BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022N08

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    289   2e-91   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    286   1e-90   Nicotiana sylvestris
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    282   8e-89   Solanum tuberosum [potatoes]
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               282   1e-88   
ref|XP_003593130.1|  Histidine decarboxylase                            275   2e-88   
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    280   5e-88   Solanum lycopersicum
ref|XP_010108654.1|  Histidine decarboxylase                            275   3e-86   Morus notabilis
ref|XP_003593129.1|  Histidine decarboxylase                            275   6e-86   Medicago truncatula
gb|ACJ85197.1|  unknown                                                 275   6e-86   Medicago truncatula
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    272   4e-85   Fragaria vesca subsp. vesca
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    272   6e-85   Cucumis sativus [cucumbers]
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    272   7e-85   
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      271   1e-84   
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      271   2e-84   Cucumis melo [Oriental melon]
ref|XP_002306690.1|  serine decarboxylase family protein                267   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               267   5e-83   Pyrus x bretschneideri [bai li]
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 266   5e-83   Malus domestica [apple tree]
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               266   7e-83   Pyrus x bretschneideri [bai li]
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               266   7e-83   
gb|KHG24953.1|  Histidine decarboxylase                                 266   8e-83   Gossypium arboreum [tree cotton]
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               266   8e-83   Populus euphratica
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               266   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 266   1e-82   Glycine max [soybeans]
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            266   1e-82   Malus domestica [apple tree]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    265   2e-82   Brassica rapa
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         265   2e-82   Jatropha curcas
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               265   3e-82   Camelina sativa [gold-of-pleasure]
emb|CDX80723.1|  BnaC08g05570D                                          265   4e-82   
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    265   5e-82   Cicer arietinum [garbanzo]
gb|KJB16468.1|  hypothetical protein B456_002G231300                    264   7e-82   Gossypium raimondii
gb|KJB16469.1|  hypothetical protein B456_002G231300                    264   7e-82   Gossypium raimondii
gb|KJB16470.1|  hypothetical protein B456_002G231300                    264   7e-82   Gossypium raimondii
gb|KHN26720.1|  Histidine decarboxylase                                 263   1e-81   Glycine soja [wild soybean]
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               263   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    263   2e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002302186.1|  serine decarboxylase family protein                262   2e-81   Populus trichocarpa [western balsam poplar]
ref|NP_001241244.1|  uncharacterized protein LOC100795577               263   2e-81   Glycine max [soybeans]
dbj|BAE07183.1|  putative serine decarboxylase                          263   2e-81   Beta vulgaris [beet]
emb|CDY30753.1|  BnaC05g51500D                                          263   2e-81   Brassica napus [oilseed rape]
ref|XP_002893962.1|  EMB1075                                            262   2e-81   
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               262   2e-81   Populus euphratica
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            262   2e-81   Prunus mume [ume]
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             263   2e-81   Eutrema salsugineum [saltwater cress]
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               262   3e-81   Nelumbo nucifera [Indian lotus]
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             262   3e-81   Prunus persica
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    262   4e-81   Theobroma cacao [chocolate]
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    262   4e-81   Tarenaya hassleriana [spider flower]
ref|XP_002533017.1|  group II plp decarboxylase, putative               261   7e-81   Ricinus communis
emb|CDY59264.1|  BnaC09g51700D                                          261   8e-81   Brassica napus [oilseed rape]
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             260   9e-81   Phaseolus vulgaris [French bean]
ref|NP_175036.1|  serine decarboxylase 1                                261   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             261   1e-80   Phaseolus vulgaris [French bean]
dbj|BAA78331.1|  serine decarboxylase                                   260   2e-80   Brassica napus [oilseed rape]
emb|CDY41717.1|  BnaA09g15450D                                          259   2e-80   Brassica napus [oilseed rape]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               260   3e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    259   4e-80   Camelina sativa [gold-of-pleasure]
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                259   5e-80   Erythranthe guttata [common monkey flower]
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               259   6e-80   Brassica rapa
emb|CDY48944.1|  BnaA08g04700D                                          259   7e-80   Brassica napus [oilseed rape]
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               258   1e-79   Arabis alpina [alpine rockcress]
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          256   6e-79   Amborella trichopoda
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               256   7e-79   
emb|CBI18554.3|  unnamed protein product                                254   1e-78   Vitis vinifera
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     256   1e-78   Eucalyptus grandis [rose gum]
emb|CAN70523.1|  hypothetical protein VITISV_034634                     254   3e-78   Vitis vinifera
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    254   3e-78   Vitis vinifera
gb|EPS66281.1|  serine decarboxylase                                    252   7e-78   Genlisea aurea
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               253   1e-77   Brassica rapa
gb|KHN39188.1|  Histidine decarboxylase                                 253   1e-77   Glycine soja [wild soybean]
ref|NP_001242861.1|  uncharacterized protein LOC100792053               251   2e-77   
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             253   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             252   3e-77   Phaseolus vulgaris [French bean]
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    251   6e-77   Glycine max [soybeans]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    251   7e-77   
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    249   3e-76   Glycine max [soybeans]
gb|KJB59411.1|  hypothetical protein B456_009G253400                    249   3e-76   Gossypium raimondii
gb|KJB59410.1|  hypothetical protein B456_009G253400                    249   3e-76   Gossypium raimondii
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             250   5e-76   
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             248   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  248   1e-75   Elaeis guineensis
gb|KHG04394.1|  Histidine decarboxylase                                 248   1e-75   Gossypium arboreum [tree cotton]
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  247   1e-75   Brachypodium distachyon [annual false brome]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            247   3e-75   
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  246   4e-75   Phoenix dactylifera
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             246   5e-75   
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   246   5e-75   Citrus sinensis [apfelsine]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             246   6e-75   Citrus clementina [clementine]
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    246   6e-75   Citrus sinensis [apfelsine]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            246   7e-75   Setaria italica
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            245   9e-75   Prunus mume [ume]
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             247   9e-75   
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             245   1e-74   
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  244   1e-74   Brachypodium distachyon [annual false brome]
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            244   3e-74   Zea mays [maize]
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             243   5e-74   
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             242   1e-73   Prunus persica
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            242   2e-73   
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          242   3e-73   Sorghum bicolor [broomcorn]
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            239   2e-72   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86197.1|  hypothetical protein OsI_07573                          238   1e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             236   4e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001761266.1|  predicted protein                                  226   1e-67   
gb|KJB59412.1|  hypothetical protein B456_009G253400                    213   1e-62   Gossypium raimondii
ref|XP_001754291.1|  predicted protein                                  212   2e-62   
emb|CDP11372.1|  unnamed protein product                                199   9e-58   Coffea canephora [robusta coffee]
gb|EMS65243.1|  Histidine decarboxylase                                 197   1e-57   Triticum urartu
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               196   5e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               193   6e-55   
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             177   9e-49   Brachypodium distachyon [annual false brome]
ref|XP_001689659.1|  serine decarboxylase                               168   4e-46   Chlamydomonas reinhardtii
ref|XP_011401256.1|  Histidine decarboxylase                            169   1e-45   Auxenochlorella protothecoides
gb|EMT14427.1|  Histidine decarboxylase                                 167   4e-45   
gb|KIZ00141.1|  histidine decarboxylase                                 166   1e-44   Monoraphidium neglectum
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    162   1e-43   
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              163   1e-43   Chlorella variabilis
ref|XP_002953989.1|  serine decarboxylase                               163   2e-43   Volvox carteri f. nagariensis
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          158   1e-41   Sorghum bicolor [broomcorn]
gb|KDD76585.1|  hypothetical protein H632_c172p0                        157   2e-41   Helicosporidium sp. ATCC 50920
ref|XP_003619923.1|  L-tyrosine decarboxylase                           148   1e-38   
ref|XP_005646136.1|  serine decarboxylase                               145   9e-38   Coccomyxa subellipsoidea C-169
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            146   1e-37   Oryza brachyantha
gb|EMS49846.1|  Histidine decarboxylase                                 144   3e-37   Triticum urartu
gb|EAY77466.1|  hypothetical protein OsI_32510                          139   8e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            139   1e-34   Oryza brachyantha
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          138   1e-34   Oryza sativa Japonica Group [Japonica rice]
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            137   5e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002178784.1|  predicted protein                                  135   8e-34   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            135   1e-33   
gb|AGT16577.1|  histidine decarboxylase-like protein                    134   2e-33   Saccharum hybrid cultivar R570
gb|EJK75470.1|  hypothetical protein THAOC_02802                        135   2e-33   Thalassiosira oceanica
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         138   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002292250.1|  histidine decarboxylase                            132   6e-33   Thalassiosira pseudonana CCMP1335
gb|KJE90702.1|  serine decarboxylase                                    135   6e-33   Capsaspora owczarzaki ATCC 30864
ref|XP_004364837.2|  serine decarboxylase                               135   6e-33   Capsaspora owczarzaki ATCC 30864
gb|EEC76705.1|  hypothetical protein OsI_14710                          132   1e-32   Oryza sativa Indica Group [Indian rice]
gb|EMT14424.1|  Histidine decarboxylase                                 132   2e-32   
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            132   2e-32   
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            132   2e-32   Solanum lycopersicum
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               132   3e-32   
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            131   4e-32   Solanum lycopersicum
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            130   6e-32   Nicotiana sylvestris
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    130   7e-32   
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            130   9e-32   Nicotiana tomentosiformis
ref|XP_003592126.1|  Histidine decarboxylase                            130   1e-31   
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    130   1e-31   
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    130   1e-31   
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            130   2e-31   Solanum tuberosum [potatoes]
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 129   2e-31   Solanum lycopersicum
gb|AES62380.2|  serine decarboxylase                                    129   2e-31   Medicago truncatula
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               129   2e-31   Solanum lycopersicum
ref|XP_002454879.1|  hypothetical protein SORBIDRAFT_03g000687          123   2e-31   
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    129   2e-31   Solanum tuberosum [potatoes]
gb|KEH26770.1|  histidine decarboxylase-like protein                    122   2e-31   Medicago truncatula
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            129   2e-31   Solanum tuberosum [potatoes]
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            129   2e-31   Solanum tuberosum [potatoes]
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            129   2e-31   Nicotiana sylvestris
gb|AHG12639.1|  histidine decarboxylase                                 129   3e-31   Nicotiana tabacum [American tobacco]
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            129   3e-31   Solanum lycopersicum
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            129   3e-31   Solanum tuberosum [potatoes]
gb|KHN16991.1|  Histidine decarboxylase                                 128   3e-31   Glycine soja [wild soybean]
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            129   3e-31   
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    128   5e-31   Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    128   5e-31   
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            128   5e-31   Solanum lycopersicum
ref|XP_002679079.1|  predicted protein                                  127   7e-31   Naegleria gruberi strain NEG-M
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               127   9e-31   
ref|XP_002444261.1|  hypothetical protein SORBIDRAFT_07g019126          122   1e-30   
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    127   1e-30   Sesamum indicum [beniseed]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    127   1e-30   Sesamum indicum [beniseed]
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            127   2e-30   Glycine max [soybeans]
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    126   2e-30   
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                126   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            125   8e-30   Cicer arietinum [garbanzo]
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            124   9e-30   Solanum lycopersicum
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            123   3e-29   
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            123   3e-29   Nicotiana sylvestris
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               123   4e-29   Sesamum indicum [beniseed]
ref|XP_003592128.1|  Embryo defective 1075-like protein                 123   4e-29   
gb|KEH43660.1|  serine decarboxylase                                    123   4e-29   Medicago truncatula
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            122   4e-29   
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 122   5e-29   Solanum lycopersicum
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            122   7e-29   Nicotiana tomentosiformis
ref|XP_006591667.1|  PREDICTED: histidine decarboxylase-like            119   7e-29   Glycine max [soybeans]
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    122   8e-29   Nicotiana sylvestris
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            122   1e-28   
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            122   1e-28   Nicotiana tomentosiformis
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                119   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            121   1e-28   Solanum tuberosum [potatoes]
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     121   1e-28   Nicotiana tabacum [American tobacco]
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            121   2e-28   Solanum tuberosum [potatoes]
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                120   2e-28   Solanum lycopersicum
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            120   2e-28   Solanum tuberosum [potatoes]
ref|XP_003607341.1|  Embryo defective 1075-like protein                 120   3e-28   
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            120   3e-28   
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            120   3e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                120   4e-28   Erythranthe guttata [common monkey flower]
ref|NP_001234136.1|  histidine decarboxylase                            119   5e-28   
ref|XP_003607343.1|  Aromatic amino acid decarboxylase 1B               118   6e-28   
ref|XP_003592132.1|  FAR1-related protein                               122   6e-28   
gb|AES89540.2|  serine decarboxylase                                    117   7e-28   Medicago truncatula
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            119   9e-28   Solanum lycopersicum
ref|XP_003592129.1|  Serine decarboxylase                               115   1e-26   
gb|KHN17002.1|  Histidine decarboxylase                                 112   3e-25   Glycine soja [wild soybean]
gb|EMT14426.1|  hypothetical protein F775_23387                         102   3e-24   
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                108   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    107   1e-23   Nicotiana tomentosiformis
ref|WP_026730962.1|  histidine decarboxylase                            106   2e-23   
ref|WP_015112001.1|  Histidine decarboxylase                            103   1e-22   Nostoc sp. PCC 7107
ref|WP_017312078.1|  histidine decarboxylase                            102   4e-22   Fischerella sp. PCC 9339
ref|WP_044451446.1|  histidine decarboxylase                            100   7e-22   
gb|EEE60437.1|  hypothetical protein OsJ_13648                        98.6    7e-21   Oryza sativa Japonica Group [Japonica rice]
ref|WP_026721610.1|  histidine decarboxylase                          98.6    1e-20   Fischerella sp. PCC 9431
ref|WP_016870188.1|  histidine decarboxylase                          98.2    1e-20   Fischerella muscicola
ref|WP_012408195.1|  histidine decarboxylase                          98.2    1e-20   Nostoc punctiforme
ref|WP_009455225.1|  histidine decarboxylase                          97.4    2e-20   Fischerella thermalis
gb|AFW71721.1|  hypothetical protein ZEAMMB73_965103                  92.8    5e-20   
gb|AFW62561.1|  hypothetical protein ZEAMMB73_005785                  91.7    1e-19   
ref|WP_041885112.1|  histidine decarboxylase                          94.4    3e-19   Pedobacter lusitanus
ref|WP_016859640.1|  histidine decarboxylase                          94.4    3e-19   Fischerella muscicola
ref|WP_037437993.1|  histidine decarboxylase                          93.2    7e-19   Pedobacter antarcticus
dbj|BAH97114.1|  amino acid decarboxylase                             91.7    2e-18   Naegleria fowleri [brain-eating amoeba]
ref|WP_036288070.1|  histidine decarboxylase                          91.7    2e-18   
ref|WP_014680621.1|  histidine decarboxylase                          90.5    7e-18   Solitalea canadensis
ref|WP_013663956.1|  histidine decarboxylase                          90.1    8e-18   Sphingobacterium sp. 21
gb|ELU52247.1|  PLP-dependent enzyme, glutamate decarboxylase         88.6    1e-17   Vibrio campbellii CAIM 519 = NBRC 15631
ref|WP_041881750.1|  histidine decarboxylase                          89.4    2e-17   Pedobacter lusitanus
ref|WP_029274788.1|  histidine decarboxylase                          89.0    3e-17   Pedobacter borealis
ref|WP_026362388.1|  histidine decarboxylase                          88.6    3e-17   
ref|WP_038863593.1|  histidine decarboxylase                          88.6    4e-17   Vibrio campbellii
ref|WP_033002296.1|  histidine decarboxylase                          88.2    4e-17   
ref|WP_014201338.1|  histidine decarboxylase                          88.2    5e-17   Owenweeksia hongkongensis
ref|WP_025146293.1|  histidine decarboxylase                          87.8    7e-17   Pedobacter jeongneungensis
ref|WP_041764715.1|  hypothetical protein                             87.8    8e-17   
ref|WP_039472909.1|  histidine decarboxylase                          87.4    8e-17   Pedobacter kyungheensis
gb|KIP17071.1|  histidine decarboxylase                               86.7    2e-16   Burkholderia sp. MSHR3999
ref|WP_042585292.1|  histidine decarboxylase                          86.3    2e-16   
gb|KFF73912.1|  histidine decarboxylase                               85.9    3e-16   Chryseobacterium sp. P1-3
gb|AFY36874.1|  Histidine decarboxylase                               87.8    3e-16   Leptolyngbya sp. PCC 7376
ref|WP_014680343.1|  histidine decarboxylase                          84.7    7e-16   Solitalea canadensis
ref|WP_025665600.1|  histidine decarboxylase                          84.3    9e-16   Aquimarina megaterium
ref|WP_018151708.1|  hypothetical protein                             84.3    1e-15   Leeia oryzae
ref|WP_027411177.1|  histidine decarboxylase                          83.2    2e-15   Aquimarina muelleri
ref|WP_004737502.1|  histidine decarboxylase                          82.8    4e-15   Vibrio splendidus
ref|WP_010521317.1|  histidine decarboxylase                          82.4    5e-15   Aquimarina agarivorans
ref|XP_006851377.1|  hypothetical protein AMTR_s00040p00010950        77.8    7e-15   
ref|XP_001757041.1|  predicted protein                                82.8    1e-14   
ref|XP_008620940.1|  histidine decarboxylase                          82.0    1e-14   Saprolegnia diclina VS20
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                81.3    1e-14   
ref|WP_035090976.1|  histidine decarboxylase                          81.3    1e-14   Aquimarina macrocephali
gb|EZH75803.1|  histidine decarboxylase                               81.3    1e-14   Aquimarina atlantica
ref|WP_034238501.1|  histidine decarboxylase                          80.9    2e-14   Aquimarina atlantica
gb|ERB65930.1|  hypothetical protein N779_07565                       77.8    2e-14   Vibrio coralliilyticus OCN008
ref|WP_010913856.1|  histidine decarboxylase                          80.5    2e-14   Mesorhizobium japonicum
ref|WP_019275400.1|  histidine decarboxylase                          80.5    3e-14   Vibrio coralliilyticus
ref|WP_013621330.1|  histidine decarboxylase                          80.5    3e-14   Cellulophaga lytica
ref|WP_038505799.1|  histidine decarboxylase                          80.5    3e-14   Cellulophaga lytica
ref|WP_034646581.1|  histidine decarboxylase                          80.5    3e-14   Cellulophaga
ref|WP_034760693.1|  histidine decarboxylase                          80.1    3e-14   Chryseobacterium sp. OV259
ref|WP_006960325.1|  MULTISPECIES: histidine decarboxylase            80.1    4e-14   Vibrio
ref|WP_042556656.1|  histidine decarboxylase                          80.1    4e-14   Pseudomonas fulva
ref|WP_043010788.1|  histidine decarboxylase                          80.1    4e-14   Vibrio coralliilyticus
ref|WP_040121251.1|  histidine decarboxylase                          79.7    5e-14   Vibrio coralliilyticus
gb|KIX22111.1|  histidine decarboxylase                               79.3    7e-14   Flavobacterium sp. 316
ref|WP_010181748.1|  histidine decarboxylase                          79.3    7e-14   Aquimarina agarilytica
gb|KDO21825.1|  hypothetical protein SPRG_12642                       79.0    9e-14   Saprolegnia parasitica CBS 223.65
ref|WP_042506313.1|  histidine decarboxylase                          78.6    1e-13   Algibacter lectus
ref|WP_042499973.1|  histidine decarboxylase                          78.6    1e-13   Algibacter lectus
ref|WP_013995757.1|  histidine decarboxylase                          78.2    1e-13   Zobellia galactanivorans
ref|WP_038890337.1|  histidine decarboxylase                          78.2    2e-13   Vibrio campbellii
gb|KGR35339.1|  histidine decarboxylase                               78.2    2e-13   Vibrio campbellii
ref|WP_005427952.1|  histidine decarboxylase                          78.2    2e-13   Vibrio campbellii
ref|WP_010647516.1|  histidine decarboxylase                          78.2    2e-13   Vibrio campbellii
ref|WP_043706361.1|  histidine decarboxylase                          78.2    2e-13   
ref|WP_005533429.1|  histidine decarboxylase                          78.2    2e-13   Vibrio campbellii
ref|WP_007138876.1|  histidine decarboxylase                          78.2    2e-13   Flavobacterium frigoris
ref|WP_043188769.1|  histidine decarboxylase                          78.2    2e-13   Pseudomonas rhizosphaerae
ref|WP_038006112.1|  histidine decarboxylase                          77.8    2e-13   Tenacibaculum sp. 47A_GOM-205m
ref|WP_009963501.1|  histidine decarboxylase                          77.8    2e-13   Verrucomicrobium spinosum
ref|WP_038170807.1|  histidine decarboxylase                          77.8    3e-13   Verrucomicrobium sp. BvORR106
ref|WP_017497877.1|  histidine decarboxylase                          77.8    3e-13   
ref|WP_017290661.1|  hypothetical protein                             78.6    3e-13   
ref|WP_012127831.1|  histidine decarboxylase                          77.4    3e-13   
ref|WP_005788362.1|  histidine decarboxylase                          77.4    4e-13   
ref|WP_013661870.1|  histidine decarboxylase                          77.0    4e-13   
ref|WP_009841733.1|  histidine decarboxylase                          77.0    5e-13   
ref|WP_038239506.1|  histidine decarboxylase                          76.6    6e-13   
dbj|GAE88421.1|  pyridoxal-dependent decarboxylase [ [                75.9    7e-13   
ref|WP_039116802.1|  histidine decarboxylase                          76.3    7e-13   
gb|KJG12110.1|  histidine decarboxylase                               73.6    8e-13   
ref|WP_038258978.1|  histidine decarboxylase                          76.3    8e-13   
emb|CDG20727.1|  Histidine decarboxylase                              76.3    8e-13   
ref|WP_012069347.1|  histidine decarboxylase                          75.9    1e-12   
ref|WP_011142216.1|  histidine decarboxylase                          75.5    1e-12   
ref|WP_019817102.1|  histidine decarboxylase                          75.5    2e-12   
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase            75.5    2e-12   
ref|WP_026731780.1|  histidine decarboxylase                          75.1    2e-12   
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940           74.7    2e-12   
ref|WP_034524496.1|  histidine decarboxylase                          75.1    2e-12   
gb|EQC02399.1|  histidine decarboxylase                               75.1    2e-12   
ref|WP_043144304.1|  histidine decarboxylase                          75.1    2e-12   
ref|WP_042467211.1|  histidine decarboxylase                          75.1    2e-12   
emb|CAN84646.1|  histidine decarboxylase                              75.1    2e-12   
gb|EHI50832.1|  histidine decarboxylase                               75.1    2e-12   
gb|ABO92295.1|  histidine decarboxylase                               75.1    2e-12   
ref|WP_005131724.1|  histidine decarboxylase                          74.7    2e-12   
ref|WP_036146264.1|  histidine decarboxylase                          74.7    2e-12   
ref|WP_026632650.1|  histidine decarboxylase                          74.7    3e-12   
ref|WP_019104578.1|  hypothetical protein                             73.2    3e-12   
ref|WP_020302734.1|  histidine decarboxylase                          74.7    3e-12   
gb|AAA25071.1|  histidine decarboxylase                               74.3    3e-12   
ref|WP_011533709.1|  histidine decarboxylase                          74.7    3e-12   
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase            74.3    3e-12   
ref|WP_015192440.1|  Histidine decarboxylase                          75.1    3e-12   
ref|WP_034281999.1|  histidine decarboxylase                          74.3    3e-12   
gb|EXE40895.1|  histidine decarboxylase                               72.8    4e-12   
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase            74.3    4e-12   
ref|WP_017055794.1|  histidine decarboxylase                          74.3    4e-12   
ref|WP_005196164.1|  histidine decarboxylase                          73.9    4e-12   
ref|WP_023248740.1|  histidine decarboxylase                          73.9    5e-12   
gb|KIP17195.1|  hypothetical protein KY49_6986                        73.9    5e-12   
ref|WP_004639823.1|  histidine decarboxylase                          73.9    5e-12   
ref|WP_001750840.1|  histidine decarboxylase                          73.9    5e-12   
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein          73.9    5e-12   
ref|WP_000603885.1|  histidine decarboxylase                          73.9    5e-12   
ref|WP_000603864.1|  histidine decarboxylase                          73.9    5e-12   
ref|WP_034119545.1|  histidine decarboxylase                          73.6    6e-12   
ref|WP_000603884.1|  histidine decarboxylase                          73.6    6e-12   
ref|WP_031380129.1|  histidine decarboxylase                          73.6    6e-12   
ref|WP_004746555.1|  histidine decarboxylase                          73.6    6e-12   
ref|WP_025821204.1|  histidine decarboxylase                          73.6    7e-12   
ref|WP_000603865.1|  histidine decarboxylase                          73.6    7e-12   
ref|WP_014207282.1|  histidine decarboxylase                          73.2    7e-12   
ref|WP_044119331.1|  histidine decarboxylase                          72.8    7e-12   
ref|WP_012166190.1|  histidine decarboxylase                          73.9    8e-12   
ref|WP_043639836.1|  histidine decarboxylase                          73.2    8e-12   
ref|WP_043592636.1|  histidine decarboxylase                          73.2    9e-12   
ref|WP_020457998.1|  histidine decarboxylase                          73.2    1e-11   
ref|WP_032060642.1|  histidine decarboxylase                          73.2    1e-11   
ref|WP_032009129.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_024436628.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_003516909.1|  histidine decarboxylase                          73.2    1e-11   
ref|WP_032001354.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603871.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031965236.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032035746.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032004531.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_005073362.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_030424673.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603877.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032058746.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase            72.8    1e-11   
ref|WP_005138337.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_005109677.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002046800.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002126558.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_039759067.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_024433575.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031993225.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032037888.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_023896388.1|  Histidine decarboxylase                          72.8    1e-11   
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase            72.8    1e-11   
ref|WP_000603863.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000927250.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603869.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_044101067.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032045777.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031978061.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_021511013.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase            72.8    1e-11   
ref|WP_000603881.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_017815795.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_005128217.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_004840538.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603870.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603866.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603861.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603882.1|  histidine decarboxylase                          72.8    1e-11   
gb|KGF60681.1|  histidine decarboxylase                               72.8    1e-11   
ref|WP_033847713.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031995260.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032063040.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603874.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002132193.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603872.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_003514849.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_023221881.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_033851982.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031964057.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002058887.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603876.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603880.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032027924.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_016653750.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_008735266.1|  histidine decarboxylase                          73.6    1e-11   
ref|WP_032055342.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_023062889.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_039098800.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase            72.8    1e-11   
ref|WP_032058148.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032000503.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031948968.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031976591.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032017576.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_002069908.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603878.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_017725496.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_024439211.1|  histidine decarboxylase                          72.8    1e-11   
gb|AII01327.1|  histidine decarboxylase                               72.8    1e-11   
ref|WP_005123263.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603879.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603875.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032068226.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031961008.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603862.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603867.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_031955420.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_032043772.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603883.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603873.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_000603868.1|  MULTISPECIES: histidine decarboxylase            72.8    1e-11   
ref|WP_032866759.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_025152530.1|  histidine decarboxylase                          72.4    1e-11   
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase            72.4    1e-11   
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...  72.4    1e-11   
ref|WP_032874071.1|  histidine decarboxylase                          72.8    1e-11   
ref|WP_009507303.1|  histidine decarboxylase                          72.4    2e-11   
gb|ERE46826.1|  hypothetical protein N036_34105                       71.2    2e-11   
ref|WP_004156018.1|  histidine decarboxylase                          72.4    2e-11   
ref|WP_024474395.1|  histidine decarboxylase                          72.4    2e-11   
ref|WP_033424613.1|  hypothetical protein                             72.4    2e-11   
ref|WP_040841268.1|  hypothetical protein                             72.0    2e-11   
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                     72.4    2e-11   
ref|WP_017787016.1|  histidine decarboxylase                          72.4    2e-11   
ref|WP_043170531.1|  MULTISPECIES: histidine decarboxylase            72.4    2e-11   
ref|WP_041204738.1|  histidine decarboxylase                          72.0    2e-11   
ref|WP_017784253.1|  histidine decarboxylase                          72.0    2e-11   
ref|WP_041602526.1|  histidine decarboxylase                          72.0    2e-11   
gb|KGY51676.1|  histidine decarboxylase                               72.0    2e-11   
ref|WP_017779468.1|  histidine decarboxylase                          72.0    2e-11   
emb|CBV42710.1|  histidine decarboxylase                              72.0    3e-11   
ref|WP_024740708.1|  histidine decarboxylase                          71.6    3e-11   
ref|WP_039045861.1|  histidine decarboxylase                          71.6    3e-11   
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                72.0    3e-11   
ref|WP_010864579.1|  histidine decarboxylase                          71.6    3e-11   
ref|WP_011154645.1|  histidine decarboxylase                          71.6    4e-11   
ref|WP_020977926.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_017781294.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_026815498.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_017764935.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_036985757.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_004863422.1|  histidine decarboxylase                          71.2    4e-11   
ref|WP_042005730.1|  histidine decarboxylase                          71.2    5e-11   
ref|WP_042050131.1|  histidine decarboxylase                          71.2    5e-11   
ref|WP_031316740.1|  histidine decarboxylase                          70.9    5e-11   
ref|WP_010635694.1|  MULTISPECIES: histidine decarboxylase            70.9    5e-11   
gb|AHV37347.1|  histidine decarboxylase                               70.9    6e-11   
ref|WP_003957081.1|  histidine decarboxylase                          71.2    6e-11   
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...  70.9    6e-11   
ref|WP_010473064.1|  histidine decarboxylase                          71.2    6e-11   
ref|WP_005301029.1|  histidine decarboxylase                          70.5    7e-11   
dbj|BAE94285.1|  histidine decarboxylase                              70.5    7e-11   
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                70.5    7e-11   
ref|NP_001176002.1|  Os10g0105700                                     68.6    7e-11   
ref|WP_003963550.1|  histidine decarboxylase                          70.9    9e-11   
ref|WP_005306879.1|  MULTISPECIES: histidine decarboxylase            70.1    9e-11   
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...  70.1    1e-10   
ref|WP_036788792.1|  histidine decarboxylase                          70.1    1e-10   
dbj|BAE94284.1|  histidine decarboxylase                              70.1    1e-10   
ref|WP_026723910.1|  histidine decarboxylase                          70.5    1e-10   
ref|WP_034327842.1|  histidine decarboxylase                          70.1    1e-10   
gb|KJG27749.1|  histidine decarboxylase                               69.7    1e-10   
gb|KJG15285.1|  histidine decarboxylase                               69.7    2e-10   
gb|KJG35078.1|  histidine decarboxylase                               69.7    2e-10   
ref|WP_037806144.1|  histidine decarboxylase                          70.1    2e-10   
ref|WP_038199974.1|  hypothetical protein                             69.3    2e-10   
ref|WP_022611508.1|  putative Histidine decarboxylase                 69.3    2e-10   
ref|WP_022551663.1|  putative Histidine decarboxylase                 69.3    2e-10   
ref|WP_038196418.1|  hypothetical protein                             69.3    2e-10   
ref|WP_022602237.1|  putative Histidine decarboxylase                 69.3    2e-10   
ref|WP_038267770.1|  histidine decarboxylase                          68.9    3e-10   
ref|WP_019840896.1|  histidine decarboxylase                          68.2    4e-10   
gb|ERE63402.1|  hypothetical protein N036_41465                       65.9    4e-10   
ref|WP_022551512.1|  Histidine decarboxylase                          68.2    5e-10   
ref|WP_004401828.1|  histidine decarboxylase                          68.2    5e-10   
ref|WP_022610851.1|  Histidine decarboxylase                          68.2    5e-10   
ref|WP_026037108.1|  histidine decarboxylase                          67.8    5e-10   
ref|WP_038528108.1|  histidine decarboxylase                          67.8    5e-10   
ref|WP_019504461.1|  hypothetical protein                             68.2    6e-10   
ref|WP_022589616.1|  Histidine decarboxylase                          67.8    6e-10   
ref|XP_003593108.1|  Serine decarboxylase                             63.5    7e-10   
ref|XP_006826559.1|  hypothetical protein AMTR_s04872p00009330        63.5    7e-10   
ref|WP_022591048.1|  putative Histidine decarboxylase                 67.8    7e-10   
ref|WP_022594060.1|  putative Histidine decarboxylase                 67.8    7e-10   
ref|WP_038142997.1|  hypothetical protein                             67.8    7e-10   
ref|WP_038124248.1|  hypothetical protein                             67.8    8e-10   
ref|WP_040574889.1|  hypothetical protein                             67.4    8e-10   
ref|WP_005692801.1|  histidine decarboxylase                          67.4    9e-10   
ref|WP_035211755.1|  histidine decarboxylase                          67.8    9e-10   
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase            67.4    9e-10   
ref|WP_038144733.1|  hypothetical protein                             67.4    9e-10   



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+ AD R + T  V EPVPP V+SD +D   A N G+  KREIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSRLDLTT-VAEPVPPVVKSDDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPF  135

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  183



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 149/168 (89%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+ AD +F+ TA V EPVP  V+S+ +D   A N G+  KREIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSQFDLTA-VAEPVPAVVKSEDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPF  135

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  183



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +1

Query  175  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  354
            AD RF+PTA+V E VP  V+S+ +D+     GG+  +REIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSEGVDAA-VNGGGEEQEREIVLGRNIHTSSFSVTEPDADD  79

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            +STGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  80   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPFIES  139

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT GNLHGIL
Sbjct  140  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGIL  184



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 10/162 (6%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADK-REIVLGRNVHTTCLEVTEPDADNEST  363
            F+P A+VTEPVPP   S         NG  A+K REIVLG+NVHTTCLEVTEPDAD+EST
Sbjct  35   FDPMAVVTEPVPPVADS---------NGHDAEKGREIVLGKNVHTTCLEVTEPDADDEST  85

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYG  145

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW+IEK++YWGYITNCGT GNLHGIL
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKNDYWGYITNCGTEGNLHGIL  187



>ref|XP_003593130.1| Histidine decarboxylase [Medicago truncatula]
Length=311

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 4/170 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  339
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  340  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  519
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  520  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  186



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = +1

Query  175  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  354
            AD RF+PTA+V E VP  V+S+ +D+     GG+  KREIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSE-VDAA-VNGGGQEQKREIVLGRNIHTSSFSVTEPDADD  78

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            +STGDKEAYMASVLARYRKTL +RTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  79   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGALTQLQHFSINNLGDPFIES  138

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT GNLHGIL
Sbjct  139  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTEGNLHGIL  183



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 7/168 (4%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+     F+P A+V EP+PP V S+ +       G +  KREIVLGRNVHTTCL VTEP+
Sbjct  25   EILLTEDFDPAAVVAEPLPPVVMSNGV-------GKEIKKREIVLGRNVHTTCLAVTEPE  77

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            A++E TGDK+AYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  78   ANDELTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPF  137

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  138  IESNYGVHSRQFEVGVLDWFARLWEIEKEEYWGYITNCGTEGNLHGIL  185



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 4/170 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  339
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  340  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  519
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  520  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  186



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 4/170 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADKREIVLGRNVHTTCLEVTE  339
            EL  D  F+ +AI+ +PVPP V +D       A  NGGK +KREIVLGRN+HTTCLEVTE
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTE  76

Query  340  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGD  519
            P+AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGD
Sbjct  77   PEADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGD  136

Query  520  PFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            PFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  137  PFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  186



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 144/166 (87%), Gaps = 12/166 (7%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSD-----KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  351
            F+PTA+V EP+PP V ++     K+   P       +KREIVLGRNVHTTCL VTEPDA+
Sbjct  18   FDPTAVVAEPLPPVVTTNGNLIGKVAEDP-------NKREIVLGRNVHTTCLAVTEPDAN  70

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            +E TGDK+AYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  71   DEFTGDKDAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  130

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  131  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  176



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  351
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHTTCL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  74

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  75   DESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  134

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  135  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  180



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  351
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHTTCL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  79

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIE
Sbjct  80   DESTGDKEAYMASVLARYRKNLLERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIE  139

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  140  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  185



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  351
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHT+CL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  74

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIE
Sbjct  75   DESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIE  134

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  135  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  180



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDAD  351
            G+F+   + ++P+PP   S+    L+     +  +  KREIVLGRNVHT+CL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  79

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIE
Sbjct  80   DESTGDKEAYMASVLARYRKSLLERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIE  139

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  140  SNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  185



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 9/162 (6%)
 Frame = +1

Query  187  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  363
            F+ +A+V  EP+PP V         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIV--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            GDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYG
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYG  131

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  132  VHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  173



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            F+PTA+VTEP+PP V S     L    A +     ++++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVVTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESN  136

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHG+L
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVL  180



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  336
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDRKGSREKQMVLGRNVHTTCLAVT  69

Query  337  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  516
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  517  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHG+L
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVL  180



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  336
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  337  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  516
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  517  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHG+L
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVL  180



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADKREIVLGRNVHTTCLEVT  336
            E+ +D  F+PTA+V EP+PP V S D  D     A +   + ++++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  337  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  516
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLG
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYPYNLDFDYGALTQLQHFSINNLG  129

Query  517  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            DPFIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHG+L
Sbjct  130  DPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVL  180



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  360
            G F PTAI  EP+PP V  + +D P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAIEVEPLPPVVPENGVDKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  179



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 9/162 (6%)
 Frame = +1

Query  187  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  363
            F+ +A+V  EP+PP +         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIL--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            GDKEAYMASVLARYRK L+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYG
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYG  131

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  132  VHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  173



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 141/171 (82%), Gaps = 13/171 (8%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQS----------DKLDSPPAANGGKADKREIVLGRNVHTTCLEVT  336
            F+PTA+V EP+PP  ++          D        NGG+   +EIVLGRNVHT+CL VT
Sbjct  23   FDPTAVVVEPLPPLAETANGIGYSGEDDVFQVKEMLNGGE---KEIVLGRNVHTSCLAVT  79

Query  337  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLG  516
            EP+A++E TGDKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQHFSINNLG
Sbjct  80   EPEANDEFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQHFSINNLG  139

Query  517  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            DPFIESNYGVHSR FEVGVLDWFARLW+IEKD+YWGYITNCGT GNLHGIL
Sbjct  140  DPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLHGIL  190



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+ TA++ +PVP  V  + +    A      +KREIVLGRNVHTTCLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPSAVVDNGILKEEAQINKGKEKREIVLGRNVHTTCLEVTEPEADDEITG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  185



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            F+PTA+VTEP+PP + S     L    A +     ++++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVLTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESN  136

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHG+L
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGVL  180



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 13/168 (8%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+ +D  F+PTA+VTEP+P PV           NGG   +RE+VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGG--GEREMVLGRNVHTTSLAVTEPE  65

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  125

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  126  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  173



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+ A+  F+  A++ EP+PP V +++  +       K + REIVLGRN+HT CLEVTEPD
Sbjct  20   EILAED-FDLRAVIKEPLPPVVTAEEEVAGEEET--KQNGREIVLGRNLHTECLEVTEPD  76

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            A++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  77   ANDEHTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALGQLQHFSINNLGDPF  136

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW+IEKD+YWGYITNCGT GNLHGIL
Sbjct  137  IESNYGVHSRQFEVGVLDWFARLWEIEKDQYWGYITNCGTEGNLHGIL  184



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+PTA+VTEP+P PV +++ ++    NG   D RE+VLGRN+HTT L VTEP+ +++ TG
Sbjct  24   FDPTAVVTEPLPSPVTTNE-ENLKKTNGVGGD-REMVLGRNIHTTSLAVTEPEVNDDFTG  81

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  82   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  141

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  142  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  182



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 145/176 (82%), Gaps = 11/176 (6%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTT  321
            ++ +DG F+PTA+  EP+P PV        + + L      NGG   +RE+VLGRNVHTT
Sbjct  18   DILSDG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVNGG--GEREMVLGRNVHTT  74

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  501
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  134

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  135  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  190



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+  AI+ +P+P  V  + +    A      +KR+IVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDVAAIIKDPLPSLVAENGIVKEEAQINEGNEKRKIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            D+EA+MASVLARYR++L ERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYRRSLTERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  185



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  360
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  179



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  360
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  179



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  181  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNES  360
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            TGDKEA MA VLARYRK L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNY
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNY  136

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  137  GVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  179



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+ TA++ +PVP  V  + +    A      +KREIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  185



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 2/163 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPP--AANGGKADKREIVLGRNVHTTCLEVTEPDADNES  360
            F+PTA+VTEP+P PV ++  +         G    RE+VLGRN+HTT L VTEP+ +++ 
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGDREMVLGRNIHTTSLAVTEPEVNDDF  83

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNY
Sbjct  84   TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNY  143

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  144  GVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  186



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  363
             +PTA+V EP+PP    D ++         +  +REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            GDKEAYMASVLARYR++L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYG  145

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  187



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            A NG K + REIVLGRNVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNGREIVLGRNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEK EY
Sbjct  87   LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSEY  146

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHGIL
Sbjct  147  WGYITNCGTEGNLHGIL  163



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+ TA++ +PVP  V  + +    A      +KREIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  23   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  82

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            D+EA+MASVLARY++ L ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  83   DREAHMASVLARYKRALTERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGV  142

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  143  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  183



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  363
             +PTA+V EP+PP    D ++         +  +REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            GDKEAYMASVLARYR++L+ERTKYHLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYG  145

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT GNLHGIL
Sbjct  146  VHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHGIL  187



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 142/168 (85%), Gaps = 13/168 (8%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            E+ +D  F+PTA+VTEP+P PV           NGG   +R +VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGG--GERVMVLGRNVHTTSLAVTEPE  65

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  125

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  126  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  173



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 10/161 (6%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+PTA+VTEP+P         SP   NGG  + RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLP---------SPTELNGGGGE-REMVLGRNIHTTSLAVTEPEVNDEFTG  76

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            DKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  77   DKEAYMASVLARYRKTLVERTKFHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  136

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  137  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  177



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            A NG K ++REIVLG+NVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNEREIVLGKNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEK EY
Sbjct  87   LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSEY  146

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHGIL
Sbjct  147  WGYITNCGTEGNLHGIL  163



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            F+PTA+V EP+P  V SD    L    A +   + ++ +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKFAEDLKSSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESN  136

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGT GNLHG+L
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVL  180



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 146/176 (83%), Gaps = 11/176 (6%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQ----SDKLDSPP----AANGGKADKREIVLGRNVHTT  321
            E+ +D  F+PTA+VTEP+PP +     +D  +  P      NGG    RE+VLGRNVHTT
Sbjct  18   EILSDD-FDPTAVVTEPLPPSLTNGTGADHGEENPRKTVVTNGG--GDREMVLGRNVHTT  74

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  501
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  134

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  135  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  190



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 16/168 (10%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKAD-------KREIVLGRNVHTTCLEVTEPD  345
            F+P A++++P+PP V           NGG  D        REIVLG+NVHT CL VTEPD
Sbjct  25   FDPIAMISDPLPPQV---------VENGGIVDDEAEDKQNREIVLGKNVHTMCLAVTEPD  75

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD+E TG++EAYMASVLARYR++L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPF
Sbjct  76   ADDEVTGEREAYMASVLARYRRSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPF  135

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  136  IESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  183



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            F+PTA+V EP+P  V SD    L    A +   + ++ +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKLAEDLKGSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TGDK+AYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESN
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALTQLQHFSINNLGDPFIESN  136

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGT GNLHG+L
Sbjct  137  YGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGVL  180



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 10/169 (6%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANG------GKADK--REIVLGRNVHTTCLEVTEP  342
            F+PTA+V EP+PP V +   D  P+ +       GK  K  REIVLGRNVHT+CL VTEP
Sbjct  25   FDPTAVVAEPLPPVVTA--ADGGPSESEEEEEGVGKPVKKSREIVLGRNVHTSCLAVTEP  82

Query  343  DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDP  522
            +A++E TGDK+AYMA VLARYRKTL+ERTK+HLGYPYNLDF+YG L+QLQHFSINNLGDP
Sbjct  83   EANDEFTGDKDAYMAGVLARYRKTLMERTKHHLGYPYNLDFEYGALAQLQHFSINNLGDP  142

Query  523  FIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            FIESNYGVHSRQFEVGVLDWFARLW+IEK+EYWGYITNCGT GNLHGIL
Sbjct  143  FIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGIL  191



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 143/179 (80%), Gaps = 21/179 (12%)
 Frame = +1

Query  187  FNPTAIVTEPVPP-----------------PVQSD-KLDSPPAANGGKADKREIVLGRNV  312
            F+PTA+V EP+PP                 PV+   K  +    NGG+   +EIVLGRNV
Sbjct  24   FDPTAVVAEPLPPLAETVNGVGDFEEDDVCPVKEKVKNTTTTEMNGGE---KEIVLGRNV  80

Query  313  HTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQ  492
            HTTCL VTEP+A+++ TGDKEAYMASVLARYRKTLVERTK+HLGYPYNLDFDYG L QLQ
Sbjct  81   HTTCLAVTEPEANDDFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQ  140

Query  493  HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HFSINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IEKD+YWGYITNCGT GNLHGIL
Sbjct  141  HFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIEKDDYWGYITNCGTEGNLHGIL  199



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 139/168 (83%), Gaps = 16/168 (10%)
 Frame = +1

Query  169  LFADGRFNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            L  D   + TAIV  EP+P  V+++               REIVLG+NVHT+CLEVTEPD
Sbjct  19   LREDIDLDLTAIVAAEPLPEVVENE---------------REIVLGKNVHTSCLEVTEPD  63

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD+E TGDK+AYMASVLARYRKTL+ERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  64   ADDELTGDKDAYMASVLARYRKTLIERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  123

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSRQFEVGVLDWFARLW+IE++EYWGYITNCGT GNLHGIL
Sbjct  124  IESNYGVHSRQFEVGVLDWFARLWEIERNEYWGYITNCGTEGNLHGIL  171



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F PTA++ EP+P P   + L      NG    +RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPCP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  127

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  128  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  168



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            FN TA +T+ V  P+ +++ D      A NG +  +R IVLGRN+HT CLEV+EPD D+E
Sbjct  25   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  84

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TG++EAYMASVLA+Y+K+L ERTKYHLGYPYNLDFDY  LSQLQHFSINNLGDPFIESN
Sbjct  85   VTGEREAYMASVLAKYKKSLTERTKYHLGYPYNLDFDYEALSQLQHFSINNLGDPFIESN  144

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  145  YGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  188



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+PTA+VTEP+PPPV     +   A  GG   +RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLPPPVT----NGIGADKGGGGGEREMVLGRNIHTTSLAVTEPEVNDEFTG  82

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            DKEAYMASVLARYRKTLVERTK HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  83   DKEAYMASVLARYRKTLVERTKNHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  142

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  143  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  183



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNE  357
            FN TA +T+ V  P+ +++ D      A NG +  +R IVLGRN+HT CLEV+EPD D+E
Sbjct  65   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  124

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
             TG++EAYMASVLA+Y+K+L ERTKYHLGYPYNLDFDY  LSQLQHFSINNLGDPFIESN
Sbjct  125  VTGEREAYMASVLAKYKKSLTERTKYHLGYPYNLDFDYEALSQLQHFSINNLGDPFIESN  184

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            YGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  185  YGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  228



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 143/176 (81%), Gaps = 10/176 (6%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTT  321
            ++ ++G F+PTA+  EP+P PV        + D L        G  + RE+VLGRNVHTT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEDNLKKTKVVTNGGGE-REMVLGRNVHTT  75

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFS  501
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFS
Sbjct  76   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFS  135

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            INNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  136  INNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  191



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F PTA++ EP+P P   + L      NG    +RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPWP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGV
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGV  127

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  128  HSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  168



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
             + T +++EP+ P   ++++ S          KREIVLGRNVHT CL VTEPDAD+E TG
Sbjct  25   IDATTVISEPLSPV--NEEIVSDETKKSDVEQKREIVLGRNVHTMCLAVTEPDADDEVTG  82

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            ++EAYMASVLARYRK+L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGV
Sbjct  83   EREAYMASVLARYRKSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGV  142

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFA LW++EKDEYWGYITNCGT GNLHGIL
Sbjct  143  HSRQFEVGVLDWFAHLWELEKDEYWGYITNCGTEGNLHGIL  183



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 139/168 (83%), Gaps = 7/168 (4%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPP-------AANGGKADKREIVLGRNVHTTCLEVTEPD  345
            F+PTA+VTEP+P PV ++  +             GG    RE+VLGRN+HTT L VTEP+
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGGGGGGDREMVLGRNIHTTSLAVTEPE  83

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
             ++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPF
Sbjct  84   VNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPF  143

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  144  IESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  191



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +1

Query  262  ANGGKADK-REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            +NG +  K REIVLG+NVHTTCLEVTEPDAD+ESTGDK+AYMASVLARYRKTL+ERT++H
Sbjct  51   SNGEEVVKPREIVLGKNVHTTCLEVTEPDADDESTGDKDAYMASVLARYRKTLLERTQHH  110

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            LGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKD+Y
Sbjct  111  LGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDY  170

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHGIL
Sbjct  171  WGYITNCGTEGNLHGIL  187



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 145/177 (82%), Gaps = 12/177 (7%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADKREIVLGRNVHT  318
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG   +RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  319  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHF  498
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHF
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHF  134

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  135  SINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  191



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 145/177 (82%), Gaps = 12/177 (7%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADKREIVLGRNVHT  318
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG   +RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  319  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHF  498
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHF
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHF  134

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SINNLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  135  SINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  191



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 141/174 (81%), Gaps = 10/174 (6%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLD------SPPAANGGKADKREIVLGRNVHTTCL  327
            E+  D  F+PTA+V EP+P P+ +  +            NGG+   RE+VLGRNVHTT L
Sbjct  21   EILGDD-FDPTAVVAEPLPSPLTNGHVADEEEKVKKTKVNGGE---REMVLGRNVHTTSL  76

Query  328  EVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSIN  507
             VTEP+ ++E TGDKEAYMASVLARYRKTLVERTK HLGYPYNLDFDYG L QLQHFSIN
Sbjct  77   AVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYPYNLDFDYGALGQLQHFSIN  136

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NLGDPFIESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  137  NLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  190



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 11/165 (7%)
 Frame = +1

Query  208  TEPVPPPVQSDKLDSP------PAANGGK-----ADKREIVLGRNVHTTCLEVTEPDADN  354
             EP+P  +   K+  P        A+ G+     + KREIVLGRNVHT+CLEVTEPDAD+
Sbjct  24   VEPLPEELNPKKIKVPLHLKNEDGADNGENSTLVSGKREIVLGRNVHTSCLEVTEPDADD  83

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            E TGD+EA MAS+LARYRK+L+ERT++HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  84   EVTGDREACMASILARYRKSLIERTRHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  143

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSRQFEVGVLDWFARLW++E++EYWGYITNCGT GNLHGIL
Sbjct  144  NYGVHSRQFEVGVLDWFARLWELERNEYWGYITNCGTEGNLHGIL  188



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  354
            F+P A+  EP+P  V             AA  G   KREIVLGRNVHTTCL + EPDA++
Sbjct  13   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  72

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            E TGDK+AYMA VLARYRKTLVERTK HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  73   ELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  132

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGT GNLHGIL
Sbjct  133  NYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGIL  177



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  471
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  13   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  72

Query  472  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXG  651
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT G
Sbjct  73   GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  132

Query  652  NLHGIL  669
            NLHGIL
Sbjct  133  NLHGIL  138



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADN  354
            F+P A+  EP+P  V             AA  G   KREIVLGRNVHTTCL + EPDA++
Sbjct  53   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  112

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            E TGDK+AYMA VLARYRKTLVERTK HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES
Sbjct  113  ELTGDKDAYMAGVLARYRKTLVERTKQHLGYPYNLDFDYGALAQLQHFSINNLGDPFIES  172

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSRQFEVGVLDWFARLW+IEK +YWGYITNCGT GNLHGIL
Sbjct  173  NYGVHSRQFEVGVLDWFARLWEIEKSDYWGYITNCGTEGNLHGIL  217



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  471
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  48   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  107

Query  472  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXG  651
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT G
Sbjct  108  GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  167

Query  652  NLHGIL  669
            NLHGIL
Sbjct  168  NLHGIL  173



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY  471
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYPYNLDFDY
Sbjct  57   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDY  116

Query  472  GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXG  651
            G LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKDEYWGYITNCGT G
Sbjct  117  GALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEG  176

Query  652  NLHGIL  669
            NLHGIL
Sbjct  177  NLHGIL  182



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  289  EIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD  468
            EIVLGRNVHT+CLEVTEPDAD+ESTGDKEAYMASVLARYRK+L+ERT++HLGYPYNLDFD
Sbjct  1    EIVLGRNVHTSCLEVTEPDADDESTGDKEAYMASVLARYRKSLIERTQHHLGYPYNLDFD  60

Query  469  YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTX  648
            YG L QLQ FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW+IEKD+YWGYITNCGT 
Sbjct  61   YGALGQLQPFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDDYWGYITNCGTE  120

Query  649  GNLHGIL  669
            GNLHGIL
Sbjct  121  GNLHGIL  127



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 136/169 (80%), Gaps = 10/169 (6%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEP  342
            F PTA+  EP+P PV        + + L      NG    +RE+VLGRNVHTT L VTEP
Sbjct  12   FVPTAVFNEPLPWPVINGNKADHEGENLKKTKVMNG--RGEREMVLGRNVHTTSLAVTEP  69

Query  343  DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDP  522
            ++++E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQ FSINNLGDP
Sbjct  70   ESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQQFSINNLGDP  129

Query  523  FIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             IESNYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  130  VIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  178



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            FN   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FNSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  185



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  185



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F  T I+    P  V++    S  A  G +  +REIVLGRNVH   L VTEPD D E TG
Sbjct  25   FGGTVIIPNSFPTMVETRASISGEARRGEEKQRREIVLGRNVHKMSLPVTEPDVDEEMTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            +KEAYMAS+LA+YRK+LVERT++HLGYPYNLDFDYG L+QLQHFSINNLGDPFIES YGV
Sbjct  85   EKEAYMASILAKYRKSLVERTEHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESKYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  185



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+ T++V +PVPP V  +  +        + +KR IVLGRN+HT  LEVTEPDAD++ TG
Sbjct  25   FDATSLVMDPVPPAVVDNGNEEVQVYK--EKEKRLIVLGRNIHTMSLEVTEPDADDDITG  82

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            D+EA++ASVLARY++ L ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGV
Sbjct  83   DREAHIASVLARYKRALTERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGV  142

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  143  HSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  183



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  8    FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  67

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  68   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  127

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  128  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  168



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
            F+   I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGV  546
            ++EAYMA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGV
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGV  144

Query  547  HSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            HSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  145  HSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  185



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +1

Query  202  IVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  381
            I+ + V   +  + + +    NG +  +R+IVLGRN+HTTCLEVTEPD D+E TG++EAY
Sbjct  3    IMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTGEREAY  62

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            MA VLA+Y+K+L ERT YHLGYPYNL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  63   MAGVLAKYKKSLTERTNYHLGYPYNLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQF  122

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  123  EVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  158



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 129/144 (90%), Gaps = 7/144 (5%)
 Frame = +1

Query  259  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  417
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  418  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  597
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  598  DIEKDEYWGYITNCGTXGNLHGIL  669
            +IEK++YWGYITNCGT GNLHGIL
Sbjct  155  EIEKNDYWGYITNCGTEGNLHGIL  178



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 129/144 (90%), Gaps = 7/144 (5%)
 Frame = +1

Query  259  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  417
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  418  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  597
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  598  DIEKDEYWGYITNCGTXGNLHGIL  669
            +IEK++YWGYITNCGT GNLHGIL
Sbjct  155  EIEKNDYWGYITNCGTEGNLHGIL  178



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = +1

Query  196  TAIVTEPVPPPVQS-----DKLDSP--PAANGGKADKREIVLGRNVHTTCLEVTEPDADN  354
            + ++ EP+P PV +     + L  P      GG    RE+VLGRN+HTT L VTEP+ ++
Sbjct  79   STVIAEPLPSPVTNGTGDEENLKKPNGAGGRGGGGGDREMVLGRNIHTTSLAVTEPEVND  138

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            E TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYG L QLQHFSINNLGDPFIES
Sbjct  139  EFTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIES  198

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NYGVHSR FEVGVLDWFARLW+IE+D+YWGYITNCGT GNLHGIL
Sbjct  199  NYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCGTEGNLHGIL  243



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 8/162 (5%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLD-SPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNEST  363
            F+ T IV EPVP       LD        G A  REIVLGRNVHT C  + EP+ D+E T
Sbjct  25   FDTTDIV-EPVPT------LDLEGVGGEEGSAKTREIVLGRNVHTMCFTIKEPEVDDEVT  77

Query  364  GDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYG  543
            G++EAYMASVLARYR++L+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYG
Sbjct  78   GEREAYMASVLARYRRSLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYG  137

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            VHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  138  VHSRQFEVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGIL  179



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = +1

Query  208  TEPVPPPVQSDKLDSPP--AANG----GKADKREIVLGRNVHTTCLEVTEPDADNESTGD  369
             EP+P      ++  P   A NG    G    REIVLGRNVH  C  + EP+AD+E TG+
Sbjct  16   VEPLPEEFDPKEISGPADSAPNGILGSGDGKNREIVLGRNVHKMCFAINEPEADDEVTGE  75

Query  370  KEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVH  549
            +EAYMASVLARYRK+LVERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVH
Sbjct  76   REAYMASVLARYRKSLVERTKHHLGYPYNLDFDYGALNQLQHFSINNLGDPFIESNYGVH  135

Query  550  SRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            SRQFEVGVLDWFARLW++E+ EYWGYITNCGT GNLHG+L
Sbjct  136  SRQFEVGVLDWFARLWELERSEYWGYITNCGTEGNLHGLL  175



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 7/144 (5%)
 Frame = +1

Query  259  AANGGKA-------DKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  417
            AANG  A       + REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKESREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  418  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  597
            +ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  154

Query  598  DIEKDEYWGYITNCGTXGNLHGIL  669
            +IEK+++WGYITNCGT GNLHGIL
Sbjct  155  EIEKNDFWGYITNCGTEGNLHGIL  178



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            KRE+VLGRNVH TC EV EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYPYNLD
Sbjct  42   KREVVLGRNVHMTCFEVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLD  101

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  102  FDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  161

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  162  TEGNLHGIL  170



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 4/137 (3%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            AANG    +REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+H
Sbjct  63   AANG----RREIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHH  118

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            LGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEY
Sbjct  119  LGYPYNLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEY  178

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHGIL
Sbjct  179  WGYITNCGTEGNLHGIL  195



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +1

Query  202  IVTEPVPPPVQSDKLDSPP--AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKE  375
            ++ E   P   S  +DS P     G     REIVLGRNVH  C  + EP+AD+E TG++E
Sbjct  18   LLPEEFDPKEISAPVDSQPNGVLEGRDGKSREIVLGRNVHKLCFAINEPEADDEVTGERE  77

Query  376  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  555
            AYMASVLARYRK+L+ERTK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSR
Sbjct  78   AYMASVLARYRKSLIERTKHHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSR  137

Query  556  QFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            QFEVGVLDWFARLW++E++EYWGYITNCGT GNLHG L
Sbjct  138  QFEVGVLDWFARLWELERNEYWGYITNCGTEGNLHGFL  175



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +1

Query  262  ANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  441
            A G    +REIVLGRN+H  C  +TEP+ D+E TGDK+ YMA VLARYRKTLVERTKYHL
Sbjct  34   AIGKLRGEREIVLGRNLHDQCFSITEPEHDDEETGDKDVYMAGVLARYRKTLVERTKYHL  93

Query  442  GYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYW  621
            GYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYW
Sbjct  94   GYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYW  153

Query  622  GYITNCGTXGNLHGIL  669
            GYITNCGT GNLHG+L
Sbjct  154  GYITNCGTEGNLHGLL  169



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  274  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  453
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  454  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  633
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  634  NCGTXGNLHGIL  669
            NCGT GNLHGIL
Sbjct  165  NCGTEGNLHGIL  176



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  274  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  453
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  454  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  633
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  634  NCGTXGNLHGIL  669
            NCGT GNLHGIL
Sbjct  165  NCGTEGNLHGIL  176



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  274  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  453
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  104

Query  454  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  633
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  164

Query  634  NCGTXGNLHGIL  669
            NCGT GNLHGIL
Sbjct  165  NCGTEGNLHGIL  176



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  GGKAD------KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERT  429
            GGKA+      +REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERT
Sbjct  51   GGKAEGPTSNGRREIVMGRNVHTSCFAVKEPDADDEVTGEREATMASVLALYRRSLVERT  110

Query  430  KYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEK  609
            K+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK
Sbjct  111  KHHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEK  170

Query  610  DEYWGYITNCGTXGNLHGIL  669
            DEYWGYITNCGT GNLHGIL
Sbjct  171  DEYWGYITNCGTEGNLHGIL  190



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            KREI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYPYNLD
Sbjct  29   KREISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLD  88

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCG
Sbjct  89   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCG  148

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  149  TEGNLHGIL  157



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   247 bits (631),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  274  KADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPY  453
            K  ++EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYPY
Sbjct  113  KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPY  172

Query  454  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYIT  633
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++E +EYWGYIT
Sbjct  173  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYIT  232

Query  634  NCGTXGNLHGIL  669
            NCGT GNLHGIL
Sbjct  233  NCGTEGNLHGIL  244



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 126/156 (81%), Gaps = 5/156 (3%)
 Frame = +1

Query  217  VPPPVQSDKLDSPPAANGGKA-----DKREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  381
            +P  +  D     P   G  A      +REIVLGRN+H  C  +TEP+ D+E TG+K+ Y
Sbjct  14   LPEEISIDSCGIEPDLEGADAIGKLRGEREIVLGRNLHDQCFSITEPEHDDEETGEKDVY  73

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            MA VLARYRKTLVERTKYHLGYPYNLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  74   MAGVLARYRKTLVERTKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQF  133

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EVGVLDWFARLW++EK+EYWGYITNCGT GNLHG+L
Sbjct  134  EVGVLDWFARLWELEKNEYWGYITNCGTEGNLHGLL  169



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDF  465
            REIV+GRNVH +C  V EPDAD+E TG++EA MA VLARYR+ L+ERTK+HLGYPYNLDF
Sbjct  42   REIVMGRNVHASCFAVKEPDADDEVTGEREATMAGVLARYRRCLIERTKHHLGYPYNLDF  101

Query  466  DYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT  645
            DYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD+EKDEYWGYITNCGT
Sbjct  102  DYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDLEKDEYWGYITNCGT  161

Query  646  XGNLHGIL  669
             GNLHGIL
Sbjct  162  EGNLHGIL  169



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 124/137 (91%), Gaps = 4/137 (3%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            AANG    KREIV+GRNVHT+C  V EPDAD+E TG++EA MAS+LA YR++LVERTK+H
Sbjct  58   AANG----KREIVMGRNVHTSCFAVKEPDADDEETGEREATMASILALYRRSLVERTKHH  113

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            LGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EKDEY
Sbjct  114  LGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFASLWELEKDEY  173

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHGIL
Sbjct  174  WGYITNCGTEGNLHGIL  190



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDF  465
            REIVLGRNVHT C  + EP+AD+E TG++EAYMASVLARYR++L++RTK+HLGYPYNLDF
Sbjct  52   REIVLGRNVHTMCFAIKEPEADDEVTGEREAYMASVLARYRRSLIDRTKHHLGYPYNLDF  111

Query  466  DYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGT  645
            DYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT
Sbjct  112  DYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITNCGT  171

Query  646  XGNLHGIL  669
             GNLHGIL
Sbjct  172  EGNLHGIL  179



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            KREI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYPYNLD
Sbjct  29   KREISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYPYNLD  88

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EK+EYWGYITNCG
Sbjct  89   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFALLWELEKNEYWGYITNCG  148

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  149  TEGNLHGIL  157



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            +REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YRK+LVERTK+HLGYPYNLD
Sbjct  38   RREIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRKSLVERTKHHLGYPYNLD  97

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  98   FDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  157

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  158  TEGNLHGIL  166



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            +R IV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYPYNLD
Sbjct  67   RRVIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYPYNLD  126

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCG
Sbjct  127  FDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCG  186

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  187  TEGNLHGIL  195



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 126/158 (80%), Gaps = 8/158 (5%)
 Frame = +1

Query  196  TAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKE  375
             A+  E  P P + +   SP         +REIVLGRNVHT    V EPDAD+E TG++E
Sbjct  33   VAMEVESPPRPAEEEGEGSPT--------RREIVLGRNVHTASFAVKEPDADDEETGERE  84

Query  376  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  555
            A MASVLA YR+ LVERTK+HLGYPYNLDFDYG L QLQHFSINNLGDPFIESNYGVHSR
Sbjct  85   AAMASVLALYRRNLVERTKHHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSR  144

Query  556  QFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            QFEVGVLDWFAR+W++EK+EYWGYITNCGT GNLHGIL
Sbjct  145  QFEVGVLDWFARIWELEKNEYWGYITNCGTEGNLHGIL  182



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  271  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  450
            G   +REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YR+ LVERTK+HLGYP
Sbjct  52   GSPTRREIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYP  111

Query  451  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  630
            YNLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFAR+W++EK+EYWGYI
Sbjct  112  YNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARIWELEKNEYWGYI  171

Query  631  TNCGTXGNLHGIL  669
            TNCGT GNLHGIL
Sbjct  172  TNCGTEGNLHGIL  184



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  271  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  450
            G  + R IVLGRN+HT    + EP++D+E TG++E YMASVLA+YRK+LVERTK+HLGYP
Sbjct  41   GAGEDRAIVLGRNMHTVSFAIKEPESDDELTGEREGYMASVLAKYRKSLVERTKHHLGYP  100

Query  451  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  630
            YNLD DYG LSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EK EYWGYI
Sbjct  101  YNLDLDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKHEYWGYI  160

Query  631  TNCGTXGNLHGIL  669
            TNCGT GNLHGIL
Sbjct  161  TNCGTEGNLHGIL  173



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  VHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQL  489
            +H +  ++TEPD D+E TG+K+AYMASVLARYRK+L E++KYHLGYPYNLDFDYG LSQL
Sbjct  1    MHGSSFKITEPDHDDEVTGEKDAYMASVLARYRKSLTEKSKYHLGYPYNLDFDYGALSQL  60

Query  490  QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW++EKDEYWGYITNCGT GNLHGIL
Sbjct  61   QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITNCGTEGNLHGIL  120



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 117/144 (81%), Gaps = 20/144 (14%)
 Frame = +1

Query  259  AANG-----GKADK--REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  417
            AANG      K DK  REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  418  VERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  597
            +ERTK+HL             +QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW
Sbjct  95   MERTKHHL-------------AQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  141

Query  598  DIEKDEYWGYITNCGTXGNLHGIL  669
            +IEK++YWGYITNCGT GNLHGIL
Sbjct  142  EIEKNDYWGYITNCGTEGNLHGIL  165



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  349  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFI  528
            D++ TGD++AYMA +LARYRKTLVE+TK+HLGYPYNLDFDYG LSQLQHFSINNLGDPFI
Sbjct  2    DDDVTGDRDAYMAGILARYRKTLVEKTKFHLGYPYNLDFDYGALSQLQHFSINNLGDPFI  61

Query  529  ESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            ESNYGVHSRQFEVGVLDWFARLW++EK+EYWGYITNCGT GNLHGIL
Sbjct  62   ESNYGVHSRQFEVGVLDWFARLWELEKEEYWGYITNCGTEGNLHGIL  108



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   199 bits (505),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            MASVLARYRKTL+ERTK+HLGYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  1    MASVLARYRKTLIERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQF  60

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EVGVLDWFARLW+IEK EYWGYITNCGT GNLHGIL
Sbjct  61   EVGVLDWFARLWEIEKSEYWGYITNCGTEGNLHGIL  96



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            MA VLARYR++LVERTK+HLGYPYNLDF+YG LSQLQHFSINNLGDPFIESNYGVHSRQF
Sbjct  1    MAGVLARYRRSLVERTKHHLGYPYNLDFEYGALSQLQHFSINNLGDPFIESNYGVHSRQF  60

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EVGVLDWFARLWD+EKDEYWGYITNCGT GNLHGIL
Sbjct  61   EVGVLDWFARLWDLEKDEYWGYITNCGTEGNLHGIL  96



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  277  ADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYN  456
            A ++EIVLGR +  +CL++ E DA+NE++G  +AYM +VLARY    +ERTK+ +GYP N
Sbjct  18   ACRKEIVLGRQIQPSCLDIREFDANNEASGATDAYMTAVLARYTHKFLERTKHFIGYPIN  77

Query  457  LDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITN  636
            LDFDY  L QL  FSINN+GDPFIESNYGVHS+ FEVG L+WFARLW+IEK+EYWGYITN
Sbjct  78   LDFDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEVGTLNWFARLWEIEKEEYWGYITN  137

Query  637  CGTXGNLHGIL  669
             GT GNLHGIL
Sbjct  138  GGTEGNLHGIL  148



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLD  462
            ++EIVLGR +  +CL++ E DA+NES+   +AYM +VLARY    +ERTK+ +GYP NLD
Sbjct  20   RKEIVLGRQIQPSCLDIRELDANNESSEATDAYMTAVLARYTHKFLERTKHVIGYPINLD  79

Query  463  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCG  642
            FDY  L QL  FSINN+GDPFIESNYGVHS+ FEVG L+WFARLW+IEK+EYWGYITN G
Sbjct  80   FDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEVGTLNWFARLWEIEKEEYWGYITNGG  139

Query  643  TXGNLHGIL  669
            T GNLHGIL
Sbjct  140  TEGNLHGIL  148



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  510
            V EP +D E+  ++ A +A++LA +   L ERT +HLGYPYNLDFD+  L+Q Q FSINN
Sbjct  64   VLEPPSDEEAAAERRAQVAALLASFGHHLRERTAHHLGYPYNLDFDFSPLTQFQSFSINN  123

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            LGDPFIESNYGVHSRQFEV VLDWFARLW++++DEYWGYITNCGT GNLHG+L
Sbjct  124  LGDPFIESNYGVHSRQFEVAVLDWFARLWELKQDEYWGYITNCGTEGNLHGLL  176



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +1

Query  361  TGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNY  540
            T ++EA +A ++  Y K L ERT +H+GYPYNLDFDYG L  L  +SINNLGDPFIESNY
Sbjct  1    TQEREAQIAEMIGSYMKKLAERTHHHMGYPYNLDFDYGLLEGLTKYSINNLGDPFIESNY  60

Query  541  GVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            GVHSR+FEVGVL+WFARLW+I+++EYWGYIT CGT GNLHGIL
Sbjct  61   GVHSREFEVGVLNWFARLWEIDEEEYWGYITTCGTEGNLHGIL  103



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  373  EAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHS  552
            EA +  V+  YR+ L +RT +H+GYPYNLDFDYG L  LQ F INNLGDPFIESNYGVHS
Sbjct  87   EARVRQVIEDYRQKLEDRTDHHMGYPYNLDFDYGPLEGLQKFCINNLGDPFIESNYGVHS  146

Query  553  RQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            R+FE+GVL WFARLW+IE+DE+WGY+TNCGT GNLHGIL
Sbjct  147  REFEIGVLQWFARLWEIEEDEFWGYVTNCGTEGNLHGIL  185



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            +A++LA + + L ERT +HLGYPYNLDFD+  ++Q Q+FSINNLGDPFIESNYGVHSRQF
Sbjct  88   VAALLAGFARHLQERTTHHLGYPYNLDFDFSVMAQFQNFSINNLGDPFIESNYGVHSRQF  147

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EV VLDWFARLWD+++DEYWGYITNCGT GNLHG+L
Sbjct  148  EVAVLDWFARLWDLQQDEYWGYITNCGTEGNLHGLL  183



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  376  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  555
            A +   + +Y K L ERTK+H+GYPYNLDFD+G L  L  +SINNLGDPFIESNYGVHSR
Sbjct  83   AAINETIQKYEKKLAERTKHHMGYPYNLDFDFGALEGLTRYSINNLGDPFIESNYGVHSR  142

Query  556  QFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +FEVGVL+WFARLW+I+++EYWGYITNCGT GNLHGIL
Sbjct  143  EFEVGVLNWFARLWEIDEEEYWGYITNCGTEGNLHGIL  180



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  433  YHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKD  612
            +H GYPYNLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA LW++EKD
Sbjct  29   FHEGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFASLWELEKD  88

Query  613  EYWGYITNCGTXGNLHGIL  669
            EYWGYITNCGT GNLHGIL
Sbjct  89   EYWGYITNCGTEGNLHGIL  107



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +1

Query  316  TTCLEVTEP-DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQ  492
            T  L V EP + D E   + EA +  V+  Y++ L  RT +H+GYPYNLDFDYG L  LQ
Sbjct  65   TPALPVLEPGELDKE---ELEARINKVIDDYKEKLQLRTDHHMGYPYNLDFDYGPLEGLQ  121

Query  493  HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             + INNLGDPFIESNYGVHSR+FE+GVL WFARLW+IE D++WGYITNCGT GNLHGIL
Sbjct  122  KYCINNLGDPFIESNYGVHSREFEIGVLQWFARLWEIEVDDFWGYITNCGTEGNLHGIL  180



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +1

Query  316  TTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQH  495
            +T L V EP  +  +  ++EA +A ++  Y K L ERT +H+GYPYNLDFDYG L  L  
Sbjct  61   STALPVMEPHPEM-TEEEREARIAEMIGNYMKKLAERTHHHMGYPYNLDFDYGLLEGLTK  119

Query  496  FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +SINNLGDPFIESNYGVHSR+FEVGVL+WFARLW+I+++EYWGYIT CGT GNLHGIL
Sbjct  120  YSINNLGDPFIESNYGVHSREFEVGVLNWFARLWEIDEEEYWGYITTCGTEGNLHGIL  177



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  507
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  58   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  117

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +YWGY+T+CGT GNLHG+L
Sbjct  118  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLGPGDYWGYVTSCGTEGNLHGLL  171



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +1

Query  373  EAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHS  552
            E+ ++ V+  Y+  L  RT +H+GYPYNLDFDYG L  LQ F INNLGDPFIESNYGVHS
Sbjct  87   ESRLSEVIQSYKNKLEHRTHHHMGYPYNLDFDYGPLECLQRFCINNLGDPFIESNYGVHS  146

Query  553  RQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            R+FE+GVL WFA LW+IE ++ WGY+TNCGT GNLHGIL
Sbjct  147  REFEIGVLHWFASLWEIEAEDMWGYVTNCGTEGNLHGIL  185



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  +KREIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLS  483
            AD+E TGD++A+MASVLARYRK+L ERTKYHLGYPYNLDFDYG LS
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLGYPYNLDFDYGILS  123



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  445  YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWG  624
            YPYNLDFD+  L  LQ FSINNLGDPFIESNYGVHSR+FE+GVL WFARLW+I++DEYWG
Sbjct  8    YPYNLDFDFSALEGLQRFSINNLGDPFIESNYGVHSREFEIGVLQWFARLWEIDQDEYWG  67

Query  625  YITNCGTXGNLHGIL  669
            YITNCGT GNLHGIL
Sbjct  68   YITNCGTEGNLHGIL  82



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  TTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQH  495
            T   ++ EP  D ++   +   + ++L  +RK L ER+ YHLGYP+NL+ D G + Q Q+
Sbjct  23   TDTYDIDEPPKDEQAATQRRLRIDNLLVNFRKQLQERSAYHLGYPFNLELDVGPVIQFQN  82

Query  496  FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            F +NN+GDPF+ESNYG+HSR+FEV VLDWFA  W++ KD+ WGY+T+ GT GNLHG+L
Sbjct  83   FHVNNIGDPFMESNYGIHSRKFEVAVLDWFANFWELPKDQSWGYVTSGGTEGNLHGLL  140



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            +GYPYNLDFD+  ++Q Q FSINNLGDPFIESNYGVHSRQFEV VLDWFA LW++++D+Y
Sbjct  21   IGYPYNLDFDFSVMAQFQSFSINNLGDPFIESNYGVHSRQFEVAVLDWFACLWELQQDQY  80

Query  619  WGYITNCGTXGNLHGIL  669
            WGYITNCGT GNLHG+L
Sbjct  81   WGYITNCGTEGNLHGLL  97



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  504
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP N D+D+G L+   +FS+
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFGPLAPFLNFSL  105

Query  505  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NN GDPF + N  VHSRQFEV VL+WFA  WD+++D++WGYIT+ GT GNL+G+L
Sbjct  106  NNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLL  160



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 3/143 (2%)
 Frame = +1

Query  241  KLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLV  420
            ++D   AA     +K+   L R V    LE+ EP  D     +K+A +A ++A Y + L 
Sbjct  15   QVDVVAAACDMLGEKQ---LVRQVILEGLEIEEPPVDETEVAEKKAGIARLMAGYVQHLQ  71

Query  421  ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD  600
             R+ +HLGYP NLD+D+  L+   +FS+NN GDPF + N  VHSRQFEV VL WFA  W+
Sbjct  72   HRSAFHLGYPLNLDYDFSPLAPFLNFSLNNAGDPFCKVNSSVHSRQFEVAVLHWFADFWE  131

Query  601  IEKDEYWGYITNCGTXGNLHGIL  669
            +++DEYWGYIT+ GT GNL+G+L
Sbjct  132  VQRDEYWGYITSGGTEGNLYGLL  154



>gb|EAZ18332.1| hypothetical protein OsJ_33863 [Oryza sativa Japonica Group]
Length=446

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  510
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P +   D G L+Q QHF INN
Sbjct  31   IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHPLSQKLDVGPLAQFQHFHINN  90

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +GDPF+ESNYG+HSRQFE  VLDWFA LW+I KD+YWGY+TN G+ GN  G+L
Sbjct  91   IGDPFVESNYGIHSRQFEYAVLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLL  143



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  504
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP N D+D+  L+   +FS+
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFSPLAPFLNFSL  105

Query  505  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NN GDPF + N  VHSRQFEV VL+WFA  WD+++D++WGYIT+ GT GNL+G+L
Sbjct  106  NNAGDPFAKVNNSVHSRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLL  160



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  385  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  564
            + +L  Y + L  ++  H GYPYNL FDY +L+Q   +SINNLGDPF+ SNYGVHSRQFE
Sbjct  1    SDILHAYDQLLQSKSSVHFGYPYNLMFDYTELAQFMKYSINNLGDPFVPSNYGVHSRQFE  60

Query  565  VGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            V V+D+FA+LW +E D YWGY+T  GT GNLHGIL
Sbjct  61   VAVIDFFAKLWKMETDSYWGYVTTSGTEGNLHGIL  95



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 86/117 (74%), Gaps = 4/117 (3%)
 Frame = +1

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            CL V EP+ +NE++  K   +  +LA+Y +TL ++ KYH+GYP N+ +++   L+ L  F
Sbjct  29   CLSVVEPNIENETSSQK---LDIILAQYLETLSKQKKYHIGYPINMCYEHQAILAPLLQF  85

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            S+NN GDPF +S    HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GT GNLHG+L
Sbjct  86   SLNNCGDPFTQSPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLL  142



>gb|AGT16577.1| histidine decarboxylase-like protein [Saccharum hybrid cultivar 
R570]
Length=375

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  507
            V EP AD ++  +++A +A +LA +R+ L +R+ +HLGYPYNLD D+  L+  LQ   IN
Sbjct  56   VEEPPADEDALAERQAEVALLLAGFRRHLEDRSAHHLGYPYNLDLDFAPLAPFLQGLCIN  115

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NLGDPF+ESNYGVHSR  EV VLD FARLWD+   +   Y T+CGT GNLHG+L
Sbjct  116  NLGDPFVESNYGVHSRPMEVAVLDCFARLWDLGPGD---YATSCGTEGNLHGLL  166



>gb|EJK75470.1| hypothetical protein THAOC_02802 [Thalassiosira oceanica]
Length=474

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  385  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  564
            + +L+ Y K L  ++  H GYPYNL +++ +L +   +SINNLGDPFI SNYGVHSRQFE
Sbjct  185  SEILSSYDKLLRRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFE  244

Query  565  VGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
              V+D+FARLW +E+D YWGY+T CGT GNLHGIL
Sbjct  245  CSVIDFFARLWKMEEDSYWGYVTTCGTEGNLHGIL  279



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  510
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P +   D G L+Q QHF INN
Sbjct  608  IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHPLSQKLDVGPLAQFQHFHINN  667

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +GDPF+ESNYG+HSRQFE  VLDWFA LW+I KD+YWGY+TN G+ GN  G+L
Sbjct  668  IGDPFVESNYGIHSRQFEYAVLDWFAHLWEIPKDQYWGYVTNGGSEGNYDGLL  720



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +1

Query  385  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  564
            + +LA Y K L  ++  H GYPYNL +++ +L +   +SINNLGDPFI SNYGVHSRQFE
Sbjct  1    SDILASYDKLLKRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFE  60

Query  565  VGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
              V+D+FA+LW  E D YWGY+T CGT GNLHGIL
Sbjct  61   CSVIDFFAKLWKAEPDSYWGYVTTCGTEGNLHGIL  95



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD      ++A +      YR  L ERT YH GYPYNL FD   L    ++S NNLGD F
Sbjct  271  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDNEHLHSFMNYSCNNLGDCF  330

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            + SNY VH+R+FE+GVLD+FA LW I +++YWGY+T+CGT GNLHG+L
Sbjct  331  VASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLL  378



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +1

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            AD      ++A +      YR  L ERT YH GYPYNL FD   L    ++S NNLGD F
Sbjct  280  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYPYNLAFDNEHLHSFMNYSCNNLGDCF  339

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            + SNY VH+R+FE+GVLD+FA LW I +++YWGY+T+CGT GNLHG+L
Sbjct  340  VASNYEVHTRKFEIGVLDFFADLWKIPREDYWGYVTSCGTEGNLHGLL  387



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINN  510
            + EP +       ++  MA++LA +++ L ER+ + +GYP N +FD+G + +  +  +NN
Sbjct  19   IDEPPSAASELEKRQDDMANLLATFKEHLQERSAHSIGYPINFEFDFGPVIEFLNMRLNN  78

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             GDPF+E NYG+HS++FE+ VLDWFARLW++ KD+YWGY+T+ GT GN+HG+L
Sbjct  79   AGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLL  131



>gb|EMT14424.1| Histidine decarboxylase [Aegilops tauschii]
Length=440

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  445  YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWG  624
            YP+NLDFD+  L Q Q FSINNLG PFIESNYGVHSR+FEV VLDWFARLW+I++DEYWG
Sbjct  133  YPFNLDFDFSVLDQFQSFSINNLGGPFIESNYGVHSRRFEVAVLDWFARLWNIQQDEYWG  192

Query  625  YITNCGTXGNLHGIL  669
            YIT  GT GNLHG+L
Sbjct  193  YITTGGTEGNLHGLL  207



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = +1

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            CL V EPD  +E++  +   +  +L +Y +TL ER KYH+GYP N+ +++   L+ L  F
Sbjct  6    CLSVVEPDIKDETSFQE---LDMILTQYLETLSERKKYHIGYPTNMHYEHHAILAPLLQF  62

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            S+NN GDPF +S    HS+ FEV VLDWFA+LW+I+KDEYWGYIT+ GT GNLHG+L
Sbjct  63   SLNNCGDPFTQSPADFHSKDFEVAVLDWFAQLWEIDKDEYWGYITSGGTEGNLHGLL  119



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP  DN+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALDNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW IEKD+YWGY+TN GT GNLHGIL
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWGIEKDQYWGYVTNGGTEGNLHGIL  167



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP  +N         + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPSLNNNGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGIL  167



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 92/162 (57%), Gaps = 18/162 (11%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPDADNESTG  366
              P ++    + P V + K    P  +G + + +            LEV EP   N+   
Sbjct  23   MTPRSLARRRLFPNVDNKKQKVAPPGDGPRKNLQ------------LEVMEPGLKNDGPS  70

Query  367  DKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLGDPFIESNYG  543
                 + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F +NN GDPF+++   
Sbjct  71   -----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFHLNNCGDPFLQNTVD  125

Query  544  VHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  126  FHSKDFEVAVLDWFAKLWEIEKDQYWGYVTNGGTEGNLHGIL  167



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGD-LSQLQHFSIN  507
            V EPD  N     +E  +  +L +Y +TL  RT+YH+GYP N+ +++ D L+ L  F +N
Sbjct  32   VVEPDEKNIKMSSQE--LDKILTQYIETLSHRTEYHIGYPVNICYEHHDALAPLLQFHLN  89

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            N GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  90   NCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  143



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 3/116 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  501
            L V EPD+ +  T  +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  28   LSVVEPDSKDNKTFSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  85

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  86   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  141



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 3/116 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  501
            L V EPD  +  T  +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDGKDIKTSSQE--LDRILIQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  143



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = +1

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            A    TG+ +  +A V+  Y  TL +   + LGYP N  FDY  L+ L HF INN+GDPF
Sbjct  46   AITNCTGESQGKLAEVINHYAGTLNQEISHLLGYPTNQSFDYSALAPLLHFHINNVGDPF  105

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            + S+YGV+S  FEV VLDWFA+LW+I+K+EYWGYIT+ GT GN HGIL
Sbjct  106  MGSSYGVNSANFEVSVLDWFAKLWEIKKEEYWGYITSGGTEGNFHGIL  153



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP  +N+        + ++L  Y  TL  R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALNNDGPS-----LDTILVNYLDTLTRRVNYHLGYPVNICYDHYASLAPLLQFH  111

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  167



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP  +N+        + ++L  Y  TL  R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  50   LEVMEPALNNDGPS-----LDTILVNYLDTLTRRVNYHLGYPVNICYDHYASLAPLLQFH  104

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  105  LNNCGDPFLQNTVDFHSKDFEVTVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  160



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+     +  + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKND-----DPSLDTILVNYLDTLKQRVNYHLGYPVNICYDHYATLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +1

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            CL V E D  NE++  K   +  +L +Y +TL +R KYH+GYP N+ +++   L+ L  F
Sbjct  29   CLSVVESDIKNETSFQK---LDMILTQYLETLSKRKKYHIGYPTNMHYEHHATLAPLLQF  85

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GT GNLHG+L
Sbjct  86   HLNNFGDPFAQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLL  142



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 84/133 (63%), Gaps = 6/133 (5%)
 Frame = +1

Query  271  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  450
            G+ DK   +   N    CL +T  +      G+  A +  ++  Y  TL ++  + LGYP
Sbjct  13   GEEDKERDIQENNNGHMCLAITNCN------GETHAKLDEIITHYEGTLNQKISHFLGYP  66

Query  451  YNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYI  630
             N +FDY  L+ L HF INN GDPF+ S+YGV+S  FE+ VLDWFA+LW+I+K EYWGY+
Sbjct  67   TNQNFDYDALAPLLHFHINNAGDPFMGSSYGVNSTDFEISVLDWFAKLWEIKKGEYWGYV  126

Query  631  TNCGTXGNLHGIL  669
            T  GT GNLHGIL
Sbjct  127  TTGGTEGNLHGIL  139



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  57   LEVMEPALKNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYATLAPLLQFH  111

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  112  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAKLWEIEKDQYWGYVTNGGTEGNLHGIL  167



>ref|XP_002454879.1| hypothetical protein SORBIDRAFT_03g000687 [Sorghum bicolor]
 gb|EER99998.1| hypothetical protein SORBIDRAFT_03g000687 [Sorghum bicolor]
Length=156

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  507
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  60   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  119

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +Y
Sbjct  120  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLVPGDY  156



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYASLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>gb|KEH26770.1| histidine decarboxylase-like protein [Medicago truncatula]
Length=122

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  166  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLGRNVHTTCLEVTEPD  345
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  +KREIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLG  444
            AD+E TGD++A+MASVLARYRK+L ERTKYHLG
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLG  110



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 3/116 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  501
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  143



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 3/116 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  501
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP N+ +++   L+ L  F 
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYPVNICYEHHAALAPLLQFH  87

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF ++    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  88   LNNCGDPFTQNTVDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  143



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = +1

Query  262  ANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  441
            A   K D   ++L +N+   C+ V EP+  NE +  K   +  +L ++ + L +R KYH+
Sbjct  11   AVSTKGDDTPLILRKNL---CVNVVEPNIKNEISSQK---LDIILTQFMEILSKRKKYHI  64

Query  442  GYPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            GYP N+ +++   L+ L  F +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEY
Sbjct  65   GYPINVCYEHHATLAPLLQFHLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEY  124

Query  619  WGYITNCGTXGNLHGIL  669
            WGYIT+ GT GNLHG+L
Sbjct  125  WGYITSGGTEGNLHGLL  141



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  53   LEVMEPGLKNDGPS-----LDTILVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  107

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  108  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  163



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  346  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPF  525
            A  + +G+ +A +ASV+ +Y +TL +     LGYP N DFDY  L+ L HF +NN+GDPF
Sbjct  5    AITKCSGETQANLASVITQYVETLNQHNLRFLGYPTNQDFDYDALAPLLHFHLNNVGDPF  64

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             ES++ ++S +FEV VLDWFA LW+I+K EYWGY+T  GT GNLHGIL
Sbjct  65   TESSFSLNSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLHGIL  112



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  69   LEVLEPGLKNDGPS-----LDTILVNYLDTLTQRVNFHLGYPVNICYDHYATLAPLLQFH  123

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  124  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  179



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP N+ +D Y  L+ L  F 
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYPVNICYDHYATLAPLLQFH  110

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VLDWFA+LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  LNNCGDPFLQNTVDFHSKDFEVAVLDWFAQLWEIEKDQYWGYVTNGGTEGNLHGIL  166



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +1

Query  322  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            CL + EP   N+++ ++   +  +L +Y  TL +R KYH+GYP NL +++   L+ L  F
Sbjct  30   CLSLIEPHIKNKTSSEE---LNMILTQYVDTLSQRMKYHIGYPINLSYEHHATLAPLLQF  86

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             +NN GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GT GNLHG+L
Sbjct  87   HLNNCGDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGLL  143



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  570
            +L +Y+K + ERT +H GYPYNL +++ +LS    +S+NNLGDPF+ESNYGVHSR FE  
Sbjct  36   ILDQYKKHIEERTYHHFGYPYNLSYNHEELSPFLRYSVNNLGDPFVESNYGVHSRAFEQS  95

Query  571  VLDWFARLWDI------------EKDEYWGYITNCGTXGNLHGIL  669
            VL++FA+LW I              DEYWGY+TNCGT GNL+GIL
Sbjct  96   VLEFFAKLWKIGPCEDKDNTKNWSHDEYWGYVTNCGTEGNLYGIL  140



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSIN  507
            V EP+ + E   ++   ++  +  +++ L ER  Y+LGYP N + + Y  LS L  F+IN
Sbjct  40   VEEPN-NEECAVERVDRLSKTVTEFQEHLRERVSYYLGYPANHNCEHYLALSTLLQFNIN  98

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            N+GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GT GNLHGIL
Sbjct  99   NVGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGIL  152



>ref|XP_002444261.1| hypothetical protein SORBIDRAFT_07g019126 [Sorghum bicolor]
 gb|EES13756.1| hypothetical protein SORBIDRAFT_07g019126 [Sorghum bicolor]
Length=156

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ-LQHFSIN  507
            V EP A+ E+  +++A +A +LA +R+ L +R+ +HLGYPYNLDFD+  L+  LQ   IN
Sbjct  60   VQEPPANEEALAERQAEVARLLAGFRRHLEDRSAHHLGYPYNLDFDFASLAPFLQGLCIN  119

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEY  618
            NLGDPF+ESNYGVHSR  EV VLDWFARLWD+   +Y
Sbjct  120  NLGDPFVESNYGVHSRPLEVAVLDWFARLWDLVPGDY  156



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  334  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINN  510
             EP  +     ++  ++  ++ +++  L ER   HLGYP N +   Y  LS L  F+INN
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQFNINN  109

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GT GNLHGIL
Sbjct  110  AGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGIL  162



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  334  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINN  510
             EP  +     ++  ++  ++ +++  L ER   HLGYP N +   Y  LS L  F+INN
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYPGNHNCSHYLALSTLLQFNINN  109

Query  511  LGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             GDPF ES++G+HS++FEVGVLDWFA+LW I+KDEYWGY+TN GT GNLHGIL
Sbjct  110  AGDPFKESDHGLHSKKFEVGVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGIL  162



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  504
            +++ E  A  + +G+ +A +ASV+  Y +TL + +  +LGYP N +F+Y  L+ L HF +
Sbjct  43   IDIKENLAITKCSGETQANLASVITHYVETLNQYSLRNLGYPTNQNFNYDTLASLLHFHL  102

Query  505  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            NN GDPF+ S++ ++S +FEV VLDWFA LW+IEK++YWGY+T  GT GNLHGIL
Sbjct  103  NNAGDPFLGSSFSLNSTRFEVCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGIL  157



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFS  501
            L V EPD  +      +  +  ++ +Y +TL  R KYHLGYP N+ +++   L+ L  F 
Sbjct  32   LSVVEPDEKDIKISSHK--LDRIVTQYLETLSHRKKYHLGYPINVCYEHHAALAPLLQFY  89

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF E+    HS+ FEV VLDWFA+LW+IEKDEYWGYITN GT GNLHG+L
Sbjct  90   LNNCGDPFTENTIDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITNGGTEGNLHGLL  145



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMAS-VLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            L + EP  D E   +++  M + ++  +++ L ER+ + LGYP NL+ ++  DLS L  F
Sbjct  1    LALVEPH-DEECVAERQRCMVTNIMFEFQEYLNERSNHLLGYPTNLNCNHLMDLSPLLCF  59

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             +NN+GDPF ESN+G+HS++FEV VLDWFA+LW+IEK EYWGY+TN GT GNLHG+L
Sbjct  60   LMNNVGDPFKESNFGLHSKKFEVAVLDWFAQLWEIEKGEYWGYVTNGGTEGNLHGML  116



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +1

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            N+  G+ +A + +++  Y  TL   +  +LGYP N DF+Y  L+ L HF +NN GDPF+ 
Sbjct  39   NQCIGETDANLKAIITHYVDTLTYSSLRNLGYPTNQDFNYDALASLFHFHLNNAGDPFVG  98

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            S++ ++S +FEVGVLDWFA LW+IEK +YWGY+T  GT GNLHGIL
Sbjct  99   SSFSLNSTKFEVGVLDWFAELWEIEKSDYWGYVTTGGTEGNLHGIL  144



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            LEV EP   N+        + + L  Y  TL +R  YHLGYP N+ +D Y  L+ L  F 
Sbjct  46   LEVMEPGLKNDGPS-----LDTTLVNYLDTLTQRVNYHLGYPVNICYDHYASLAPLLQFH  100

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA+LW+IEKD+ WGY+TN GT GNLHGIL
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFAQLWEIEKDQCWGYVTNGGTEGNLHGIL  156



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = +1

Query  301  GRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDL  480
            G   H+ C         N +  D+ + +ASV+ +Y +TL +     LGYP N DFDY  L
Sbjct  10   GNGFHSCC---------NGAVADR-SNLASVITQYVETLNQHNLRFLGYPTNQDFDYDAL  59

Query  481  SQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLH  660
            + L HF +NN+GDPF ES++ ++S +FEV VLDWFA LW+I+K EYWGY+T  GT GNLH
Sbjct  60   APLLHFHLNNVGDPFTESSFSLNSSKFEVCVLDWFANLWEIDKGEYWGYVTTGGTEGNLH  119

Query  661  GIL  669
            GIL
Sbjct  120  GIL  122



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 96/171 (56%), Gaps = 23/171 (13%)
 Frame = +1

Query  178  DGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLG------RNVHTTCLEVTE  339
            +  F P+A+    + PP            NG   + + + +       +N++ T   VTE
Sbjct  7    EKEFEPSAVTPRGLAPP--------GLIGNGDFGEMKRLKVATPTAPRKNLNIT---VTE  55

Query  340  PDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLG  516
            P + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F +NN G
Sbjct  56   PGSRNDGQS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCG  110

Query  517  DPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            DPF+++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  111  DPFLQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGIL  161



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  331  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSIN  507
            V EP  D E   ++  ++  ++  ++  L ER    LG+P N +   Y  LS L  ++IN
Sbjct  46   VVEP-KDEECAVERLHHLTKIVTEFQDHLRERASNQLGHPGNHNCSHYLALSTLLQYNIN  104

Query  508  NLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            N+GDPF ESNYG+H+++FEV VLDWFA+LW I+KDEYWGY+TN GT GNLHGIL
Sbjct  105  NVGDPFKESNYGLHTKKFEVSVLDWFAQLWGIDKDEYWGYVTNGGTEGNLHGIL  158



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +1

Query  355  ESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIES  534
            +S G+ +A + +++A Y +T+ +    +LGYP N DF+Y  L+ L  F +NN GDPF+ S
Sbjct  42   KSIGETDANLDAIIAHYAQTITKYNMRNLGYPTNQDFNYEALAPLLQFHLNNAGDPFLGS  101

Query  535  NYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            ++ ++S  FEV VLDWFA+LW+IEK+EYWGY+T  GT GNLHGIL
Sbjct  102  SFSLNSMAFEVSVLDWFAKLWEIEKNEYWGYVTTGGTEGNLHGIL  146



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +1

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            NE  G+K+A + +++ARY +T+ +    +LGYP N DF+Y  L+ L HF +NN GDPF+ 
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYPTNQDFNYDKLAPLFHFHLNNAGDPFVG  103

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            S++ ++S  FEV VLDWFA LW+I+  EYWGY+T  G+ GNLHGIL
Sbjct  104  SSFSLNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGIL  149



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 75/116 (65%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L VTEP       G     + S+L  Y  TL +R  +H+GYP N+ +  Y  L+ L  F 
Sbjct  42   LAVTEP-----GFGSDGPSLDSILVNYLDTLTQRVNFHIGYPVNICYHHYATLAPLLQFH  96

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPFI++    HS+ FE+ VLDWFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  97   LNNCGDPFIDNTVDFHSKDFEMAVLDWFANLWEIEKDQYWGYVTNGGTEGNLHGIL  152



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L VTEP  ++  T D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPTLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GT GNLHGIL
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGIL  161



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFH  100

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGIL  156



>ref|XP_006591667.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=220

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  490  QHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +HFSINN GDPFIESNYGVHSRQFEVGVLDWFA LW++EKDEYWGYITN GT GNLHGIL
Sbjct  72   KHFSINNPGDPFIESNYGVHSRQFEVGVLDWFAWLWELEKDEYWGYITNYGTEGNLHGIL  131



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 94/168 (56%), Gaps = 23/168 (14%)
 Frame = +1

Query  187  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADKREIVLG------RNVHTTCLEVTEPDA  348
            F P+A+    + PP           ANG   + + + +       +N++     VTEP +
Sbjct  10   FEPSAVTPRGLAPP--------GLIANGDFGEMKRLKVATPTAPRKNLNVA---VTEPGS  58

Query  349  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFSINNLGDPF  525
             N         +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F +NN GDPF
Sbjct  59   RNNGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFHLNNCGDPF  113

Query  526  IESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  114  LQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGIL  161



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  567
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLTQRVKYHLGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  568  GVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
             VLDWFA+LW+IEKDEYWGY+T+ GT GNLHGI
Sbjct  120  AVLDWFAKLWEIEKDEYWGYVTHGGTEGNLHGI  152



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNIFYEHYASLAPLLQFH  100

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  101  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGIL  156



>gb|EYU24758.1| hypothetical protein MIMGU_mgv1a026373mg, partial [Erythranthe 
guttata]
Length=282

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMAS-VLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHF  498
            L + EP  D E   D+   + + +++ +++ L ER+ + LGYP NL+ ++  DLS L  F
Sbjct  17   LALIEPH-DEECVVDRHRCLVTKIMSEFQEYLNERSNHLLGYPSNLNCNHLMDLSPLLGF  75

Query  499  SINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             +NN+GDPF ESN+G+HS++ EV  LDWFA+LW IEKDEYWGY+TN GT  NLHG+L
Sbjct  76   LMNNVGDPFQESNFGLHSKKIEVAGLDWFAQLWKIEKDEYWGYVTNGGTECNLHGML  132



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GT GNLHGIL
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGIL  161



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 6/116 (5%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            + VTEP + N+        +  +L  Y  TL +R  YH+GYP N+ ++ Y  L+ L  F 
Sbjct  46   VAVTEPGSRNDGPS-----LDCILMNYIDTLSQRINYHIGYPVNICYEHYASLAPLLQFH  100

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS  FEV VL+WFA LW+IEKD+YWGY+TN GT GNLHGIL
Sbjct  101  LNNCGDPFLQNTVDFHSEDFEVAVLNWFADLWEIEKDQYWGYVTNGGTEGNLHGIL  156



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GT GNLHGIL
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGIL  161



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L VTEP  ++  + D        L  Y  TL +R  YH+GYP N+ ++ Y +L+ L  F 
Sbjct  52   LSVTEPGKNDGPSLD------CTLMNYIDTLTQRINYHIGYPVNICYEHYANLAPLLQFH  105

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+++    HS+ FEV VL+WFA LW+IE+D+YWGY+TN GT GNLHGIL
Sbjct  106  LNNCGDPFLQNTVDFHSKDFEVAVLNWFADLWEIERDQYWGYVTNGGTEGNLHGIL  161



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  567
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLTQRVKYHLGFPENICYDHHVALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  568  GVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
             VLDWFA+LW+IEKDEYWGY+T+ GT GNLHGI
Sbjct  120  AVLDWFAKLWEIEKDEYWGYVTHGGTEGNLHGI  152



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +1

Query  307  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  486
            N+H   +      A  +  G+ +A + +V+  Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  27   NIHEEDINRLTNIAITQCIGETDANLDAVITHYVETINKYNLRNLGYPTNQDFNYEALAP  86

Query  487  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L  F +NN GDPF+ S++ ++S  FEV VLDWFA+LW+IEKD+YWGYIT  GT GNLHGI
Sbjct  87   LLQFHLNNAGDPFLGSSFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYITTGGTEGNLHGI  146

Query  667  L  669
            L
Sbjct  147  L  147



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = +1

Query  439  LGYPYNLDFD-YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDE  615
            LGYP+N+  D Y  L+ L  + +NN GDPF E+NYG+HSR FEVGVLDWF++LW+IEKD+
Sbjct  39   LGYPHNIYCDEYVALAPLLRYHLNNFGDPFTENNYGMHSRHFEVGVLDWFSKLWEIEKDQ  98

Query  616  YWGYITNCGTXGNLHGIL  669
            YWGY+T+CGT GNLHGIL
Sbjct  99   YWGYVTHCGTEGNLHGIL  116



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  424  RTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI  603
            RT+ + GYP N +FD+G + +  +  +NN GDPF+E NYG+HS++FE+ VLDWFARLW++
Sbjct  63   RTRRNAGYPINFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEIAVLDWFARLWEL  122

Query  604  EKDEYWGYITNCGTXGNLHGIL  669
             KD+YWGY+T+ GT GN+HG+L
Sbjct  123  PKDQYWGYVTSGGTEGNMHGLL  144



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  325  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFD-YGDLSQLQHFS  501
            L++ EP  D E   D++  +  +L+ +++ L ER+ + LGY  N D     DLS    F 
Sbjct  15   LDLVEP-FDEECHVDRQRRLTKILSEFQEHLAERSNHFLGYHLNQDCSCLTDLSPFLRFH  73

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            INN+GDPF ESN G+HS++FEV VLDWFA LW+IE DEYWGY+TN GT  NL  +L
Sbjct  74   INNVGDPFKESNLGLHSKKFEVAVLDWFAELWEIENDEYWGYVTNGGTEANLQALL  129



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +1

Query  337  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDY-GDLSQLQHFSINNL  513
            E D  NE++  +   +  +L +Y +TL ER KYH+GYP N+ +++   L+ L  F +NN 
Sbjct  2    ESDIKNETSFQE---LDMILTQYLETLSERKKYHIGYPINMCYEHHATLAPLLQFHLNNC  58

Query  514  GDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHG  663
            GDPF +     HS+ FEV VLDWFA+LW+IEKDEYWGYIT+ GT GNLHG
Sbjct  59   GDPFTQHPTDFHSKDFEVAVLDWFAQLWEIEKDEYWGYITSGGTEGNLHG  108



>ref|XP_003607343.1| Aromatic amino acid decarboxylase 1B [Medicago truncatula]
Length=297

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +1

Query  307  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  486
            N+H   +      A  +  G+ +A + +V+A Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  45   NIHEEDINRLTNIAITQCIGETDANLDAVIAHYVETINKYNLCNLGYPGNQDFNYEALAP  104

Query  487  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L  F +NN GDPF+ S + ++S  FEV VLDWFA+LW+IEKD+YWGY+T  GT GNLH I
Sbjct  105  LLQFLLNNAGDPFLGSGFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYVTTGGTEGNLHAI  164

Query  667  L  669
            L
Sbjct  165  L  165



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +1

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            NE  G+K+A + +++ARY +T+ +    +LGYP N DF+Y  L+ L HF +NN GDPF+ 
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYPTNQDFNYDKLAPLFHFHLNNAGDPFVG  103

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            S++ ++S  FEV VLDWFA LW+I+  EYWGY+T  G+ GNLHGIL
Sbjct  104  SSFSLNSSPFEVSVLDWFANLWNIDNSEYWGYVTTGGSEGNLHGIL  149



>gb|AES89540.2| serine decarboxylase [Medicago truncatula]
Length=301

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +1

Query  307  NVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQ  486
            N+H   +      A  +  G+ +A + +V+A Y +T+ +    +LGYP N DF+Y  L+ 
Sbjct  45   NIHEEDINRLTNIAITQCIGETDANLDAVIAHYVETINKYNLCNLGYPGNQDFNYEALAP  104

Query  487  LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L  F +NN GDPF+ S + ++S  FEV VLDWFA+LW+IEKD+YWGY+T  GT GNLH I
Sbjct  105  LLQFLLNNAGDPFLGSGFSLNSMTFEVSVLDWFAKLWEIEKDQYWGYVTTGGTEGNLHAI  164

Query  667  L  669
            L
Sbjct  165  L  165



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYG-DLSQLQHFSINNLGDPFIESNYGVHSRQFEV  567
            +L  Y KTL +R KYHLG+P N+ +D+   L+ L  F +NN GDPF E+    HS+ FEV
Sbjct  60   ILDNYLKTLAQRVKYHLGFPENIFYDHHLALAPLLQFHLNNCGDPFTENPVDFHSKDFEV  119

Query  568  GVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
             VLDWFA+LW+I+KDEYWGY+T+ GT GNLHGI
Sbjct  120  AVLDWFAKLWEIDKDEYWGYVTHGGTEGNLHGI  152



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 84/157 (54%), Gaps = 30/157 (19%)
 Frame = +1

Query  271  GKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLG--  444
            G+ DK   +   N    CL +T  +      G+  A +  ++  Y  TL ++  + LG  
Sbjct  13   GEEDKERDIQENNNGHMCLAITNCN------GETHAKLDEIITHYEGTLNQKISHFLGKK  66

Query  445  ----------------------YPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQ  558
                                  YP N +FDY  L+ L HF INN GDPF+ S+YGV+S  
Sbjct  67   GWTFILMYVIARSTLMVFVKAGYPTNQNFDYDALAPLLHFHINNAGDPFMGSSYGVNSTD  126

Query  559  FEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            FE+ VLDWFA+LW+I+K EYWGY+T  GT GNLHGIL
Sbjct  127  FEISVLDWFAKLWEIKKGEYWGYVTTGGTEGNLHGIL  163



>gb|KHN17002.1| Histidine decarboxylase [Glycine soja]
Length=500

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            M S+L   +    +R    LGYP N +F+Y  L+ L HF +NN GDPF+ S++ ++S +F
Sbjct  1    MKSLLLTMQDCTNDRLSCTLGYPTNQNFNYDTLASLLHFHLNNAGDPFLGSSFSLNSTRF  60

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            EV VLDWFA LW+IEK++YWGY+T  GT GNLHGIL
Sbjct  61   EVCVLDWFANLWEIEKNKYWGYVTTGGTEGNLHGIL  96


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +1

Query  520  PFIE--SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            PF+E  S++ ++S  FEV VL+WF  LW+I+K+EYWGY+T  GT GNLHGIL
Sbjct  204  PFVEQGSSFSLNSTTFEVCVLNWFTNLWEIKKNEYWGYVTTGGTEGNLHGIL  255



>gb|EMT14426.1| hypothetical protein F775_23387 [Aegilops tauschii]
Length=66

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            MA++LA +   L ERT +HLGYP+NLDFD+G L+Q Q F INN+GDPFIESNYGVHSRQF
Sbjct  1    MAALLAGFAHHLEERTDHHLGYPFNLDFDFGALNQFQSFFINNVGDPFIESNYGVHSRQF  60

Query  562  EVGVLD  579
            EV VLD
Sbjct  61   EVAVLD  66



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  445  YPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYW  621
            YP NL+  +  DLS L  F +NN+GDPF ESN+G+HS++FEV VLDWFA LW+IE DEYW
Sbjct  1    YPGNLNCKHLVDLSPLLSFLLNNVGDPFKESNFGLHSKKFEVAVLDWFAELWEIENDEYW  60

Query  622  GYITNCGTXGNLHGIL  669
            GY+TN GT GNLHG+L
Sbjct  61   GYVTNGGTEGNLHGML  76



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +1

Query  421  ERTKYHLGYPYNLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLW  597
            E   ++LGYP N+ +++   L+ L  F +NN GDPF E+    HS+ FEV VLDWFA+LW
Sbjct  22   ETLNHNLGYPINVCYEHHAALAPLLQFYLNNCGDPFTENTIDFHSKDFEVAVLDWFAQLW  81

Query  598  DIEKDEYWGYITNCGTXGNLHGIL  669
            +IEKDEYWGYITN GT GNLHG+L
Sbjct  82   EIEKDEYWGYITNGGTEGNLHGLL  105



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            +  + K L +R ++  GYPYNL +DY  L  L +F++NNLGDP++ESNY + SR++E  V
Sbjct  1    MLSFLKELEKRREFATGYPYNLSYDYTPLLNLFNFTLNNLGDPYVESNYAIDSRKYEQEV  60

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            LD+FA L+ +  D+ WGYIT+CGT GNL+GI
Sbjct  61   LDFFANLYKLPDDDSWGYITSCGTEGNLYGI  91



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            LA + + + +R+++H GYPYNL  D+  +++   F +NN GDP+IE N+G+HSR+FE  V
Sbjct  9    LAIFWQQIEQRSQFHAGYPYNLSCDFTCINKFFSFLLNNAGDPYIEPNFGLHSRKFEQEV  68

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            L +FA+L+ I ++E+WGY+T  GT GNL+GIL
Sbjct  69   LSFFAQLYKIPENEFWGYVTAGGTEGNLYGIL  100



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  570
            +L R ++ L + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++FE  
Sbjct  13   ILKRLQQHLAKSTKLSIGYPANLDFDYALLLPFFQYYLNNVGDPFVEGNFALHSKEFERQ  72

Query  571  VLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
             + WFA+L+++E  EYWGY+T+ GT GNL+GI
Sbjct  73   CISWFAQLYELE--EYWGYLTSGGTEGNLYGI  102



>ref|WP_044451446.1| histidine decarboxylase, partial [Mastigocladus laminosus]
 gb|KIY10883.1| histidine decarboxylase, partial [Mastigocladus laminosus UU774]
Length=227

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  570
            +L R ++ L + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++ E  
Sbjct  13   ILKRLQQHLAKSTKLSIGYPANLDFDYALLLPFFQYYLNNVGDPFVEGNFALHSKELERQ  72

Query  571  VLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
             + WFA+L+++E  EYWGY+T+ GT GNL+GI 
Sbjct  73   CISWFAQLYELE--EYWGYLTSGGTEGNLYGIF  103



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  502  INNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            +NN GDPF+E NYG+HS++FE+ VLDWFARLW++ KD+YWGY+T+ GT GN+HG+L
Sbjct  3    LNNAGDPFMECNYGIHSKKFEIAVLDWFARLWELPKDQYWGYVTSGGTEGNMHGLL  58



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L + ++ + + TK  +GYP NLDFDY  L     + +NN+GDPF+E N+ +HS++FE   
Sbjct  14   LKKLQEHIAKCTKQSIGYPANLDFDYTVLLPFFQYYLNNVGDPFVEGNFALHSKEFERQC  73

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            ++WFA+L+++E  EYWGY+T+ GT GNL+GI 
Sbjct  74   INWFAQLYELE--EYWGYLTSGGTEGNLYGIF  103



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L R ++ + E  K+ +GYP NLDFDY  L     +++NN GDPF+E N+ +HS++FE   
Sbjct  14   LKRLQQHIAECAKHSIGYPANLDFDYTLLLPFFQYNLNNAGDPFVEGNFALHSKEFERQS  73

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L+WFA+L+++E  EYWGY+T+ GT GN++G+
Sbjct  74   LNWFAQLYELE--EYWGYLTSGGTEGNIYGM  102



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            +A  LA +   + +R+++H GYPYNL  DY  + +  +  +NN GDP+IE ++G+HSR+F
Sbjct  5    VAKELADFLLQIEQRSQFHAGYPYNLSCDYSAIGKFFNHLLNNAGDPYIEPDFGLHSRKF  64

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGIL  669
            E  VL +FA L+ I ++++WGY+T  GT GNL+GI 
Sbjct  65   EQEVLSFFAHLYKIPENQFWGYVTAGGTEGNLYGIF  100



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L   ++ + E  K  +GYP NLDFDY  L     +++NN+GDPF+E N+ +HS++FE   
Sbjct  14   LKLLQQHIAECAKLSIGYPVNLDFDYTLLLPFLQYNLNNVGDPFVEGNFALHSKEFERQS  73

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L+WFA+L+++E  EYWGY+T+ GT GNL+G+
Sbjct  74   LNWFAQLYELE--EYWGYLTSGGTEGNLYGM  102



>gb|AFW71721.1| hypothetical protein ZEAMMB73_965103, partial [Zea mays]
Length=137

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 9/76 (12%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            AANG    +REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+H
Sbjct  63   AANG----RREIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHH  118

Query  439  LGY-----PYNLDFDY  471
            LG         +DFD+
Sbjct  119  LGMLRLGRSSPIDFDF  134



>gb|AFW62561.1| hypothetical protein ZEAMMB73_005785 [Zea mays]
Length=128

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 4/62 (6%)
 Frame = +1

Query  259  AANGGKADKREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  438
            AANG    KREIV+GRNVHT+C  V EPDAD+E TG++EA MAS+LA YR++LVERTK+H
Sbjct  58   AANG----KREIVMGRNVHTSCFAVKEPDADDEETGEREATMASILALYRRSLVERTKHH  113

Query  439  LG  444
            LG
Sbjct  114  LG  115



>ref|WP_041885112.1| histidine decarboxylase [Pedobacter sp. NL19]
 gb|KIO75424.1| histidine decarboxylase [Pedobacter sp. NL19]
Length=380

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L+ Y K   ER+KY +GYP   DFDY +L  L    +NN+GDP++ES Y ++SR  E+ V
Sbjct  13   LSTYMKMAEERSKYFIGYPIAQDFDYSELYPLLRLPLNNVGDPWVESTYDLNSRSLELEV  72

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L++FA L++     +WGY+TN G+ GNL+G+
Sbjct  73   LEFFAELFNAPAKNWWGYVTNGGSEGNLYGL  103



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  570
            +L R ++ + + TK  +GYP NL+FDY  L     + +NN GDPFI+ N+ ++S++FE  
Sbjct  13   ILKRLQQHIAKCTKLSIGYPANLNFDYTLLLPFFQYYLNNAGDPFIDGNFALNSKEFERQ  72

Query  571  VLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
             ++WFA+L+++E  EYWGY+TN GT GNL+ I
Sbjct  73   CINWFAQLYELE--EYWGYLTNGGTEGNLYSI  102



>ref|WP_037437993.1| histidine decarboxylase [Sphingobacterium antarcticum]
 gb|KEQ31557.1| histidine decarboxylase [Sphingobacterium antarcticus 4BY]
Length=379

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            LA  +K L    +  LGYP + DF+Y +L++   F INNLGDPFIES Y V +R  EV V
Sbjct  14   LAELKKKLTADAELMLGYPVSKDFNYDELAEFLKFPINNLGDPFIESTYQVGTRGLEVEV  73

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L++FA L+    + +WGY+TN G+ GNL+G+
Sbjct  74   LEFFAALFRAPVNNWWGYVTNGGSEGNLYGL  104



>dbj|BAH97114.1| amino acid decarboxylase [Naegleria fowleri]
Length=307

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 12/71 (17%)
 Frame = +1

Query  493  HFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI------------EKDEYWGYITN  636
             + I+NLGDPF+ESNYGVHSR FE  VL +FA+LW I              DEYWGY+TN
Sbjct  1    RYGIDNLGDPFVESNYGVHSRAFEQSVLQFFAKLWKIGPCPDEANAQNWSHDEYWGYVTN  60

Query  637  CGTXGNLHGIL  669
            CGT GNL+GIL
Sbjct  61   CGTEGNLYGIL  71



>ref|WP_036288070.1| histidine decarboxylase, partial [Methylocystis sp. ATCC 49242]
Length=376

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L R    L  R    +GYP N  FDY +L +   FS+NN+GDPF ++ YG+++ +FE  V
Sbjct  21   LDRLHDELQARAATMIGYPTNFCFDYPELERFHAFSLNNVGDPFDDNLYGLNTHEFEREV  80

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            +++FA+L+ I+K  YWGY+TN GT GN++G+
Sbjct  81   IEFFAQLYHIQKPNYWGYVTNGGTEGNMYGL  111



>ref|WP_014680621.1| histidine decarboxylase [Solitalea canadensis]
 gb|AFD07394.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=376

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L   R+ + E ++  LGYP + DFDY +L +L  + +NN+GDPF +  Y V SR+ E  V
Sbjct  12   LEALRQKIKENSQNSLGYPVSKDFDYSELFELLKYPVNNIGDPFADCTYSVDSREMEREV  71

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L++FA ++  +K+++WGY+TN G+ GN++G+
Sbjct  72   LEFFAEVFRAQKNDWWGYVTNGGSEGNMYGL  102



>ref|WP_013663956.1| histidine decarboxylase [Sphingobacterium sp. 21]
 gb|ADZ77228.1| Histidine decarboxylase [Sphingobacterium sp. 21]
Length=380

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L  Y +   ER  Y LGYP   DFDY DL  L    +NN+GDP +ES Y ++SR  E  V
Sbjct  11   LTNYMQRAEERAAYFLGYPIARDFDYSDLYPLLKLPLNNIGDPLVESTYDLNSRSLEQEV  70

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L +FA L+    D +WGY+TN G+ GNL+G+
Sbjct  71   LAFFADLFRAPADNWWGYVTNGGSEGNLYGL  101



>gb|ELU52247.1| PLP-dependent enzyme, glutamate decarboxylase [Vibrio campbellii 
CAIM 519 = NBRC 15631]
Length=230

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  11   LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  70

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            +++FA+L+   +D++WGY+TN  T  NL+ +
Sbjct  71   IEFFAKLFRAPEDDWWGYVTNGSTEANLYAL  101



>ref|WP_041881750.1| histidine decarboxylase [Pedobacter sp. NL19]
 gb|KIO77140.1| histidine decarboxylase [Pedobacter sp. NL19]
Length=379

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +1

Query  385  ASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  564
            A+ L    + L+  +   LGYP + DFDY +L+   +F INNLGDPF+ S Y + +R+ E
Sbjct  11   AAKLKDLMERLIADSALMLGYPVSKDFDYAELAGFLNFPINNLGDPFVASTYNIGTREME  70

Query  565  VGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
              VL++FA L+   ++ +WGY+TN G+ GNL+G+
Sbjct  71   REVLEFFAELFRAPQNNWWGYVTNGGSEGNLYGL  104



>ref|WP_029274788.1| histidine decarboxylase [Pedobacter borealis]
Length=377

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  421  ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD  600
            ++T   LGYP + DFDY  LS    + +NNLGDPF+ S YGV SR+ E  V+ +FA L+ 
Sbjct  23   KQTDLFLGYPVSKDFDYQSLSDFLKYPMNNLGDPFVTSTYGVGSRELEKEVVQFFAELFR  82

Query  601  IEKDEYWGYITNCGTXGNLHGI  666
               D +WGY+TN G+ GNL+G+
Sbjct  83   APADNWWGYVTNGGSEGNLYGL  104



>ref|WP_026362388.1| histidine decarboxylase [Geopsychrobacter electrodiphilus]
Length=360

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  409  KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA  588
            + L ERT   LGYP   DFDY  L Q     +NN+GDPF  S Y V +R+FE  VL++ A
Sbjct  6    ERLSERTDQFLGYPVAKDFDYQHLVQFLDLPLNNIGDPFAPSTYQVDTREFEREVLEFSA  65

Query  589  RLWDIEKDEYWGYITNCGTXGNLHGI  666
            RL   E++ +WGY+TN G+ GNL+G+
Sbjct  66   RLLRAEENSWWGYVTNGGSEGNLYGL  91



>ref|WP_038863593.1| histidine decarboxylase [Vibrio campbellii]
Length=386

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  11   LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  70

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            +++FA+L+   +D++WGY+TN  T  NL+ +
Sbjct  71   IEFFAKLFRAPEDDWWGYVTNGSTEANLYAL  101



>ref|WP_033002296.1| histidine decarboxylase, partial [Vibrio campbellii]
Length=376

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L R+ + + +++   +GYP + DFDY  L++L ++ +NNLGDPF +S + V SR+FE  V
Sbjct  1    LDRFIQDINDKSTSFMGYPISTDFDYQQLTELINYPLNNLGDPFAKSTWQVDSREFECEV  60

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            +++FA+L+   +D++WGY+TN  T  NL+ +
Sbjct  61   IEFFAKLFRAPEDDWWGYVTNGSTEANLYAL  91



>ref|WP_014201338.1| histidine decarboxylase [Owenweeksia hongkongensis]
 gb|AEV31977.1| PLP-dependent enzyme, glutamate decarboxylase [Owenweeksia hongkongensis 
DSM 17368]
Length=380

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  VLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVG  570
            +++   + ++  T+  LGYP + DFDY +L     + +NNLGDPFI S YGV+S + E  
Sbjct  7    IISELLEKVITNTENFLGYPVSKDFDYDELMPFLKYPMNNLGDPFINSTYGVNSNEMEKE  66

Query  571  VLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            V+ +FA+L+  E + +WGY++N G+ GNL+G+
Sbjct  67   VIAFFAKLFRAEPNNWWGYVSNGGSEGNLYGL  98



>ref|WP_025146293.1| histidine decarboxylase [Sphingobacterium sp. H1ai]
Length=377

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  424  RTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI  603
            +T+  LGYP + DFDY  L+    + +NNLGDPF+ S YGV SR+ E  V+ +FA L+  
Sbjct  24   QTELFLGYPVSKDFDYQALADFLKYPMNNLGDPFVTSTYGVGSRELEKEVVQFFAELFRA  83

Query  604  EKDEYWGYITNCGTXGNLHGI  666
              D +WGY+TN G+ GNL+G+
Sbjct  84   PADNWWGYVTNGGSEGNLYGL  104



>ref|WP_041764715.1| hypothetical protein, partial [Leptolyngbya sp. PCC 7376]
Length=386

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +1

Query  382  MASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQF  561
            M S +   ++   ++  +  GY  N DFDY  LS    F INN+GDPF+   YG+HSR  
Sbjct  1    MKSHMDGLKEYFRDQKSHFAGYQVNADFDYSALSDFLEFHINNVGDPFVAGTYGIHSRMM  60

Query  562  EVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            E  ++++FA+L+  ++ +YWGY+T+ GT  N++G+
Sbjct  61   ERPIIEFFAKLFHAKEKDYWGYVTSGGTEANMYGL  95



>ref|WP_039472909.1| histidine decarboxylase [Pedobacter kyungheensis]
 gb|KIA95404.1| histidine decarboxylase [Pedobacter kyungheensis]
Length=377

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +1

Query  358  STGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESN  537
            ++G+  A     L+   + +  +T   LGYP   DFDY +L+    + +NNLGDPF+ S 
Sbjct  2    TSGNLSATDQHTLSDLLEKVKNQTDLFLGYPVAKDFDYQELTDFLKYPMNNLGDPFVTST  61

Query  538  YGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            YGV SR+ E  V+ +FA L+   +D +WGY+TN G+ GNL+G+
Sbjct  62   YGVGSRELEKEVVAFFANLFRAPEDNWWGYVTNGGSEGNLYGL  104



>gb|KIP17071.1| histidine decarboxylase [Burkholderia sp. MSHR3999]
Length=391

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  409  KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA  588
            +++ E   + LGYP+  DFDY  L +    + NNLGDPF +  Y V SR+FE  V+ +FA
Sbjct  15   ESMNEANNHFLGYPFARDFDYSALWRFLGLTGNNLGDPFQDGYYRVDSREFEREVVRFFA  74

Query  589  RLWDIEKDEYWGYITNCGTXGNLHGI  666
             L++ E D+YWGY+TN GT GN++G+
Sbjct  75   SLFNAEADDYWGYVTNGGTEGNIYGL  100



>ref|WP_042585292.1| histidine decarboxylase [Burkholderia sp. MSHR3999]
Length=375

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +1

Query  421  ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWD  600
            E   + LGYP+  DFDY  L +    + NNLGDPF +  Y V SR+FE  V+ +FA L++
Sbjct  3    EANNHFLGYPFARDFDYSALWRFLGLTGNNLGDPFQDGYYRVDSREFEREVVRFFASLFN  62

Query  601  IEKDEYWGYITNCGTXGNLHGI  666
             E D+YWGY+TN GT GN++G+
Sbjct  63   AEADDYWGYVTNGGTEGNIYGL  84



>gb|KFF73912.1| histidine decarboxylase [Chryseobacterium sp. P1-3]
Length=383

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 7/97 (7%)
 Frame = +1

Query  397  ARYRKTLV-------ERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  555
            AR +K L+       E++ + +GYP+  DFDY +L  L  + I N+GDPFIESNY V+S 
Sbjct  3    AREQKKLINFINVIKEKSTFSIGYPFARDFDYTELYDLFQYPIANVGDPFIESNYAVNSF  62

Query  556  QFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            + E  V+ +FA L+   KD Y GY+T+ G+ GNL+G+
Sbjct  63   EIEREVIQFFAGLFRAPKDNYSGYVTSGGSEGNLYGL  99



>gb|AFY36874.1| Histidine decarboxylase [Leptolyngbya sp. PCC 7376]
Length=669

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +1

Query  352  NESTGDKEAYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIE  531
            N+S   +   + S +   ++   ++  +  GY  N DFDY  LS    F INN+GDPF+ 
Sbjct  23   NQSKKLERHEIKSHMDGLKEYFRDQKSHFAGYQVNADFDYSALSDFLEFHINNVGDPFVA  82

Query  532  SNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
              YG+HSR  E  ++++FA+L+  ++ +YWGY+T+ GT  N++G+
Sbjct  83   GTYGIHSRMMERPIIEFFAKLFHAKEKDYWGYVTSGGTEANMYGL  127



>ref|WP_014680343.1| histidine decarboxylase [Solitalea canadensis]
 gb|AFD07116.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=388

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            L  Y +   ER K+ +GYP   DFDY +L  L    +NN+GDP ++S Y ++SR  E  V
Sbjct  13   LHDYMQKAEERAKHFIGYPIARDFDYSELYPLLSLPLNNVGDPLVDSTYDLNSRSLEQEV  72

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            L +FA L++  ++ +WGY+TN G+ GNL+G+
Sbjct  73   LAFFAELFNAPENNWWGYVTNGGSEGNLYGL  103



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +1

Query  427  TKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIE  606
            T+  LGYP + DFDY +L     F +NNLGDPF ES Y V SR  E  V+++FARL+   
Sbjct  22   TQNFLGYPVSKDFDYSELMPFLQFPLNNLGDPFSESTYRVDSRAMEREVVNFFARLFRAH  81

Query  607  KDEYWGYITNCGTXGNLHGI  666
            +++ WGY+TN G+ GNL+ +
Sbjct  82   ENDIWGYVTNGGSEGNLYSL  101



>ref|WP_018151708.1| hypothetical protein [Leeia oryzae]
Length=370

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  409  KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFA  588
            + L E +++ LGYP   D DY +L +   F INN+GDPF +S Y + +R+ E  V+ +FA
Sbjct  15   QNLSENSQHFLGYPCANDLDYENLFRFLQFPINNVGDPFQDSTYRLATREIEQEVVHFFA  74

Query  589  RLWDIEKDEYWGYITNCGTXGNLHGI  666
             L+   +D+YWGY+TN GT GNL+G+
Sbjct  75   DLFRAPQDDYWGYVTNGGTEGNLYGL  100



>ref|WP_027411177.1| histidine decarboxylase [Aquimarina muelleri]
Length=375

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  427  TKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIE  606
            T+  LGYP + DFDY +L     + +NNLGDPF ES Y V SR  E  V+++FA L+   
Sbjct  22   TQNFLGYPVSKDFDYSELMPFLQYPLNNLGDPFSESTYRVDSRAMEREVVNFFAGLFRAH  81

Query  607  KDEYWGYITNCGTXGNLHGI  666
             D+ WGY+TN G+ GNL+G+
Sbjct  82   TDDIWGYVTNGGSEGNLYGL  101



>ref|WP_004737502.1| histidine decarboxylase [Vibrio splendidus]
 gb|EGU45031.1| Histidine decarboxylase [Vibrio splendidus ATCC 33789]
Length=373

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +1

Query  376  AYMASVLARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSR  555
            A+    L  + K + ++    +GYP + DF+Y  L +L +F +NNLGDPF +S + V SR
Sbjct  5    AHQQEKLKIFIKDIHKKATSFMGYPISTDFNYQQLKELINFPLNNLGDPFAKSTWQVDSR  64

Query  556  QFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            +FE  V+++FA+L    + ++WGY+TN  T  NL+ +
Sbjct  65   EFECEVIEFFAKLLRAPEKDWWGYVTNGSTEANLYAL  101



>ref|WP_010521317.1| histidine decarboxylase [Flavobacteriaceae bacterium HQM9]
Length=378

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +1

Query  394  LARYRKTLVERTKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGV  573
            LA  ++ L+   +  LGYP + DF++ +L     FSINN+GDPF + NY V +   E  V
Sbjct  13   LAHLKEQLINYREKVLGYPISSDFNFSELYPFLEFSINNIGDPFEDCNYKVQTTNLEREV  72

Query  574  LDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            + +FA L++ + ++YWGYITN G+  NL G+
Sbjct  73   ISFFAELFNADPNDYWGYITNGGSENNLCGL  103



>ref|XP_006851377.1| hypothetical protein AMTR_s00040p00010950, partial [Amborella 
trichopoda]
 gb|ERN12958.1| hypothetical protein AMTR_s00040p00010950, partial [Amborella 
trichopoda]
Length=100

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  283  KREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  441
            +REIVL  NVH +CLEVT+PDAD+E T +K+AYMAS+LARY+K L+ER K+ L
Sbjct  48   EREIVLESNVHLSCLEVTDPDADDEVTREKDAYMASILARYQKLLIERAKHLL  100



>ref|XP_001757041.1| predicted protein [Physcomitrella patens]
 gb|EDQ78272.1| predicted protein [Physcomitrella patens]
Length=525

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  442  GYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYW  621
            GY +NLDF+Y  LS +Q+  I+NLG+PFIE N+G+ SRQF+VGV+DWFA LW+ EK E  
Sbjct  423  GYSFNLDFNYETLSPIQNSFIDNLGNPFIERNFGIPSRQFDVGVMDWFATLWESEK-EIS  481

Query  622  GYITNCGTXGNLHGI  666
            G+       G + G+
Sbjct  482  GWRMCLKMAGYMPGL  496



>ref|XP_008620940.1| histidine decarboxylase [Saprolegnia diclina VS20]
 gb|EQC25649.1| histidine decarboxylase [Saprolegnia diclina VS20]
Length=430

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = +1

Query  337  EPDADNEST-GDKEAYMASVLARYR---KTLVERTKYHLGYPYNLDFDYGDLSQLQHFSI  504
            + D D  ST GD     A+  AR +   +T+ ER+++ +G+P   D+DY  L     F +
Sbjct  48   DSDTDASSTDGDALCLPAADAARLQALYETVSERSEHLVGFPSCKDWDYSALYPFLSFPM  107

Query  505  NNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIEKDEYWGYITNCGTXGNLHGI  666
            NN+GDP+IES   V +R  E  VL +FA L     D+ WGY+TN GT GNL+G+
Sbjct  108  NNVGDPYIESISKVSTRDCERDVLSFFASLLRAPVDDVWGYVTNGGTEGNLYGM  161



>ref|WP_034885662.1| pyridoxal-dependent decarboxylase, partial [Ensifer sp. TW10]
Length=361

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  439  LGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDI-EKDE  615
            LGYPYNLDFD   +SQ   F +NNLGDP++ S+Y       E+ V+DW  R+W+  + +E
Sbjct  1    LGYPYNLDFDPRPISQFGEFLVNNLGDPYVGSHYATEVCDLELEVVDWTMRVWECADPEE  60

Query  616  YWGYITNCGTXGNLHGI  666
            YWG +   GT GNL  I
Sbjct  61   YWGTVGASGTEGNLWAI  77



>ref|WP_035090976.1| histidine decarboxylase [Aquimarina macrocephali]
Length=373

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  427  TKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIE  606
            T+  LGYP + DFDY +L     F +NNLGDPF ES Y V SR  E  V+++FA L+   
Sbjct  22   TQNFLGYPVSKDFDYSELMPFLQFPLNNLGDPFSESTYRVDSRAMEREVVNFFAGLFRAH  81

Query  607  KDEYWGYITNCGTXGNLHGI  666
            +++ WGY+TN G+ GNL+ +
Sbjct  82   ENDIWGYVTNGGSEGNLYSL  101



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  427  TKYHLGYPYNLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWDIE  606
            T+  LGYP + DFDY +L     F +NNLGDPF ES Y V SR  E  V+++FA L+   
Sbjct  26   TQNFLGYPVSKDFDYSELMPFLQFPLNNLGDPFSESTYRVDSRAMEREVVNFFAGLFRAH  85

Query  607  KDEYWGYITNCGTXGNLHGI  666
            +++ WGY+TN G+ GNL+ +
Sbjct  86   ENDIWGYVTNGGSEGNLYSL  105



Lambda      K        H        a         alpha
   0.317    0.136    0.417    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780