F     +  VQLSPCD RL L+N AQ+A
Sbjct  31   DRNGVYDPCADTTVGRGDGFTFGVAFTGRDAFF-----SGGVQLSPCDSRLGLSNRAQVA  85

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            +FRP+VDEISLLT+N+SSF P S GGYMVAFAGRKYAARS P FV N SY V+SFTLV E
Sbjct  86   LFRPQVDEISLLTINSSSFDPSSSGGYMVAFAGRKYAARSAPVFVGNSSYTVTSFTLVLE  145

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KGRL+NL+WK   C SC G + F C++ + CA+KT SCK +GG  DCS GIQL FSGT
Sbjct  146  FQKGRLENLFWKDGDCKSCSGRADFACVD-KSCAVKTTSCKGKGGQADCSPGIQLAFSGT  204

Query  634  DKHESVFNSWYEV  672
            DKHE V NSWYEV
Sbjct  205  DKHEDVLNSWYEV  217



>ref|XP_006407410.1| hypothetical protein EUTSA_v10021362mg [Eutrema salsugineum]
 gb|ESQ48863.1| hypothetical protein EUTSA_v10021362mg [Eutrema salsugineum]
Length=257

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 154/210 (73%), Gaps = 17/210 (8%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NA  264
            + D N V+SPC+D+TV   DGFTFGI FAAR+ +F   +++  VQ SPCDRR LSLN N+
Sbjct  22   AGDDNRVYSPCSDSTVAIGDGFTFGIAFAARD-SFFGTNRSVRVQYSPCDRRRLSLNGNS  80

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVG----GYMVAFAGRKYAARSPPAFVANGSYIVS  432
            +LAVFRPKVDEI+LLT+NTSS           GYMVAFAG KYAARS P  VA+  +IV+
Sbjct  81   ELAVFRPKVDEITLLTINTSSSSSSFRPDSSKGYMVAFAGAKYAARSVPIMVADNDHIVT  140

Query  433  SFTL----------VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNR  582
            SFTL          V EF+KGRL+NL+WK+DGC+ C G + F CLN ++CA+KT +CKNR
Sbjct  141  SFTLFCNIHLSTRLVLEFQKGRLENLFWKKDGCSKCSGDAKFVCLNKEECAIKTQNCKNR  200

Query  583  GGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            GG VDCSLGIQL FSGTDKH +  NSWYEV
Sbjct  201  GGQVDCSLGIQLAFSGTDKHYTALNSWYEV  230



>gb|EPS70295.1| hypothetical protein M569_04465, partial [Genlisea aurea]
Length=227

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 10/199 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN V+SPC+D  VQK+DGFTFG+ F++RN+ F N +     QLSPCD RLSL   NA
Sbjct  15   AGDTNPVYSPCSDAKVQKNDGFTFGLAFSSRNSFFFNQT-----QLSPCDNRLSLAGTNA  69

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEI+LLTVN+S+F P   GGYMVAFAGR+YAARS P FVA+ ++ ++SFTL
Sbjct  70   QLAIFRPKVDEITLLTVNSSTFNPSLAGGYMVAFAGRQYAARSQPVFVADNTHTITSFTL  129

Query  445  VFEFKKGRLQNLYWKR---DGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            VFEF+KG L+NLYWK+      +   G +   CLNG DCA++++ C + GG V+C LGIQ
Sbjct  130  VFEFQKGTLENLYWKKFGCSSSSCGGGGASLVCLNGTDCAVQSSQCTSNGGTVECDLGIQ  189

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDK+++V NSWYEV
Sbjct  190  LAFSGTDKNDAVMNSWYEV  208



>ref|XP_010690983.1| PREDICTED: uncharacterized protein LOC104904437 [Beta vulgaris 
subsp. vulgaris]
Length=241

 Score =   243 bits (621),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            DTN V  PC DT VQ+ DGFTFG+ F+++ + +  D     VQLSPCD RL L N AQLA
Sbjct  32   DTNPVHDPCTDTKVQRWDGFTFGLAFSSKESFYAPDQ----VQLSPCDSRLQLVNKAQLA  87

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRP+VDEISLLT+N S+F PD+ GGYMVAFAGR YAARSPP FVA+ + IV+SFTLV E
Sbjct  88   VFRPRVDEISLLTIN-STFSPDTSGGYMVAFAGRAYAARSPPVFVADSTNIVTSFTLVLE  146

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KG LQNLYWK+ GC SCK      C + Q+CA+ T+ CK++GG +DC++ IQLTFSGT
Sbjct  147  FEKGILQNLYWKKFGCDSCKDYH--ICKDNQECAVPTSKCKDKGGPIDCTISIQLTFSGT  204

Query  634  DKHESVFNSWYEVK  675
            D++  V NSWYE+K
Sbjct  205  DRNSEVLNSWYEMK  218



>ref|XP_003561838.1| PREDICTED: uncharacterized protein LOC100825689 [Brachypodium 
distachyon]
Length=243

 Score =   243 bits (621),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 152/195 (78%), Gaps = 8/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQLA  273
            DTN V+ PC+D+ +Q+ DGFTFG+ FA  +A F     +   QLSPCDRRL+L N +QLA
Sbjct  27   DTNGVYDPCSDSRIQRGDGFTFGLAFAGSSAFF-----SGSTQLSPCDRRLNLANPSQLA  81

Query  274  VFRPKVDEISLLTVNTSS-FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            VFRPKVDEISLLTVNT++ F P S GGYMVAFAGRKYAARS P FV+N S  VSSFTLV 
Sbjct  82   VFRPKVDEISLLTVNTTTGFSPASAGGYMVAFAGRKYAARSAPVFVSNSSVTVSSFTLVL  141

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRG-GNVDCSLGIQLTFS  627
            EF KGRLQNL+WK+DGC +C G S F CL  Q CA++TN CK++  G +DCS+GIQL FS
Sbjct  142  EFNKGRLQNLHWKKDGCGACSGKSNFICLGKQTCAIRTNVCKSQNQGTMDCSIGIQLAFS  201

Query  628  GTDKHESVFNSWYEV  672
            GTDKHESV NSWYEV
Sbjct  202  GTDKHESVLNSWYEV  216



>ref|NP_001149996.1| expp1 protein precursor [Zea mays]
 gb|ACG37435.1| expp1 protein precursor [Zea mays]
 gb|AFW67425.1| expp1 protein [Zea mays]
Length=244

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 149/193 (77%), Gaps = 7/193 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  31   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  85

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV E
Sbjct  86   LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLVLE  145

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KG LQNL+WK  GC+SC G S F C++G  CA++T SC+ +GG V+CS GIQL FSGT
Sbjct  146  FQKGTLQNLFWKAGGCSSCSGRSDFACVDG-SCAVRTASCRGKGGQVECSPGIQLAFSGT  204

Query  634  DKHESVFNSWYEV  672
            D+HE+V NSWYEV
Sbjct  205  DRHEAVLNSWYEV  217



>ref|XP_007199436.1| hypothetical protein PRUPE_ppa026636mg [Prunus persica]
 gb|EMJ00635.1| hypothetical protein PRUPE_ppa026636mg [Prunus persica]
Length=214

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 148/197 (75%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            ++DTN V+ PC+D  +++ DGFTFG+ F+ +++   N +     QLSPCD RL+L  NNA
Sbjct  8    AADTNSVYDPCSDAKIRRLDGFTFGLAFSKKDSFAFNQT-----QLSPCDSRLNLAGNNA  62

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDE+SLLT+N+S+F P + GGYMVAFAGRKYAARS P  +A+ S  ++SFTL
Sbjct  63   QLAVFRPKVDEMSLLTINSSTFSPINAGGYMVAFAGRKYAARSLPTLIADESNTITSFTL  122

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNLYWK+ GC +C G     CLN +DCA+  + CK+ GG+ DC+L IQL F
Sbjct  123  VLEFQRGTLQNLYWKKFGCKACSGDYS-VCLNNEDCAVPNSKCKSSGGSFDCNLSIQLAF  181

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDKH  V NSWYEV+
Sbjct  182  SGTDKHLQVLNSWYEVR  198



>ref|XP_008236692.1| PREDICTED: uncharacterized protein LOC103335461 [Prunus mume]
Length=233

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 146/196 (74%), Gaps = 8/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            ++DTN V+ PC+D  +++ DGFTFG+ F+ +++   N +     QLSPCD RL+L  NNA
Sbjct  27   AADTNSVYDPCSDAKIRRLDGFTFGLAFSKKDSFSFNQT-----QLSPCDSRLNLAGNNA  81

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDE+SLLT+N+S+F P   GGYMVAFAGRKYAARS P  VA+ S  ++SFTL
Sbjct  82   QLAVFRPKVDEMSLLTINSSTFSPIKAGGYMVAFAGRKYAARSLPTLVADDSNTITSFTL  141

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNLYWK+ GC +C G     CLN +DCA+  + CK+ GG+ DC+L IQL F
Sbjct  142  VLEFQRGTLQNLYWKKFGCKACSGDYS-VCLNNEDCAVPNSKCKSSGGSFDCNLSIQLAF  200

Query  625  SGTDKHESVFNSWYEV  672
            SGTDKH  V NSWYEV
Sbjct  201  SGTDKHLQVLNSWYEV  216



>ref|XP_010096267.1| hypothetical protein L484_027004 [Morus notabilis]
 gb|EXB63662.1| hypothetical protein L484_027004 [Morus notabilis]
Length=242

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 147/197 (75%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            ++DTN V+ PC+D+ VQK DGFTFG+ F+ + + F N +     QLSPCD+RLSL+  N+
Sbjct  26   AADTNDVYDPCSDSKVQKLDGFTFGLAFSTKESFFFNQT-----QLSPCDKRLSLSDSNS  80

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLL+++ ++F P + GGYMVAFAGR YAARS P  VA+ ++ ++SFTL
Sbjct  81   QLAVFRPKVDEISLLSIDGNTFDPATSGGYMVAFAGRNYAARSQPILVADSTHSITSFTL  140

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+ G LQNLYWK+ GC  C G   F CLN QDCA+  + CK+ GG  DC+L IQLTF
Sbjct  141  VLEFQSGTLQNLYWKKFGCDKCSGGP-FVCLNEQDCAVPNSKCKSNGGTFDCNLSIQLTF  199

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEVK
Sbjct  200  SGTDKNLDALNSWYEVK  216



>ref|XP_010263791.1| PREDICTED: uncharacterized protein LOC104601968 isoform X4 [Nelumbo 
nucifera]
Length=235

 Score =   238 bits (608),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 139/195 (71%), Gaps = 23/195 (12%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN ++ PC+D  + KSDGFT G+ F+++ + F      + +QLSPCDRRLSL+   AQL
Sbjct  36   DTNDIYDPCSDAKILKSDGFTLGLAFSSKESFFF-----EKIQLSPCDRRLSLSTKIAQL  90

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPK                D  GGYMVAFAGRKYAARS P FVAN SYI++SFTLV 
Sbjct  91   AVFRPK----------------DMYGGYMVAFAGRKYAARSQPTFVANSSYIITSFTLVL  134

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK+DGCA+C G S F CLN QDCA + ++C++ GG  DCSLGIQL FSG
Sbjct  135  EFQKGTLQNLHWKKDGCATCAGKSSFICLNLQDCATRISNCQSHGGPFDCSLGIQLAFSG  194

Query  631  TDKHESVFNSWYEVK  675
            TDK + V NSWYEVK
Sbjct  195  TDKSDEVLNSWYEVK  209



>ref|XP_009417070.1| PREDICTED: uncharacterized protein LOC103997543 [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 147/194 (76%), Gaps = 6/194 (3%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            D N VF PCAD  VQ+ DGFTFGI F+ R++  +N S    +QLSPCD RLSL+   AQL
Sbjct  27   DKNSVFQPCADAKVQRWDGFTFGIAFSGRDSFLLNQS----LQLSPCDSRLSLSTRGAQL  82

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVDEISLLTVNT++    + GG+MVAFAGRKYAARS P FV N SY ++SFTLV 
Sbjct  83   AVFRPKVDEISLLTVNTTTNPSINSGGFMVAFAGRKYAARSSPVFVGNSSYAITSFTLVL  142

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF KG LQ+L+WK   C+SC G S F CL  Q CA+K  +CK +GG+VDCS+GIQL FSG
Sbjct  143  EFHKGTLQDLHWKTGSCSSCSGKSSFVCLREQGCAIKAPNCKGQGGSVDCSIGIQLAFSG  202

Query  631  TDKHESVFNSWYEV  672
            TDKH++V NSWYEV
Sbjct  203  TDKHDAVLNSWYEV  216



>dbj|BAJ94664.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 144/204 (71%), Gaps = 13/204 (6%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A +  D N V+ PCAD TV + DGFTFG+ FA R+A F     +  VQLSPCD RL L N
Sbjct  28   ASARGDGNGVYEPCADATVSRGDGFTFGVAFAGRDAFF-----SGGVQLSPCDGRLPLQN  82

Query  262  -AQLAVFRPKVDEISLLTVNTSSFFP-DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             A+LA+FRP VDEISLLTVN S      S GGYMVAFAGRK+AARSPP FV N SY V+ 
Sbjct  83   TAKLALFRPTVDEISLLTVNASGAGDLTSAGGYMVAFAGRKFAARSPPVFVGNSSYTVTG  142

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK-----NRGGNVDC  600
            FTLVFEF KG LQNL+WK DGC+SC G + F C+    CA+KT+SC+        G VDC
Sbjct  143  FTLVFEFHKGTLQNLFWKADGCSSCSGQANFGCVE-NSCAIKTSSCRGGNGGGGAGQVDC  201

Query  601  SLGIQLTFSGTDKHESVFNSWYEV  672
            S GIQL FSGTDKHE+V NSWYEV
Sbjct  202  SPGIQLAFSGTDKHEAVLNSWYEV  225



>dbj|BAJ90624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 144/204 (71%), Gaps = 13/204 (6%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A +  D N V+ PCAD TV + DGFTFG+ FA R+A F     +  VQLSPCD RL L N
Sbjct  28   ASARGDGNGVYEPCADATVSRGDGFTFGVAFAGRDAFF-----SGGVQLSPCDGRLPLQN  82

Query  262  -AQLAVFRPKVDEISLLTVNTSSFFP-DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             A+LA+FRP VDEISLLTVN S      S GGYMVAFAGRK+AARSPP FV N SY V+ 
Sbjct  83   TAKLALFRPTVDEISLLTVNASGAGDLTSAGGYMVAFAGRKFAARSPPVFVGNSSYTVTG  142

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCK-----NRGGNVDC  600
            FTLVFEF KG LQNL+WK DGC+SC G + F C+    CA+KT+SC+        G VDC
Sbjct  143  FTLVFEFHKGTLQNLFWKADGCSSCSGQANFGCVE-NSCAIKTSSCRGGNGGGGAGQVDC  201

Query  601  SLGIQLTFSGTDKHESVFNSWYEV  672
            S GIQL FSGTDKHE+V NSWYEV
Sbjct  202  SPGIQLAFSGTDKHEAVLNSWYEV  225



>ref|XP_010526940.1| PREDICTED: uncharacterized protein LOC104804369 [Tarenaya hassleriana]
 ref|XP_010526941.1| PREDICTED: uncharacterized protein LOC104804369 [Tarenaya hassleriana]
Length=246

 Score =   238 bits (608),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 143/194 (74%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN VFSPC+D  + K DGFTFG+V +++ A F     N  +QLSPCD RL L   NA+L
Sbjct  35   DTNGVFSPCSDVQISKGDGFTFGVVISSKEAFF-----NNKIQLSPCDSRLGLASKNAKL  89

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            A+FRPKVDEISLL+++T+ F P   GG+MVAFAG KYAARS PA +A+GS  ++SFTLV 
Sbjct  90   ALFRPKVDEISLLSIDTTQFSPSEAGGHMVAFAGSKYAARSFPAKIADGSNTITSFTLVM  149

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF+KG LQNL+WK  GC SCK  S   CLNG DCA+ ++ CK  GG V+C +GIQLTFSG
Sbjct  150  EFQKGTLQNLFWKSFGCDSCKSGSS-VCLNGTDCAVPSSKCKGNGGRVNCDIGIQLTFSG  208

Query  631  TDKHESVFNSWYEV  672
            TDK+    NSWYEV
Sbjct  209  TDKNLESLNSWYEV  222



>gb|KDP38260.1| hypothetical protein JCGZ_04903 [Jatropha curcas]
Length=238

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 145/194 (75%), Gaps = 9/194 (5%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN VFSPC D  V KSDGFTFG+ F+++ + F +      VQLSPCD RLSL+   AQL
Sbjct  26   DTNDVFSPCLDAKVAKSDGFTFGLAFSSKESFFFDQ-----VQLSPCDIRLSLSTKTAQL  80

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            ++FRP VDE+SLLT+N+++F P   GGYMVAFAGRKYAARS P  +A+ + I++SFTLV 
Sbjct  81   SIFRPIVDELSLLTINSTTFDPVKFGGYMVAFAGRKYAARSLPIMMADNNLIITSFTLVL  140

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF++G LQNLYWK  GC +C  SSGF CLN +DCA++T+ C   GG++DCS  IQL FSG
Sbjct  141  EFQEGTLQNLYWKNFGCETC--SSGFVCLNEKDCAIQTSKCTVHGGSIDCSPSIQLAFSG  198

Query  631  TDKHESVFNSWYEV  672
            TDK+    NSWYEV
Sbjct  199  TDKNLESLNSWYEV  212



>ref|XP_008459230.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
 ref|XP_008459231.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
 ref|XP_008459232.1| PREDICTED: uncharacterized protein LOC103498418 [Cucumis melo]
Length=235

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 145/194 (75%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL   NAQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDARLSLASKNAQL  78

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            AVFRPKVD++S LT++TS+F P   GGYMVAFAG+KYAARS P  V + S+ ++SFTLVF
Sbjct  79   AVFRPKVDQLSFLTIDTSTFNPALNGGYMVAFAGQKYAARSLPVMVTDNSHTITSFTLVF  138

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF++G LQNL+WK+ GC  C G     C++ QDCA+ ++ CK  GG+VDC+LGIQL FSG
Sbjct  139  EFERGTLQNLFWKKFGCDKCSGDFSL-CVDNQDCAILSSKCKYSGGSVDCNLGIQLAFSG  197

Query  631  TDKHESVFNSWYEV  672
            TDK+  V NSWYE+
Sbjct  198  TDKNLEVLNSWYEI  211



>ref|XP_009136289.1| PREDICTED: uncharacterized protein LOC103860439 [Brassica rapa]
Length=241

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 140/195 (72%), Gaps = 7/195 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            D N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    AQL
Sbjct  29   DNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMAQL  83

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
            A+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTLV 
Sbjct  84   ALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTLVM  143

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF++G LQNL+W   GC SCKG S   CLNG DCA+ T  CK  GG  +C++GIQ+ FSG
Sbjct  144  EFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAFSG  203

Query  631  TDKHESVFNSWYEVK  675
            TDK+    NSWYEV+
Sbjct  204  TDKNLETLNSWYEVR  218



>ref|XP_010517082.1| PREDICTED: uncharacterized protein LOC104792590 [Camelina sativa]
Length=233

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 140/196 (71%), Gaps = 7/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  19   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  73

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+GS  +++FTL
Sbjct  74   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADGSNTITAFTL  133

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+ CK  GG  +C++GIQ+ F
Sbjct  134  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  193

Query  625  SGTDKHESVFNSWYEV  672
            SGTDK+    N+WYEV
Sbjct  194  SGTDKNLESLNTWYEV  209



>ref|XP_010467337.1| PREDICTED: uncharacterized protein LOC104747407 [Camelina sativa]
Length=239

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 140/196 (71%), Gaps = 7/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  25   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  79

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+GS  +++FTL
Sbjct  80   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADGSNTITAFTL  139

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+ CK  GG  +C++GIQ+ F
Sbjct  140  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  199

Query  625  SGTDKHESVFNSWYEV  672
            SGTDK+    N+WYEV
Sbjct  200  SGTDKNLESLNTWYEV  215



>ref|XP_010066065.1| PREDICTED: uncharacterized protein LOC104453239 [Eucalyptus grandis]
Length=244

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 146/197 (74%), Gaps = 11/197 (6%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN VF PC+DT +QK DGF+FG+ F+ + + F      + +QLSPCD RL L  ++A
Sbjct  31   AEDTNLVFDPCSDTKIQKGDGFSFGLAFSTKESFFF-----QQIQLSPCDNRLPLAGSSA  85

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAV+RPKVDEISLLT+N+S+F P   GGYMVAFAG KYAARS P  VA+ ++ ++SFTL
Sbjct  86   QLAVYRPKVDEISLLTINSSTFNPGMSGGYMVAFAGHKYAARSLPVQVADSTHTITSFTL  145

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNLYWK+ GC SC G S   CLN +DCA+  + C + G    C++GIQLTF
Sbjct  146  VLEFQKGTLQNLYWKKFGCDSCPGDST-VCLNNEDCAVPNSKCSHAGA---CNIGIQLTF  201

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK++ V NSWYEVK
Sbjct  202  SGTDKNDVVLNSWYEVK  218



>ref|XP_006299440.1| hypothetical protein CARUB_v10015605mg, partial [Capsella rubella]
 gb|EOA32338.1| hypothetical protein CARUB_v10015605mg, partial [Capsella rubella]
Length=247

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 140/196 (71%), Gaps = 7/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      VQLSPCD RL L    A
Sbjct  33   ASDNNAVYSPCSDTQISKGDGFTIGVAISSKEAFFLDQ-----VQLSPCDSRLGLAAKMA  87

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS PA V +GS  +++FTL
Sbjct  88   QLALFRPKVDEISLLSIDTSKFSPSEAGGYMVGFAGSKYAARSYPAKVVDGSNTITAFTL  147

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK  GC  CKG +   CLNG DCA+ T+ CK  GG  +C++GIQ+ F
Sbjct  148  VMEFQKGVLQNLFWKSFGCDLCKGGTSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  207

Query  625  SGTDKHESVFNSWYEV  672
            SGTDK+    N+WYEV
Sbjct  208  SGTDKNLESLNTWYEV  223



>ref|XP_002463772.1| hypothetical protein SORBIDRAFT_01g005890 [Sorghum bicolor]
 gb|EER90770.1| hypothetical protein SORBIDRAFT_01g005890 [Sorghum bicolor]
Length=245

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 150/193 (78%), Gaps = 7/193 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++ F     +  VQLSPCD RL L N AQLA
Sbjct  32   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSFF-----SGGVQLSPCDSRLGLANRAQLA  86

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            ++RP+VDEISLLTVN+SSF P S GGYMVAFAG+KYAARS P FVAN SY V+ FTLV E
Sbjct  87   LYRPQVDEISLLTVNSSSFDPSSSGGYMVAFAGKKYAARSTPVFVANTSYTVTGFTLVLE  146

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KG LQNL+WK  GC+SC G S F C++   CA+KT SCK +GG VDC+ GIQL FSGT
Sbjct  147  FQKGTLQNLFWKPSGCSSCSGRSDFACVD-SSCAIKTTSCKGKGGQVDCNPGIQLAFSGT  205

Query  634  DKHESVFNSWYEV  672
            DKHE+V NSWYEV
Sbjct  206  DKHEAVLNSWYEV  218



>emb|CDY02274.1| BnaA03g38930D [Brassica napus]
Length=350

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  136  ASDNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  190

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTL
Sbjct  191  QLALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTL  250

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNL+W   GC SCKG S   CLNG DCA+ T  CK  GG  +C++GIQ+ F
Sbjct  251  VMEFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAF  310

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEV+
Sbjct  311  SGTDKNLESLNSWYEVR  327



>ref|XP_008643755.1| PREDICTED: expp1 protein isoform X1 [Zea mays]
Length=778

 Score =   244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 149/193 (77%), Gaps = 7/193 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  565  DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  619

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV E
Sbjct  620  LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLVLE  679

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+KG LQNL+WK  GC+SC G S F C++G  CA++T SC+ +GG V+CS GIQL FSGT
Sbjct  680  FQKGTLQNLFWKAGGCSSCSGRSDFACVDG-SCAVRTASCRGKGGQVECSPGIQLAFSGT  738

Query  634  DKHESVFNSWYEV  672
            D+HE+V NSWYEV
Sbjct  739  DRHEAVLNSWYEV  751



>emb|CDX89683.1| BnaC03g45970D [Brassica napus]
Length=350

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 142/197 (72%), Gaps = 7/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  136  ASDNNVVYSPCSDTEISKGDGFTVGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  190

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS PA VA+GS+ ++SFTL
Sbjct  191  QLALFRPKVDEISLLSIDTSKFNPSEAGGHMVGFAGSKYAARSYPAKVADGSHTITSFTL  250

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNL+W   GC SCKG S   CLNG DCA+ T  CK  GG  +C++GIQ+ F
Sbjct  251  VMEFQRGVLQNLFWNNFGCDSCKGGSSSVCLNGTDCAVPTAKCKANGGEANCNIGIQVAF  310

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEV+
Sbjct  311  SGTDKNLESLNSWYEVR  327



>gb|ACF84480.1| unknown [Zea mays]
 gb|AFW68145.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_851126 [Zea 
mays]
Length=227

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 137/193 (71%), Gaps = 23/193 (12%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRPK                 S GG+MVAFAGRKYAARS P FV+N S  VSSFTLV E
Sbjct  85   VFRPKA----------------SAGGFMVAFAGRKYAARSIPIFVSNTSVTVSSFTLVLE  128

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F KGRL+NL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSGT
Sbjct  129  FNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  187

Query  634  DKHESVFNSWYEV  672
            DKHESV NSWYEV
Sbjct  188  DKHESVLNSWYEV  200



>ref|XP_006409495.1| hypothetical protein EUTSA_v10023083mg [Eutrema salsugineum]
 gb|ESQ50948.1| hypothetical protein EUTSA_v10023083mg [Eutrema salsugineum]
Length=335

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 141/196 (72%), Gaps = 7/196 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  +++ A F++      +QLSPCD RL L    A
Sbjct  121  ASDNNAVYSPCSDTQISKGDGFTIGVAISSKEAFFLDQ-----IQLSPCDSRLGLAAKMA  175

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+ S  +++FTL
Sbjct  176  QLALFRPKVDEISLLSIDTSKFNPSEAGGYMVGFAGSKYAARSYPVKVADASNTITAFTL  235

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNL+WK  GC SCKG+S   CLNG DCA+ T+ CK  GG  +C++GIQ+ F
Sbjct  236  VMEFQKGVLQNLFWKNFGCDSCKGASSSVCLNGTDCAVPTSKCKANGGEANCNIGIQVAF  295

Query  625  SGTDKHESVFNSWYEV  672
            SGT+K+    NSWYEV
Sbjct  296  SGTEKNLESLNSWYEV  311



>ref|XP_004507366.1| PREDICTED: uncharacterized protein LOC101506783 [Cicer arietinum]
Length=252

 Score =   229 bits (583),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 141/197 (72%), Gaps = 9/197 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQK DGFTFGI F+ +  TF  D+     QLSPCD RL L N  A
Sbjct  37   AADTNDVYSPCHDAKVQKDDGFTFGIAFSNKQ-TFTPDNGP---QLSPCDSRLDLPNKGA  92

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLT+N S+  P + GGYMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  93   QLAVFRPKVDEISLLTINKSTLNPATTGGYMVAFAGQKYAARSLPIMFADDSHTITSFTL  152

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF +G LQNL+WK  GC SC G S   CLN QDCA+    C+   G++ C++GIQLTF
Sbjct  153  VLEFHEGTLQNLFWKSFGCGSCPGGS--VCLNKQDCAVPNTKCQTN-GDISCNIGIQLTF  209

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEVK
Sbjct  210  SGTDKNLDALNSWYEVK  226



>gb|KDO39918.1| hypothetical protein CISIN_1g040802mg [Citrus sinensis]
Length=245

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            +DTN +F+PC D+ V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  33   ADTNIIFNPCDDSKVKRWDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALPTKNAK  87

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  88   LAIFRPKVDEISLLTIDDTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  147

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++G L+NLYWK  GC SC G +   C+N   CA+    C+N GG +DC++GIQLTFS
Sbjct  148  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNIGIQLTFS  206

Query  628  GTDKHESVFNSWYEVK  675
            GTD+   V NSWYEV+
Sbjct  207  GTDEKRQVLNSWYEVE  222



>ref|XP_002885990.1| hypothetical protein ARALYDRAFT_319534 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62249.1| hypothetical protein ARALYDRAFT_319534 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = +1

Query  85   ESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--N  258
            + SSD N V+SPC+DT + K DGFT GI  +++ A F++      VQLSPCD RL L   
Sbjct  139  DDSSDNNPVYSPCSDTQISKGDGFTIGIAISSKEAFFLDQ-----VQLSPCDSRLGLAAK  193

Query  259  NAQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  438
             AQLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS P  VA+GS  +++F
Sbjct  194  MAQLALFRPKVDEISLLSIDTSKFNPSEAGGFMVGFAGSKYAARSSPVKVADGSNTITAF  253

Query  439  TLVFEFKKGRLQNLYWKRDGCASCKG---SSGFTCLNGQDCAMKTNSCKNRGGNVDCSLG  609
            TLV EF+KG LQNL+WK  GC SCKG   SS   CLNG DCA+ T+ CK  GG  +C++G
Sbjct  254  TLVLEFQKGVLQNLFWKSFGCDSCKGIGSSSSSVCLNGTDCAVPTSKCKANGGEANCNIG  313

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQ+ FSGTDK+    N+WYEV
Sbjct  314  IQVAFSGTDKNLESLNTWYEV  334



>ref|XP_006423087.1| hypothetical protein CICLE_v10029171mg [Citrus clementina]
 gb|ESR36327.1| hypothetical protein CICLE_v10029171mg [Citrus clementina]
Length=244

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 143/196 (73%), Gaps = 8/196 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            +DTN +F+PC DT V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  32   ADTNIIFNPCDDTKVKRLDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALATKNAK  86

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            L +FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  87   LTIFRPKVDEISLLTIDGTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  146

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++G L+NLYWK  GC SC G +   C+N   CA+    C+N GG +DC++GIQLTFS
Sbjct  147  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNVGIQLTFS  205

Query  628  GTDKHESVFNSWYEVK  675
            GTD+   V NSWYEV+
Sbjct  206  GTDEKRQVLNSWYEVE  221



>ref|XP_006480155.1| PREDICTED: uncharacterized protein LOC102615233 [Citrus sinensis]
Length=249

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQ  267
            +DTN +F+PC D+ V++ DGFTFG+ F+ + A F++      +QLSPCD RL+L   NA+
Sbjct  37   ADTNIIFNPCDDSKVKRWDGFTFGLAFSTKEAFFLDQ-----IQLSPCDSRLALPTKNAK  91

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            LA+FRPKVDEISLLT++ ++F P   GGY+VAFAGRKYAARS P  VA+ ++ V++ TLV
Sbjct  92   LAIFRPKVDEISLLTIDDTNFNPILSGGYVVAFAGRKYAARSAPTLVADSTHTVTNLTLV  151

Query  448  FEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFS  627
             EF++G L+NLYWK  GC SC G +   C+N   CA+    C+N GG +DC++GIQLTFS
Sbjct  152  LEFQQGTLENLYWKSLGCDSCSGETS-VCINNTVCAVPNLKCRNHGGPIDCNIGIQLTFS  210

Query  628  GTDKHESVFNSWYEVK  675
            GTD+   V NSWYEV+
Sbjct  211  GTDEKRQVLNSWYEVE  226



>ref|XP_011005674.1| PREDICTED: uncharacterized protein LOC105111893 [Populus euphratica]
Length=249

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 11/201 (5%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A +++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL L+ 
Sbjct  29   AINAADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLGLSK  83

Query  262  -AQLAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIV  429
             AQLAVFRP+VDEISLLT+N+S   P +   +G +MVAFAGRK+AARS P  +++ + I+
Sbjct  84   KAQLAVFRPQVDEISLLTINSSPSDPGAPGPLGSHMVAFAGRKHAARSFPVMISDNNTII  143

Query  430  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLG  609
            +SFTLV EF+KG LQNLYWK+ GC SC  S  F CL G+DCA+  + CK+ GG  DC L 
Sbjct  144  TSFTLVLEFQKGTLQNLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKSNGGANDCVLS  201

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQLTFSGTDK+    NSWYEV
Sbjct  202  IQLTFSGTDKNLQALNSWYEV  222



>ref|XP_006384473.1| hypothetical protein POPTR_0004s15390g [Populus trichocarpa]
 gb|ERP62270.1| hypothetical protein POPTR_0004s15390g [Populus trichocarpa]
Length=224

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 11/201 (5%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A +++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL+L+ 
Sbjct  4    AINAADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLALSK  58

Query  262  -AQLAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIV  429
             AQLAVFRP+VDEISLLT+N+S   P +   +G YMVAFAGRK+AARS P  +++ + I+
Sbjct  59   KAQLAVFRPQVDEISLLTINSSPSDPGAPGPLGSYMVAFAGRKHAARSFPVMISDNNTII  118

Query  430  SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLG  609
            +SFTLV EF+KG LQ LYWK+ GC SC  S  F CL G+DCA+  + CK  GG  DC+L 
Sbjct  119  TSFTLVLEFQKGTLQTLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKINGGAHDCNLS  176

Query  610  IQLTFSGTDKHESVFNSWYEV  672
            IQLTFSGTDK+    NSWYEV
Sbjct  177  IQLTFSGTDKNLQALNSWYEV  197



>ref|XP_004145350.1| PREDICTED: uncharacterized protein LOC101213680 [Cucumis sativus]
 ref|XP_004153260.1| PREDICTED: uncharacterized protein LOC101222204 [Cucumis sativus]
 ref|XP_004161628.1| PREDICTED: uncharacterized LOC101222204 [Cucumis sativus]
Length=235

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 141/194 (73%), Gaps = 8/194 (4%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL +  AQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDTRLSLASKMAQL  78

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
             VFRPKVD++S LT+N+S+F P   GGYMVAFAG+KYAARS P  + + S  ++SFTLV 
Sbjct  79   VVFRPKVDQLSFLTINSSTFNPALNGGYMVAFAGQKYAARSLPVMITDNSNTITSFTLVL  138

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF++G LQNL+WK+ GC  C G     C++ QDCA+  + CK  GG+VDC+LGIQL FSG
Sbjct  139  EFQRGILQNLFWKKFGCDKCSGDFSL-CVDNQDCAIPNSKCKYNGGSVDCNLGIQLAFSG  197

Query  631  TDKHESVFNSWYEV  672
            TDK+  V NSWYEV
Sbjct  198  TDKNLEVLNSWYEV  211



>ref|XP_011001205.1| PREDICTED: uncharacterized protein LOC105108558 [Populus euphratica]
 ref|XP_011016215.1| PREDICTED: uncharacterized protein LOC105119739 [Populus euphratica]
Length=249

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 143/198 (72%), Gaps = 11/198 (6%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN-AQ  267
            ++DTN VF PC+D  VQK DGFTFG+ F+ +++ F N      VQLSPCD RL L+  AQ
Sbjct  32   AADTNEVFDPCSDAMVQKFDGFTFGLAFSDKDSFFSNQ-----VQLSPCDSRLGLSKKAQ  86

Query  268  LAVFRPKVDEISLLTVNTSSFFPDS---VGGYMVAFAGRKYAARSPPAFVANGSYIVSSF  438
            LAVFRP+VDEISLLT+N+S   P +   +G +MVAFAGRK+AARS P  +++ + I++SF
Sbjct  87   LAVFRPQVDEISLLTINSSPSDPGAPGPLGSHMVAFAGRKHAARSFPVMISDNNTIITSF  146

Query  439  TLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQL  618
            TLV EF+KG LQNLYWK+ GC SC  S  F CL G+DCA+  + CK+  G  DC L IQL
Sbjct  147  TLVLEFQKGTLQNLYWKKFGCQSC--SKDFVCLGGEDCALPISKCKSNSGANDCVLSIQL  204

Query  619  TFSGTDKHESVFNSWYEV  672
            TFSGTDK+    NSWYEV
Sbjct  205  TFSGTDKNLQALNSWYEV  222



>gb|AFK46494.1| unknown [Lotus japonicus]
Length=254

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 137/197 (70%), Gaps = 8/197 (4%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQ+ DGFTFGI  A +   F  D      QLSPCD RL L++  A
Sbjct  43   AADTNDVYSPCLDAKVQRGDGFTFGIALADKQ-IFFQDGNGP--QLSPCDSRLGLSSKEA  99

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            Q A+FRPKVDEISLLT+N S+      GGYMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  100  QAAMFRPKVDEISLLTINRSALDSGKTGGYMVAFAGQKYAARSLPIMFADNSHTITSFTL  159

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EFK+G LQNL+WKR GC +C  S G  CLN QDCA+    C+  GG   C++GIQLTF
Sbjct  160  VLEFKEGTLQNLFWKRFGCGAC--SKGSVCLNNQDCAVPNTDCQKNGGTT-CNIGIQLTF  216

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEVK
Sbjct  217  SGTDKNLDALNSWYEVK  233



>ref|XP_007042316.1| CSL zinc finger domain-containing protein [Theobroma cacao]
 gb|EOX98147.1| CSL zinc finger domain-containing protein [Theobroma cacao]
Length=238

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 137/199 (69%), Gaps = 14/199 (7%)
 Frame = +1

Query  82   AESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN  261
            A  + DTN VFSPC D+ V KSDGFTFG+ F+ + + F ++     VQLSPCD RL+L +
Sbjct  22   AAIADDTNGVFSPCEDSKVHKSDGFTFGLAFSKKESFFFDN-----VQLSPCDSRLALAS  76

Query  262  --AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
              A LAVFRPKVDEISLLT+N S   P   GG+MVAFAGRKYAARS P  VA+    ++S
Sbjct  77   KMAPLAVFRPKVDEISLLTINGS--IPLVAGGFMVAFAGRKYAARSFPVMVADDRNTITS  134

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ  615
            FTLV EF KG LQNL+WK  GC SC G S   CLN QDCA+ T  C    G+  CSLGIQ
Sbjct  135  FTLVLEFHKGTLQNLHWKSFGCDSCSGESA-VCLNNQDCAIPTPKC----GHTGCSLGIQ  189

Query  616  LTFSGTDKHESVFNSWYEV  672
            L FSGTDK+    NSWYEV
Sbjct  190  LAFSGTDKNLEPLNSWYEV  208



>gb|KJB78925.1| hypothetical protein B456_013G040100 [Gossypium raimondii]
Length=221

 Score =   217 bits (553),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 134/197 (68%), Gaps = 16/197 (8%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNA-TFINDSKNKDVQLSPCDRRLSL--NN  261
            + DTN V+SPC D  VQK DGFTFG+ F+ +   +F N      VQLSPCD RL L   +
Sbjct  18   ADDTNDVYSPCDDAKVQKLDGFTFGVAFSKKEFFSFEN------VQLSPCDSRLGLATKS  71

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLAVFRPK+DEISLLT+N S       GGYMVAFAGRKYAARS P  VA+    ++SFT
Sbjct  72   AQLAVFRPKLDEISLLTINGSDLL--KAGGYMVAFAGRKYAARSLPIMVADDKNTITSFT  129

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EFK+G LQNL+WK  GC SC G S  TCLN QDCA  T+ C   G    C+LGIQL 
Sbjct  130  LVLEFKQGTLQNLFWKSSGCDSCSGESA-TCLNNQDCARPTSKCGQNG----CNLGIQLA  184

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDK+    NSWYEV
Sbjct  185  FSGTDKNLEALNSWYEV  201



>ref|XP_007131910.1| hypothetical protein PHAVU_011G050900g [Phaseolus vulgaris]
 gb|ESW03904.1| hypothetical protein PHAVU_011G050900g [Phaseolus vulgaris]
Length=254

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 140/197 (71%), Gaps = 10/197 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQK DGFTFG+ F+ +       S +   QLSPCD+RL L N  A
Sbjct  40   AADTNDVYSPCFDAKVQKGDGFTFGVAFSDKQIF----SPDNGPQLSPCDKRLQLANKGA  95

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAVFRPKVDEISLLT+N S+  P +  GYMVAFAG+KYAARS P    + ++ ++S +L
Sbjct  96   QLAVFRPKVDEISLLTINRSTSDPGA-NGYMVAFAGKKYAARSLPIMFVDNTHTITSLSL  154

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNL+WK  GC +C   SG +CLN QDCA+    C+  GG++ C++GIQLTF
Sbjct  155  VLEFQEGILQNLFWKSFGCDAC--PSGSSCLNQQDCAVPNTECQKNGGDI-CNVGIQLTF  211

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEVK
Sbjct  212  SGTDKNLDALNSWYEVK  228



>ref|XP_001762404.1| predicted protein [Physcomitrella patens]
 gb|EDQ72871.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 142/197 (72%), Gaps = 10/197 (5%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS--LNNAQ  267
            ++TN V+SPC D TV K+DGFTFG+ FA+  + F N      +QLSPCD RL+  L   +
Sbjct  27   ANTNKVYSPCMDATVHKNDGFTFGLAFASNKSFFYNK-----IQLSPCDSRLAEKLREHK  81

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSV--GGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            +++FRP+VDE++LL VN +   P++V  GG+ VA+AG+K+A  S P F+AN SY ++S +
Sbjct  82   ISLFRPQVDEVTLLLVNHTEINPENVEGGGFAVAYAGKKHAVVSAPHFLANSSYRITSLS  141

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV  F++GRLQN+ WK DGC SC G+S F C+ G +CA+++ +C   GG VDCSL IQLT
Sbjct  142  LVLNFEQGRLQNILWKNDGCKSCLGNSSFACVRG-ECAIQSTACIEAGGRVDCSLSIQLT  200

Query  622  FSGTDKHESVFNSWYEV  672
            +SGTD+ + V NSWY++
Sbjct  201  WSGTDQRQEVLNSWYQM  217



>ref|NP_179191.1| CSL zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AAD41975.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06447.1| CSL zinc finger domain-containing protein [Arabidopsis thaliana]
Length=367

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 141/207 (68%), Gaps = 18/207 (9%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            ++D N V+SPC+DT + K DGFT GI  +++ A F++      VQLSPCD RL L    A
Sbjct  142  AADNNPVYSPCSDTQISKGDGFTIGIAISSKEAFFLDQ-----VQLSPCDTRLGLAAKMA  196

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT-  441
            QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS P  VA+GS  +++FT 
Sbjct  197  QLALFRPKVDEISLLSIDTSKFNPSEAGGFMVGFAGSKYAARSYPVKVADGSNTITAFTL  256

Query  442  --------LVFEFKKGRLQNLYWKRDGCASCK--GSSGFTCLNGQDCAMKTNSCKNRGGN  591
                    LV EF+KG LQNL+WK  GC  CK  GSS   CLNG DCA+ T+ CK  GG 
Sbjct  257  VMKLTLSPLVLEFQKGVLQNLFWKSFGCDLCKGTGSSSSVCLNGTDCAVPTSKCKANGGQ  316

Query  592  VDCSLGIQLTFSGTDKHESVFNSWYEV  672
             +C++GIQ+ FSGTD++    N+WYEV
Sbjct  317  ANCNIGIQVAFSGTDRNLESLNTWYEV  343



>ref|XP_002977899.1| hypothetical protein SELMODRAFT_36451, partial [Selaginella moellendorffii]
 gb|EFJ21237.1| hypothetical protein SELMODRAFT_36451, partial [Selaginella moellendorffii]
Length=231

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 137/196 (70%), Gaps = 9/196 (5%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS-LNNAQLA  273
            DTN VF+PC DT VQ  DGFTFG+ F++ ++ F+  S     QLSPCDRRLS L + ++A
Sbjct  16   DTNPVFNPCGDTRVQVLDGFTFGLAFSSNSSFFLGRS-----QLSPCDRRLSNLYSGRIA  70

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGG--YMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
             FRP+VDEISLLTVN +S      G   YMV++AG ++ ARS P FV +   IV+SFTLV
Sbjct  71   AFRPRVDEISLLTVNDTSTLNADNGNELYMVSYAGSRFGARSKPHFVGDNEKIVTSFTLV  130

Query  448  FEFKKGRLQNLYWKRDGCASCK-GSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
             EF+KGRL N+ WK + C SC  G   F CL   DCA++ + C++RGG VDCS+GI +TF
Sbjct  131  LEFRKGRLINMLWKGNDCKSCSDGRDDFVCLKSGDCAVRLSHCRHRGGRVDCSIGITVTF  190

Query  625  SGTDKHESVFNSWYEV  672
            SGTDK+  V N+WY+V
Sbjct  191  SGTDKNNVVLNTWYQV  206



>ref|XP_003606839.1| hypothetical protein MTR_4g068290 [Medicago truncatula]
Length=262

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 133/194 (69%), Gaps = 11/194 (6%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            DTN V+ PC D  VQK DGFTFGI FA +  +F  DS     QLSPCD RLSL   AQL 
Sbjct  57   DTNDVYLPCEDAKVQKGDGFTFGIAFADKQ-SFTPDSGP---QLSPCDSRLSLAGKAQLV  112

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRP VDEISLLTVN SS   DS G YMVAFAG+KYAARS P  +A+ S+ ++SFTLV E
Sbjct  113  VFRPMVDEISLLTVNRSS--SDS-GTYMVAFAGQKYAARSLPIMLADDSHTITSFTLVLE  169

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+ G LQNL+WK  GC +C   SG  CLN QDCA+    C+ + G+  C +GIQL FSG 
Sbjct  170  FQDGTLQNLFWKSFGCDAC--PSGSICLNNQDCAVPNTECQ-KNGDTACKIGIQLAFSGI  226

Query  634  DKHESVFNSWYEVK  675
            DK+    NSWYEVK
Sbjct  227  DKNLDALNSWYEVK  240



>ref|XP_003541122.2| PREDICTED: uncharacterized protein LOC100813820 [Glycine max]
Length=248

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  34   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKQFF----SQGNGPQLSPCDKRLDLANKGA  89

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QL+VFRP VDE+SLLT+N S+  P +   YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  90   QLSVFRPTVDEVSLLTINRSTSNPGN-NAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  148

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNLYWK  GC  C   SG  CLN QDCA+    C+  GG   C++GIQL F
Sbjct  149  VLEFQEGTLQNLYWKSFGCDGCP--SGSICLNQQDCAVPNKECQKNGGTA-CNMGIQLAF  205

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEV+
Sbjct  206  SGTDKNLDALNSWYEVQ  222



>gb|KHN25326.1| hypothetical protein glysoja_010243 [Glycine soja]
Length=246

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 135/197 (69%), Gaps = 10/197 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  32   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKQFF----SQGNGPQLSPCDKRLDLANKGA  87

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QL+VFRP VDE+SLLT+N S+  P +   YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  88   QLSVFRPTVDEVSLLTINRSTSNPGN-NAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  146

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNLYWK  GC  C   SG  CLN QDCA+    C+  GG   C++GIQL F
Sbjct  147  VLEFQEGTLQNLYWKSFGCDGCP--SGSICLNQQDCAVPNKECQKNGGTA-CNMGIQLAF  203

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYEV+
Sbjct  204  SGTDKNLDALNSWYEVQ  220



>gb|AES89036.2| CSL zinc finger protein, putative [Medicago truncatula]
Length=243

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 133/194 (69%), Gaps = 11/194 (6%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            DTN V+ PC D  VQK DGFTFGI FA +  +F  DS     QLSPCD RLSL   AQL 
Sbjct  38   DTNDVYLPCEDAKVQKGDGFTFGIAFADKQ-SFTPDSGP---QLSPCDSRLSLAGKAQLV  93

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRP VDEISLLTVN SS   DS G YMVAFAG+KYAARS P  +A+ S+ ++SFTLV E
Sbjct  94   VFRPMVDEISLLTVNRSS--SDS-GTYMVAFAGQKYAARSLPIMLADDSHTITSFTLVLE  150

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F+ G LQNL+WK  GC +C   SG  CLN QDCA+    C+ + G+  C +GIQL FSG 
Sbjct  151  FQDGTLQNLFWKSFGCDACP--SGSICLNNQDCAVPNTECQ-KNGDTACKIGIQLAFSGI  207

Query  634  DKHESVFNSWYEVK  675
            DK+    NSWYEVK
Sbjct  208  DKNLDALNSWYEVK  221



>gb|KJB78926.1| hypothetical protein B456_013G040100 [Gossypium raimondii]
Length=197

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 130/193 (67%), Gaps = 16/193 (8%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNA-TFINDSKNKDVQLSPCDRRLSL--NN  261
            + DTN V+SPC D  VQK DGFTFG+ F+ +   +F N      VQLSPCD RL L   +
Sbjct  18   ADDTNDVYSPCDDAKVQKLDGFTFGVAFSKKEFFSFEN------VQLSPCDSRLGLATKS  71

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AQLAVFRPK+DEISLLT+N S       GGYMVAFAGRKYAARS P  VA+    ++SFT
Sbjct  72   AQLAVFRPKLDEISLLTINGSDLL--KAGGYMVAFAGRKYAARSLPIMVADDKNTITSFT  129

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            LV EFK+G LQNL+WK  GC SC G S  TCLN QDCA  T+ C   G    C+LGIQL 
Sbjct  130  LVLEFKQGTLQNLFWKSSGCDSCSGESA-TCLNNQDCARPTSKCGQNG----CNLGIQLA  184

Query  622  FSGTDKHESVFNS  660
            FSGTDK+    NS
Sbjct  185  FSGTDKNLEALNS  197



>ref|NP_001241490.1| uncharacterized protein LOC100816612 [Glycine max]
 gb|ACU24598.1| unknown [Glycine max]
 gb|KHN06175.1| hypothetical protein glysoja_031617 [Glycine soja]
Length=250

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 133/197 (68%), Gaps = 10/197 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--A  264
            ++DTN V+SPC D  VQ+ DGFTFGI F+ +       S+    QLSPCD+RL L N  A
Sbjct  36   AADTNDVYSPCLDAKVQRGDGFTFGIAFSDKEFF----SQGNGPQLSPCDKRLDLANKGA  91

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QL+VFRP VDEISLLT+N  S        YMVAFAG+KYAARS P   A+ S+ ++SFTL
Sbjct  92   QLSVFRPTVDEISLLTIN-RSIVNAGKDAYMVAFAGQKYAARSLPIMFADNSHTITSFTL  150

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF++G LQNLYWK  GC +C   SG  CLN QDCA+    C+  GG+  C+LGIQL F
Sbjct  151  VLEFQEGTLQNLYWKSFGCNACP--SGSICLNNQDCAVPNTECQKNGGSA-CNLGIQLAF  207

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK+    NSWYE +
Sbjct  208  SGTDKNLDALNSWYEAQ  224



>ref|XP_002979423.1| hypothetical protein SELMODRAFT_58114, partial [Selaginella moellendorffii]
 gb|EFJ19312.1| hypothetical protein SELMODRAFT_58114, partial [Selaginella moellendorffii]
Length=236

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 138/200 (69%), Gaps = 13/200 (7%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLS-LNNAQLA  273
            DTN VF+PC DT VQ  DGFTFG+ F++ ++ F+  S     QLSPCDRRLS L + ++A
Sbjct  23   DTNPVFNPCGDTRVQVLDGFTFGLAFSSNSSFFLGRS-----QLSPCDRRLSNLYSGRIA  77

Query  274  VFRPKVDEISLLTVNTSS------FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS  435
             FRP+VDEISLLTVN +S      F  +    YMV++AG ++ ARS P FV +   IV+S
Sbjct  78   AFRPRVDEISLLTVNDTSTLNARSFQDNGNELYMVSYAGSRFGARSKPHFVGDNEKIVTS  137

Query  436  FTLVFEFKKGRLQNLYWKRDGCASCK-GSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGI  612
            FTLV EF+KGRL N+ WK + C SC  G   F CL   DCA++ + C++RGG VDCS+GI
Sbjct  138  FTLVLEFRKGRLINMLWKGNDCKSCSDGRDDFVCLKSGDCAVRLSHCRHRGGRVDCSIGI  197

Query  613  QLTFSGTDKHESVFNSWYEV  672
             +TFSGTDK+  V N+WY+V
Sbjct  198  TVTFSGTDKNNVVLNTWYQV  217



>gb|KGN61748.1| hypothetical protein Csa_2G237180 [Cucumis sativus]
Length=220

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 132/194 (68%), Gaps = 23/194 (12%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNN--AQL  270
            DTN V+SPC D+ +Q+SDGFTFG+ F+++ + F        +Q SPCD RLSL +  AQL
Sbjct  24   DTNDVYSPCLDSKIQRSDGFTFGVAFSSKESFF-----QDQIQFSPCDTRLSLASKMAQL  78

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
             VFRPKVD++S LT+N+S+F P   GGYMVAFAG+KYAARS P               V 
Sbjct  79   VVFRPKVDQLSFLTINSSTFNPALNGGYMVAFAGQKYAARSLP---------------VL  123

Query  451  EFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSG  630
            EF++G LQNL+WK+ GC  C G     C++ QDCA+  + CK  GG+VDC+LGIQL FSG
Sbjct  124  EFQRGILQNLFWKKFGCDKCSGDFSL-CVDNQDCAIPNSKCKYNGGSVDCNLGIQLAFSG  182

Query  631  TDKHESVFNSWYEV  672
            TDK+  V NSWYEV
Sbjct  183  TDKNLEVLNSWYEV  196



>gb|EEC76294.1| hypothetical protein OsI_13809 [Oryza sativa Indica Group]
Length=220

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 125/197 (63%), Gaps = 44/197 (22%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  271  AVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFT  441
            AVFRP+VDEISLLTVNTS+   F P + GGYMVAFAGRKYAARSPP FV+N SY V+SFT
Sbjct  91   AVFRPEVDEISLLTVNTSAAGGFDPATSGGYMVAFAGRKYAARSPPVFVSNSSYTVTSFT  150

Query  442  LVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLT  621
            L                                   CA+ T +C  +GG+VDCS GIQL 
Sbjct  151  L----------------------------------SCAISTANCTGKGGSVDCSPGIQLA  176

Query  622  FSGTDKHESVFNSWYEV  672
            FSGTDKHE+V NSWYEV
Sbjct  177  FSGTDKHEAVLNSWYEV  193



>tpg|DAA50290.1| TPA: hypothetical protein ZEAMMB73_913292 [Zea mays]
Length=208

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 122/193 (63%), Gaps = 42/193 (22%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDARIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRPKVDEISLLT+NT++                                    F  V E
Sbjct  85   VFRPKVDEISLLTINTTT-----------------------------------GFNPVLE  109

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F KGRLQNL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSGT
Sbjct  110  FNKGRLQNLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  168

Query  634  DKHESVFNSWYEV  672
            DKHESV NSWYEV
Sbjct  169  DKHESVLNSWYEV  181



>gb|ACL54751.1| unknown [Zea mays]
Length=208

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 122/193 (63%), Gaps = 42/193 (22%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQLA  273
            DTN V+ PC+D  +Q+ DGFTFG+VFA  NA F     + + QLSPCDRRL+L  + QLA
Sbjct  30   DTNGVYEPCSDGRIQRGDGFTFGVVFAGYNAFF-----SGNTQLSPCDRRLNLAASGQLA  84

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
            VFRPKVDEISLLT+NT++                                    F  V E
Sbjct  85   VFRPKVDEISLLTINTTT-----------------------------------GFNPVLE  109

Query  454  FKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGT  633
            F KGRL+NL+WK+DGC +C G S F CL  Q CA++T SCK++ G VDCS+GIQL FSGT
Sbjct  110  FNKGRLENLHWKKDGCGACSGKSNFVCLGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGT  168

Query  634  DKHESVFNSWYEV  672
            DKHESV NSWYEV
Sbjct  169  DKHESVLNSWYEV  181



>ref|XP_006838810.1| hypothetical protein AMTR_s00002p00262020 [Amborella trichopoda]
 gb|ERN01379.1| hypothetical protein AMTR_s00002p00262020 [Amborella trichopoda]
Length=157

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (84%), Gaps = 3/118 (3%)
 Frame = +1

Query  328  FFP---DSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDG  498
            F P   ++ GGYMVAFAGRKYAARS P+FVAN +YIV+SFTLV EFKKG LQNLYWKRDG
Sbjct  13   FLPPPLETYGGYMVAFAGRKYAARSTPSFVANSTYIVTSFTLVLEFKKGTLQNLYWKRDG  72

Query  499  CASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            C SCKG+  FTCLN QDCA+K +SCK  GG+VDCSLGIQ+ FSGTDKHE V NSWYEV
Sbjct  73   CKSCKGNPNFTCLNFQDCAIKRSSCKGHGGSVDCSLGIQMAFSGTDKHEVVLNSWYEV  130



>gb|ACU17763.1| unknown [Glycine max]
Length=141

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +1

Query  349  GYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGF  528
            GYMVAFAG +YAARSPPAFVANG+Y V+SFTLV EFK+GRLQNLYWKRDGCA C  +S  
Sbjct  7    GYMVAFAGHRYAARSPPAFVANGTYTVTSFTLVLEFKRGRLQNLYWKRDGCAKCSSNSKA  66

Query  529  TCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEVK  675
             CLN QDCA++T++CK+ GG VDCS+GIQL FSGTD+H +V NSWYEVK
Sbjct  67   VCLNNQDCALQTSTCKSHGGTVDCSIGIQLAFSGTDRHLAVLNSWYEVK  115



>ref|XP_002863988.1| hypothetical protein ARALYDRAFT_495006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40247.1| hypothetical protein ARALYDRAFT_495006 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 123/201 (61%), Gaps = 25/201 (12%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQLA  273
            S+TN+++SPC+DT +Q+SDGFTFGI F++R + F+N +    V LSPCD RLSL      
Sbjct  14   SNTNNIYSPCSDTRIQRSDGFTFGIAFSSRPSFFLNQT----VLLSPCDHRLSLAAMNSQ  69

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFE  453
                                 D+ GGYMVAFAGRKYAAR  PAF+AN ++IV+SFTL+  
Sbjct  70   S--------LSSPSTPPPSSRDNYGGYMVAFAGRKYAARLIPAFIANNTFIVTSFTLIHH  121

Query  454  FKKGRLQNLYWKRDGCASCKG-------SSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGI  612
                  + L+        C G       + G   LN QDCA++T +CK RGG+VDCSLGI
Sbjct  122  ------EILFMVLLCFKICIGRETGVRRARGIKILNKQDCAIRTPTCKGRGGSVDCSLGI  175

Query  613  QLTFSGTDKHESVFNSWYEVK  675
            QL F GTDKH +V NSWYEV+
Sbjct  176  QLAFFGTDKHLAVLNSWYEVE  196



>ref|XP_010517092.1| PREDICTED: uncharacterized protein LOC104792600, partial [Camelina 
sativa]
Length=156

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 7/150 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            +SD N V+SPC+DT + K DGFT G+  ++R A F++      VQLSPCD RL L    A
Sbjct  12   ASDNNAVYSPCSDTQISKGDGFTIGLAISSREAFFLDQ-----VQLSPCDSRLGLAAKMA  66

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLA+FRPKVDEISLL+++TS F P   GGYMV FAG KYAARS P  VA+ S  +++FTL
Sbjct  67   QLALFRPKVDEISLLSIDTSKFNPSKAGGYMVGFAGSKYAARSYPVKVADESNTITAFTL  126

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTC  534
            V EF+KG LQNL+WK  GC  CKG +   C
Sbjct  127  VMEFQKGVLQNLFWKSFGCDMCKGGTSSVC  156



>gb|EYU18142.1| hypothetical protein MIMGU_mgv1a011713mg [Erythranthe guttata]
Length=273

 Score =   163 bits (413),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 6/119 (5%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN-NAQ  267
            S +TN+VFSPC D +VQ+SDGFTFG+ FA   A   N +     QLSPCD RLSL  ++Q
Sbjct  22   SKNTNNVFSPCGDASVQRSDGFTFGVAFAQTRAFSFNGT-----QLSPCDSRLSLTGSSQ  76

Query  268  LAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            +AVFRPKVDEISLLT+NTS+F PDSVGGYMVAFAGRKYAARS PAFVAN +YIV+SFTL
Sbjct  77   VAVFRPKVDEISLLTINTSTFQPDSVGGYMVAFAGRKYAARSMPAFVANSTYIVTSFTL  135


 Score = 60.8 bits (146),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  449  LNSKRADCKTCTGRGMGVHRAKAAQASHASMVKIVL*RPIPARTEVGM*TVALEYN*HSP  628
            LNS+R   KTCTG+   V RA+A QAS+AS +K V      A+TEVGM T A  Y+    
Sbjct  135  LNSRRGGFKTCTGKETDVLRARATQASYASTIKTVPSESTTAKTEVGMWTAASGYSWRFL  194

Query  629  ALISTSRFSTRGMK  670
            A IST+RFS  G +
Sbjct  195  ARISTNRFSIPGTR  208



>emb|CDY70957.1| BnaC03g73480D, partial [Brassica napus]
Length=156

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 10/127 (8%)
 Frame = +1

Query  292  DEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRL  471
            D+ISL          DS  GYMVAFAG KYAARS P  VA+  ++V+SFTLV EF+KGRL
Sbjct  13   DQISL----------DSSKGYMVAFAGSKYAARSVPIMVADNDHVVTSFTLVLEFQKGRL  62

Query  472  QNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESV  651
            +NL+WK+DGC+ C G++ F CLN ++CA+K  SCKN+GG VDCSLGIQL FSGTDKH + 
Sbjct  63   ENLFWKKDGCSKCSGNAKFVCLNKEECAIKRQSCKNQGGQVDCSLGIQLAFSGTDKHYTA  122

Query  652  FNSWYEV  672
             NSWYEV
Sbjct  123  LNSWYEV  129



>gb|KCW63843.1| hypothetical protein EUGRSUZ_G01513 [Eucalyptus grandis]
Length=208

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 119/197 (60%), Gaps = 47/197 (24%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA  264
            + DTN VF PC+DT +QK DGF+FG+ F+ + + F      + +QLSPCD RL L  ++A
Sbjct  31   AEDTNLVFDPCSDTKIQKGDGFSFGLAFSTKESFFF-----QQIQLSPCDNRLPLAGSSA  85

Query  265  QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL  444
            QLAV+RPKVDEISLLT+N+S+F P                                    
Sbjct  86   QLAVYRPKVDEISLLTINSSTFNP------------------------------------  109

Query  445  VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF  624
            V EF+KG LQNLYWK+ GC SC G S   CLN +DCA+  + C + G    C++GIQLTF
Sbjct  110  VLEFQKGTLQNLYWKKFGCDSCPGDST-VCLNNEDCAVPNSKCSHAGA---CNIGIQLTF  165

Query  625  SGTDKHESVFNSWYEVK  675
            SGTDK++ V NSWYEVK
Sbjct  166  SGTDKNDVVLNSWYEVK  182



>ref|XP_008354774.1| PREDICTED: uncharacterized protein LOC103418422 [Malus domestica]
Length=137

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  325  SFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCA  504
            SF PD+ G +MVAFAGR Y  RS P FVANG+Y V++FTLV EF KGRLQNLYWK+D C+
Sbjct  2    SFNPDAYG-FMVAFAGRNYVTRSLPTFVANGTYTVTTFTLVLEFNKGRLQNLYWKKDRCS  60

Query  505  SCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSW  663
             C GSS F CLN Q+CA KT+SCKN GG+VDCS+ IQL F GT+KH SV NSW
Sbjct  61   KCSGSSDFVCLNNQNCAFKTSSCKNHGGSVDCSIIIQLAFFGTNKHLSVLNSW  113



>gb|AAU89199.1| expressed protein [Oryza sativa Japonica Group]
Length=459

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +1

Query  334  PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCK  513
            P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV EF KGRLQNL+WK+DGC +C 
Sbjct  321  PATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVLEFNKGRLQNLHWKKDGCGACA  380

Query  514  GSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
             SS   C+  Q CA +T SCK++ G VDCS+GIQL FSGTDKHESV NSWYEV
Sbjct  381  KSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSGTDKHESVLNSWYEV  432


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PC+DT +Q+ DGF+FGI FA   A +   S    VQLSPCDRRLSL ++ QLA
Sbjct  169  DENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS----VQLSPCDRRLSLASSGQLA  224

Query  274  VFRPKVDEISLLTVNTSSFF  333
            VFRPKVDEISLLT+NT++ F
Sbjct  225  VFRPKVDEISLLTINTTTGF  244



>gb|AFW68146.1| expp1 protein, mRNA isoform 1 [Zea mays]
 gb|AFW68147.1| hypothetical protein ZEAMMB73_851126 [Zea mays]
Length=132

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +1

Query  355  MVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTC  534
            MVAFAGRKYAARS P FV+N S  VSSFTLV EF KGRL+NL+WK+DGC +C G S F C
Sbjct  1    MVAFAGRKYAARSIPIFVSNTSVTVSSFTLVLEFNKGRLENLHWKKDGCGACSGKSNFVC  60

Query  535  LNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            L  Q CA++T SCK++ G VDCS+GIQL FSGTDKHESV NSWYEV
Sbjct  61   LGKQTCAIRTQSCKSQ-GPVDCSVGIQLAFSGTDKHESVLNSWYEV  105



>gb|EMS61424.1| Protein IQ-DOMAIN 1 [Triticum urartu]
Length=548

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 3/113 (3%)
 Frame = +1

Query  340  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  519
            S GGYMVAFAGRK+AARSPP FV N SY V+ FTLVFEF KG LQNL+WK DGC+SC G 
Sbjct  410  SAGGYMVAFAGRKFAARSPPVFVGNSSYTVTGFTLVFEFHKGTLQNLFWKSDGCSSCSGQ  469

Query  520  SGFTCLNGQDCAMKTNSCKNR--GGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            + F C+    CA+KT+SC+    GG VDCS GIQL FSGTDKHE+V NSWYEV
Sbjct  470  ANFGCVEN-SCAIKTSSCRGNGGGGQVDCSPGIQLAFSGTDKHEAVLNSWYEV  521



>gb|EMT08784.1| hypothetical protein F775_31788 [Aegilops tauschii]
Length=166

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  340  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  519
            S GGYMVAFAGRKYAARS P FV+N S  VSSFTLV EF KG+LQNL+WK+DGC +C G 
Sbjct  28   SAGGYMVAFAGRKYAARSQPVFVSNSSVTVSSFTLVLEFNKGKLQNLHWKKDGCGACTGK  87

Query  520  SGFTCLNGQDCAMKTNSCK-NRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
              F CL  Q CA++TN CK N  G++DCS+GIQL FSGTDKHESV NSWYEV
Sbjct  88   PNFICLGKQTCAIRTNICKSNNQGSMDCSIGIQLAFSGTDKHESVLNSWYEV  139



>gb|EMT01607.1| hypothetical protein F775_23771 [Aegilops tauschii]
Length=782

 Score =   158 bits (400),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +1

Query  340  SVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGS  519
            S GGYMVAFAGRK+AARSPP FV N SY V+ FTLVFEF KG LQNL+WK DGC+SC G 
Sbjct  396  SAGGYMVAFAGRKFAARSPPVFVGNSSYTVTGFTLVFEFHKGTLQNLFWKADGCSSCSGQ  455

Query  520  SGFTCLNGQDCAMKTNSCKNR-GGNVDCSLGIQLTFSGTDKHESVFNS  660
            +   C+    CA+KT+SCK   GG VDCS GIQL FSGTDKHE+V NS
Sbjct  456  ANLGCVE-NSCAIKTSSCKGSGGGQVDCSPGIQLAFSGTDKHEAVLNS  502



>gb|AAF23196.1|AC016795_9 unknown protein [Arabidopsis thaliana]
Length=127

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 6/106 (6%)
 Frame = +1

Query  355  MVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTC  534
            MVAFAG KYAARS P  VA+ ++IV       EF+KGRL+N++WK+DGC+ C G S F C
Sbjct  1    MVAFAGAKYAARSLPIMVADSNHIV------LEFQKGRLENMFWKKDGCSKCSGDSKFVC  54

Query  535  LNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEV  672
            LN ++CA+K  +CKN+GG VDCSLGIQL FSGTDKH +  NSWYEV
Sbjct  55   LNKEECAIKPQNCKNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEV  100



>gb|AFW67426.1| hypothetical protein ZEAMMB73_369494 [Zea mays]
Length=155

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQLA  273
            D N V+ PCAD +VQ+ DGFTFG+VF+ R++       +  VQLSPCD RL L N AQ+A
Sbjct  31   DHNGVYDPCADASVQRGDGFTFGVVFSGRDSF-----SSGGVQLSPCDSRLGLANRAQVA  85

Query  274  VFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            +FRP+VDEISLLTVN+SSF P S G YMVAFAG+KYAARSPP FV N SY V+ FTLV
Sbjct  86   LFRPQVDEISLLTVNSSSFDPSSSGVYMVAFAGKKYAARSPPVFVGNISYTVTGFTLV  143



>ref|XP_006292065.1| hypothetical protein CARUB_v10018260mg, partial [Capsella rubella]
 gb|EOA24963.1| hypothetical protein CARUB_v10018260mg, partial [Capsella rubella]
Length=117

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 8/117 (7%)
 Frame = +1

Query  112  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQLAVFRP  285
            +SPC+D+TV   DGFTFGI FAA ++ F     N+ VQ SPCDRR  SLN N+++AVFRP
Sbjct  2    YSPCSDSTVGTDDGFTFGITFAAEDSFF---GTNRSVQYSPCDRRRFSLNGNSEVAVFRP  58

Query  286  KVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLV  447
            KVDEI+LLT+NTSS   F PD+  GYMVAFAG KY ARS P  V + ++IV+SFTLV
Sbjct  59   KVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYTARSVPIMVVDSNHIVTSFTLV  115



>emb|CAB62352.1| hypothetical protein [Arabidopsis thaliana]
Length=122

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +1

Query  424  IVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCS  603
            +V +F  V EF+KGRLQNLYWKRD CASCKG+  F CL  Q CA++T SCK RGG+V CS
Sbjct  14   VVMTFK-VMEFQKGRLQNLYWKRDVCASCKGNQNFVCLKKQVCAIRTPSCKGRGGSVGCS  72

Query  604  LGIQLTFSGTDKHESVFNSWYEV  672
            LGIQL FSGTDKH +V NSWYEV
Sbjct  73   LGIQLAFSGTDKHLAVLNSWYEV  95



>ref|XP_006827430.1| hypothetical protein AMTR_s00009p00088580 [Amborella trichopoda]
 gb|ERM94846.1| hypothetical protein AMTR_s00009p00088580 [Amborella trichopoda]
Length=105

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 77/130 (59%), Gaps = 34/130 (26%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLNNAQL  270
            + D  +VF  C D  +QKSDGFTFGI F+                               
Sbjct  7    TDDKKNVFQLCQDARIQKSDGFTFGIAFS-------------------------------  35

Query  271  AVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVF  450
               RPKVD+ISLL +NT +F P++ GGYMV FAGRKYAARSPP FVAN +Y+V++FTLVF
Sbjct  36   --LRPKVDQISLLAINTINFAPETYGGYMVEFAGRKYAARSPPTFVANSTYMVATFTLVF  93

Query  451  EFKKGRLQNL  480
            EF KG  QNL
Sbjct  94   EF-KGTWQNL  102



>ref|XP_002975636.1| hypothetical protein SELMODRAFT_415872 [Selaginella moellendorffii]
 gb|EFJ23265.1| hypothetical protein SELMODRAFT_415872 [Selaginella moellendorffii]
Length=258

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 109/212 (51%), Gaps = 21/212 (10%)
 Frame = +1

Query  91   SSDTNHVFSPCADT-TVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  258
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADNNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  259  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  420
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLHTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  421  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNV--  594
             I   +TLV E KKG L+NL WK D CASC G +  +C  G  C+   ++C +    +  
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGA-CSTSESTCLDPSSTIAS  194

Query  595  -----DCSLGIQLTFSGTDKHESVFNSWYEVK  675
                  C   I + FSGTDK+  V +SWY+VK
Sbjct  195  VKGADPCRFAINVAFSGTDKNNVVMDSWYQVK  226



>ref|XP_002973613.1| hypothetical protein SELMODRAFT_414097 [Selaginella moellendorffii]
 gb|EFJ25273.1| hypothetical protein SELMODRAFT_414097 [Selaginella moellendorffii]
Length=258

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 109/212 (51%), Gaps = 21/212 (10%)
 Frame = +1

Query  91   SSDTNHVFSPCADT-TVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  258
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADNNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  259  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  420
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLHTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  421  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNV--  594
             I   +TLV E KKG L+NL WK D CASC G +  +C  G  C+   ++C +    +  
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGA-CSTSESTCLDPSSTIAS  194

Query  595  -----DCSLGIQLTFSGTDKHESVFNSWYEVK  675
                  C   I + FSGTDK+  V +SWY+VK
Sbjct  195  VKGADPCRFAINVAFSGTDKNNVVMDSWYQVK  226



>ref|XP_002978961.1| hypothetical protein SELMODRAFT_418771 [Selaginella moellendorffii]
 gb|EFJ19918.1| hypothetical protein SELMODRAFT_418771 [Selaginella moellendorffii]
Length=379

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 108/211 (51%), Gaps = 21/211 (10%)
 Frame = +1

Query  91   SSDTNHVFSPCADT-TVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN---  258
            ++D N VF+PC     V   D  +  + +    + + N+S     QLSPCD  L      
Sbjct  19   AADKNPVFNPCRQLLPVGGKDSISIAVGYTGAPSVWYNNSDPSLNQLSPCDNALVAKMPA  78

Query  259  NAQLAVFRPKVDEISLLTVNTSSF------FPDSVGGYMVAFAGRKYAARSPPAFVANGS  420
            N+++AVFRP +D+IS+L  N +S+      FP +    +VA+AG      +P  F+    
Sbjct  79   NSRVAVFRPLLDQISMLRTNNASYLDLLTAFPGN--ATVVAYAGNPTIVSTPKYFLIPYG  136

Query  421  YIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNV--  594
             I   +TLV E KKG L+NL WK D CASC G +  +C  G  C+   ++C +    +  
Sbjct  137  RI-PIYTLVIELKKGVLKNLLWKDDKCASCGGKTSASCFQGA-CSTSESTCLDPSSTIAS  194

Query  595  -----DCSLGIQLTFSGTDKHESVFNSWYEV  672
                  C   I + FSGTDK+  V +SWY+V
Sbjct  195  VKGADPCRFAINVAFSGTDKNNVVMDSWYQV  225



>emb|CAN71120.1| hypothetical protein VITISV_000390 [Vitis vinifera]
Length=140

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 8/85 (9%)
 Frame = +1

Query  91   SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA  264
            S D N VFSPCADTTVQKSDGFTFGI FA+R+    N++      LSPCDRRL+L+  N+
Sbjct  22   SGDNNRVFSPCADTTVQKSDGFTFGIAFASRDKFSYNNT-----LLSPCDRRLALSSQNS  76

Query  265  QLAVFRPKVDEISLLTVN-TSSFFP  336
            Q+A FRPKVDEISLL++N TSSFFP
Sbjct  77   QIAAFRPKVDEISLLSINTTSSFFP  101



>ref|XP_008350235.1| PREDICTED: uncharacterized protein LOC103413547 [Malus domestica]
Length=1016

 Score =   107 bits (268),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 5/82 (6%)
 Frame = +1

Query  94   SDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL-NNAQL  270
            S+ N+V+SPCADTTV++SDGFTFGI FA++ +      +N  VQLSPCD RL L +NAQ+
Sbjct  22   SNNNNVYSPCADTTVERSDGFTFGIAFASKESF----QRNGTVQLSPCDSRLFLSSNAQI  77

Query  271  AVFRPKVDEISLLTVNTSSFFP  336
            +VF PKVDEISLL+VN+SSF P
Sbjct  78   SVFXPKVDEISLLSVNSSSFNP  99



>ref|NP_001051495.1| Os03g0787100 [Oryza sativa Japonica Group]
 gb|AAT75255.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99242.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13409.1| Os03g0787100 [Oryza sativa Japonica Group]
 dbj|BAG99059.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +1

Query  97   DTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQL  270
            DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    A+L
Sbjct  36   DTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKGAKL  90

Query  271  AVFRPKVDEISLLTVNTSS  327
            AVFRP+VDEISLLTVNTS+
Sbjct  91   AVFRPEVDEISLLTVNTSA  109



>ref|XP_001760696.1| predicted protein [Physcomitrella patens]
 gb|EDQ74435.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 97/211 (46%), Gaps = 17/211 (8%)
 Frame = +1

Query  88   SSSDTNHVFSPCAD-TTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--  258
            SS DTN V SPCA    +   D  T  +      AT+ N+S +K   LSPC    S    
Sbjct  240  SSKDTNPVMSPCAQLQPIGTGDAITVAVALGGNRATWHNNSNSKLNVLSPCSPHTSPGIP  299

Query  259  -NAQLAVFRPKVDEISLLTVN----TSSFFPDSVGGYMVAFAGRKYAAR-----SPPAFV  408
               Q+ VFRP VD++SL  +     TS     S    ++ +AG   A       S P   
Sbjct  300  LGTQVTVFRPIVDQLSLFQIYNQTLTSVATTFSEAASLLVYAGYNSATDNGTIVSEPRTF  359

Query  409  ANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSC--KNR  582
            +     +    LV EF++G L+NL WK D C  C G+S   CL+  +CA    +C  +N 
Sbjct  360  STSVGKIGGLLLVMEFEQGVLKNLTWKDDDCRDC-GNSSVLCLD-NNCATPIATCISQNT  417

Query  583  GGNVDCSLGIQLTFSGTDKHESVFNSWYEVK  675
                 C   I + +SGTDK+   F SW  VK
Sbjct  418  TNPAICITRINVAYSGTDKNSLSFTSWMSVK  448



>ref|XP_006303588.1| hypothetical protein CARUB_v100111180mg, partial [Capsella rubella]
 gb|EOA36486.1| hypothetical protein CARUB_v100111180mg, partial [Capsella rubella]
Length=78

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 5/74 (7%)
 Frame = +1

Query  112  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NAQLAVFRP  285
            +SPC+D+TV   DGFTFGI FAA  + F     N+ VQ SPCDRR  SLN N+++AVFRP
Sbjct  2    YSPCSDSTVGIDDGFTFGITFAAEYSFF---GTNRSVQYSPCDRRRFSLNGNSEVAVFRP  58

Query  286  KVDEISLLTVNTSS  327
            KVDEI+LLT+NTSS
Sbjct  59   KVDEITLLTINTSS  72



>ref|NP_190432.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE78439.1| uncharacterized protein AT3G48630 [Arabidopsis thaliana]
Length=128

 Score = 66.6 bits (161),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  352  YMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCA  504
            Y V   G +  +   PAF+AN ++IV+SFT V EF+KGRLQNLYWKRD CA
Sbjct  2    YNVGTRGSEIRSEVDPAFIANSTFIVTSFTWVMEFQKGRLQNLYWKRDVCA  52


 Score = 33.5 bits (75),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +2

Query  599  VALEYN*HSPALISTSRFSTRGMK  670
            V L ++   PALIST RFSTRGMK
Sbjct  61   VVLGFSWRFPALISTWRFSTRGMK  84



>emb|CDY54071.1| BnaA07g36330D [Brassica napus]
Length=169

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 23/111 (21%)
 Frame = +1

Query  112  FSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNAQLAVFRP  285
            +SPC+DT + K DGF  G+  + R A F++      VQL PCD RL L    AQL +FRP
Sbjct  17   YSPCSDTQISKRDGFIVGVAISRREAFFLD-----QVQLYPCDSRLGLAAKMAQLVLFRP  71

Query  286  KVDEIS------LLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGS  420
            KVDEIS      ++++  + FF        + F   ++A RS P  VA+GS
Sbjct  72   KVDEISIRWLYGIISMRLNLFF--------IFF--EQHAIRSYPVKVADGS  112



>ref|XP_003064312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51217.1| predicted protein [Micromonas pusilla CCMP1545]
Length=285

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 95/237 (40%), Gaps = 45/237 (19%)
 Frame = +1

Query  82   AESSSDTNHVFSPC-ADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQL-SPCDRR---  246
            A S +    ++ PC A + VQ  D F+ GI F    A  I+D  +   ++  PCD     
Sbjct  34   APSPARAAGIYDPCVAQSAVQIGDTFSIGIAFYPGGA--ISDWYDSAGKIYHPCDATASA  91

Query  247  -LSLNNAQLAVFRPKVDEISLL---------TVNTSSFFPDSVGGYMVAFAGRKYAARSP  396
             L     Q   FRPKVD ++ L           NT+S  P  +   MVA+      +   
Sbjct  92   VLQTKLVQTQSFRPKVDHLTFLRGDATEETAVFNTASGTPIIM--TMVAYTANGIISDPR  149

Query  397  PAFVANGSYIV--------SSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLN----  540
               V N   IV        SS TLV  F  G + +L W   GC+SCK   G +C+N    
Sbjct  150  IVRVTNSGAIVGGSDLGRVSSLTLVARFDGGNVAHLQWHDIGCSSCK--DGDSCINVDAK  207

Query  541  --GQDCAMKTNSCKNRGGN----------VDCSLGIQLTFSGTDKHESVFNSWYEVK  675
                 CA    +C   G            + C L   L FSGTDKH     S  +++
Sbjct  208  GDHYACAGSETACSCTGSGCALNLAGTDVLRCQLTTSLGFSGTDKHSVPMKSGAQIE  264



>ref|XP_002501068.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62326.1| predicted protein [Micromonas sp. RCC299]
Length=265

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 93/223 (42%), Gaps = 46/223 (21%)
 Frame = +1

Query  109  VFSPCADTT-VQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDR--RLSLNNAQLA--  273
            ++ PCA    +   DGFT G+ +      +   S      L PC    R +L  A +A  
Sbjct  26   IYDPCASQPDLSAGDGFTIGLAY------YPGGSLEDWGTLHPCKSADRANLTAAGVASM  79

Query  274  VFRPKVDEISLLTVNTSSF--FPDSVGGY----MVAFAGRKYAARSPP--AFVANGSYIV  429
             FRPK+D ++    + +       SV G     +VA+AG     RS P  A V + S +V
Sbjct  80   TFRPKLDAMTFFRGSEAEEGQVLASVSGANIMTVVAYAGE---VRSEPRIARVTSASAVV  136

Query  430  S--------SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLN----GQDCAMKTNSC  573
                     S TLV  F +GRL+ L W   GC SC  + G  C++     Q CA     C
Sbjct  137  GGVQPGRVNSLTLVARFDEGRLRYLQWHDLGCGSC--ARGDLCIHVGEGHQSCAGSETDC  194

Query  574  KNRGGN----------VDCSLGIQLTFSGTDKHESVFNSWYEV  672
               G N          + C L +   FSGTDKH     S  ++
Sbjct  195  SCAGDNCALDLTGSDVLRCQLTLATAFSGTDKHSVPLGSASQI  237



>ref|XP_006584145.1| PREDICTED: uncharacterized protein LOC102665500 [Glycine max]
Length=129

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = +1

Query  169  VFAARNATFINDSKNKDVQLSPCDRRLSLNNA--QLAVFRPKVDEISLLTVNTSSF  330
            +FA ++  F N++ + ++QLS CD RLSL+NA  Q++VFRPKVDEI LL VN SSF
Sbjct  1    MFAPKDKFFYNNNIS-NIQLSSCDMRLSLSNANSQISVFRPKVDEILLLIVNFSSF  55



>ref|XP_001695376.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01634.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=264

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 95/229 (41%), Gaps = 48/229 (21%)
 Frame = +1

Query  109  VFSPCAD-TTVQKSDGFTFGI-VFAARNATFINDSK-------NKDVQLSPCDRRLSLNN  261
            ++ PC   T + + D F  G+ +  A NAT + +         N   Q    D  ++   
Sbjct  23   IYDPCQPLTPIARGDPFVIGLALIPAVNATLLANLTASYGGLCNTTFQ----DYLITNYK  78

Query  262  AQLAVFRPKVDEISLLTVNTSSFFPDSVGGYM------VAFAGRKYAARSPPAFVANGSY  423
            A +A++  +VD + +L +     +PD +   +      +A A  +    SP A++A+G  
Sbjct  79   ALIAIYNLRVDRLQVLRMP----YPDIIFNMVNATPPTMALAAFRANVTSPAAYIASGDP  134

Query  424  IVS-------SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG------------Q  546
             V+       S  L+  F KG LQ L W    C  C G +G  C++              
Sbjct  135  AVTYGAGFVVSLALLPRFDKGNLQYLQWYDQSCNECGGKNGALCMHSTQAGVVACSTPLD  194

Query  547  DCAMKTNSCKNRGGNVD------CSLGIQLTFSGTDKHESVFNSWYEVK  675
            +C    +   N   ++D      CS  I   + GTD++++V  +  +V+
Sbjct  195  NCTCTVSGVTNSSCSLDDARFDVCSTSINTAWMGTDRNQAVMRTGPQVQ  243



>ref|XP_005647423.1| hypothetical protein COCSUDRAFT_42464 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22879.1| hypothetical protein COCSUDRAFT_42464 [Coccomyxa subellipsoidea 
C-169]
Length=247

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 71/185 (38%), Gaps = 39/185 (21%)
 Frame = +1

Query  226  LSPCDRRLSLNNAQL-------------AVFRPKVDEISLLTVN-------------TSS  327
            L+PC+   + NN  L             A F  KVD +  + +N              SS
Sbjct  23   LNPCNATNNYNNTGLSDAAYLAEKGVVVAAFELKVDLLMAMRINGSDIDRLFATISNASS  82

Query  328  FFPDSVGGYMVAFAGRKYAA---RSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDG  498
                 V   ++  AG +  A   RS  A+++ G+  V S  L   F KG+L  L W    
Sbjct  83   STQHEVISTVIFRAGFRSEAVYIRSEDAYLSRGTGRVKSLALSASFDKGQLTYLLWDDVT  142

Query  499  CASCKGSSGFTCLN------GQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNS  660
            C SC G +   C+          CA     C       DCSL I + F+G D+H   F +
Sbjct  143  CNSCGGLTSKQCVTTATSQPQHSCAATDEECVTD----DCSLSIYMGFTGEDRHGVAFQT  198

Query  661  WYEVK  675
              ++ 
Sbjct  199  GSQIH  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420