BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022L18

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  303   4e-98   Nicotiana tomentosiformis
gb|AAD20626.1|  squalene synthase                                       303   6e-98   Capsicum annuum
ref|NP_001236365.1|  squalene synthase                                  300   9e-97   
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  300   9e-97   Nicotiana sylvestris
gb|AEX26930.1|  squalene synthase 1-2                                   298   3e-96   Solanum tuberosum [potatoes]
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            298   3e-96   
dbj|BAA82093.1|  squalene synthase                                      298   3e-96   Solanum tuberosum [potatoes]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       298   3e-96   Solanum tuberosum [potatoes]
gb|ADG36717.1|  squalene synthase 2                                     298   4e-96   Glycyrrhiza uralensis [Chinese licorice]
gb|AGS57530.1|  squalene synthase                                       298   4e-96   Solanum nigrum
gb|ACT52825.1|  squalene synthase 2                                     298   4e-96   Glycyrrhiza uralensis [Chinese licorice]
gb|ACS66749.1|  squalene synthase                                       298   5e-96   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36719.1|  squalene synthase 2                                     298   5e-96   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77655.1|  squalene synthase 2                                    298   5e-96   Glycyrrhiza eurycarpa
ref|NP_001234716.1|  squalene synthase                                  298   6e-96   
ref|XP_009631700.1|  PREDICTED: squalene synthase                       298   6e-96   Nicotiana tomentosiformis
gb|AAB02945.1|  squalene synthase                                       296   6e-96   Nicotiana tabacum [American tobacco]
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       297   1e-95   Glycine max [soybeans]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  297   1e-95   Prunus mume [ume]
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            298   1e-95   
emb|CAJ77653.1|  squalene synthase 2                                    296   2e-95   Glycyrrhiza uralensis [Chinese licorice]
gb|AEX26929.1|  squalene synthase 1-1                                   296   2e-95   Solanum tuberosum [potatoes]
gb|AGB05603.1|  squalene synthase                                       296   2e-95   Camellia oleifera [abura-tsubaki]
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         296   2e-95   Jatropha curcas
gb|AAM27472.1|  squalene synthase                                       292   2e-95   Nicotiana tabacum [American tobacco]
gb|AFR77735.1|  squalene synthase                                       296   3e-95   Camellia oleifera [abura-tsubaki]
gb|AAB08578.1|  squalene synthase                                       295   4e-95   Nicotiana tabacum [American tobacco]
gb|AEX26932.1|  squalene synthase                                       295   4e-95   Solanum chacoense
gb|ACN69082.1|  squalene synthase                                       295   5e-95   Diospyros kaki [Japanese persimmon]
gb|AHA84150.1|  squalene synthase                                       294   2e-94   Phaseolus vulgaris [French bean]
ref|XP_009802568.1|  PREDICTED: squalene synthase                       294   2e-94   Nicotiana sylvestris
gb|ACU21003.1|  unknown                                                 294   2e-94   Glycine max [soybeans]
gb|ADW27427.1|  squalene synthase                                       293   2e-94   Astragalus membranaceus
dbj|BAH23428.1|  squalene synthetase                                    293   2e-94   Euphorbia tirucalli
gb|ADV57358.1|  squalene synthase                                       293   3e-94   Astragalus membranaceus
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    293   3e-94   
gb|ADC95435.1|  squalene synthase                                       293   4e-94   Withania somnifera [ashwagandha]
emb|CDP20866.1|  unnamed protein product                                293   7e-94   Coffea canephora [robusta coffee]
dbj|BAA13084.1|  squalene synthase                                      292   9e-94   Glycyrrhiza glabra
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  292   9e-94   
gb|KDO43896.1|  hypothetical protein CISIN_1g015087mg                   288   1e-93   Citrus sinensis [apfelsine]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  291   1e-93   Sesamum indicum [beniseed]
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            291   1e-93   
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    291   1e-93   Nicotiana benthamiana
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   290   2e-93   Citrus sinensis [apfelsine]
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   289   2e-93   Citrus sinensis [apfelsine]
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   290   2e-93   Citrus sinensis [apfelsine]
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            288   3e-93   Populus euphratica
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             291   3e-93   Phaseolus vulgaris [French bean]
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       290   3e-93   Fragaria vesca subsp. vesca
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       290   3e-93   Fragaria vesca subsp. vesca
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             290   4e-93   
ref|XP_010066209.1|  PREDICTED: squalene synthase                       290   4e-93   Eucalyptus grandis [rose gum]
gb|ADX01171.1|  putative squalene synthase                              290   5e-93   Bacopa monnieri
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               290   5e-93   Medicago truncatula
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  290   6e-93   
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            289   1e-92   Populus euphratica
gb|AEA41713.1|  squalene synthase                                       289   1e-92   Eleutherococcus senticosus
ref|XP_003607040.1|  Squalene synthase                                  289   1e-92   
gb|AEA41712.1|  squalene synthase                                       289   2e-92   Eleutherococcus senticosus
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  289   2e-92   Pyrus x bretschneideri [bai li]
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  288   2e-92   Solanum lycopersicum
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             288   2e-92   
gb|AGI19256.1|  squalene synthase                                       288   2e-92   Panax notoginseng [san-qi]
gb|AEM42980.1|  squalene synthase                                       288   2e-92   Siraitia grosvenorii [arhat fruit]
gb|AFI33135.3|  squalene synthase                                       288   3e-92   Eriobotrya japonica [loquat]
gb|ABA29019.1|  squalene synthase                                       288   3e-92   Panax notoginseng [san-qi]
gb|AER23670.1|  squalene synthase                                       288   3e-92   Eleutherococcus senticosus
ref|XP_002266150.1|  PREDICTED: squalene synthase                       288   3e-92   Vitis vinifera
gb|AED99863.1|  squalene synthase                                       288   3e-92   Panax quinquefolius
ref|XP_010109768.1|  hypothetical protein L484_008444                   288   4e-92   Morus notabilis
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                285   5e-92   Erythranthe guttata [common monkey flower]
emb|CAN81937.1|  hypothetical protein VITISV_028001                     288   5e-92   Vitis vinifera
gb|AFK29283.1|  putative squalene synthase 1                            287   5e-92   Salvia miltiorrhiza [Chinese salvia]
gb|ACR57219.1|  squalene synthase                                       287   6e-92   Salvia miltiorrhiza [Chinese salvia]
dbj|BAC56854.1|  squalene synthase                                      287   7e-92   Lotus japonicus
gb|ACX42425.1|  squalene synthase                                       287   8e-92   Bupleurum chinense
gb|ACX42426.1|  squalene synthase                                       287   8e-92   Bupleurum chinense
gb|ACX42423.1|  squalene synthase                                       286   1e-91   Bupleurum chinense
dbj|BAA24289.1|  squalene synthase                                      286   1e-91   Panax ginseng [Asiatic ginseng]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                286   1e-91   Erythranthe guttata [common monkey flower]
gb|ADC32654.1|  squalene synthase                                       286   1e-91   Aralia elata
gb|ACA66014.1|  squalene synthase                                       286   1e-91   Panax ginseng [Asiatic ginseng]
gb|AGS78117.1|  squalene synthase 1                                     286   2e-91   Malus domestica [apple tree]
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  286   2e-91   Cucumis melo [Oriental melon]
gb|AAV58897.1|  squalene synthase                                       286   2e-91   Centella asiatica [Asiatic pennywort]
gb|AFZ93644.1|  squalene synthetase                                     286   2e-91   Euphorbia lathyris
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  286   3e-91   Cicer arietinum [garbanzo]
gb|AAY46017.1|  squalene synthase                                       285   4e-91   Bupleurum falcatum
emb|CAJ77652.1|  squalene synthase 1                                    285   4e-91   Glycyrrhiza uralensis [Chinese licorice]
gb|ACV88718.1|  squalene synthase                                       285   5e-91   Panax ginseng [Asiatic ginseng]
emb|CAJ58418.1|  squalene synthase                                      285   5e-91   Panax quinquefolius
gb|ACS66750.1|  squalene synthase                                       285   7e-91   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  284   8e-91   Pyrus x bretschneideri [bai li]
gb|AFK36923.1|  unknown                                                 284   8e-91   Medicago truncatula
gb|ADW78251.1|  squalene synthase                                       284   9e-91   Withania somnifera [ashwagandha]
gb|ADG36702.1|  squalene synthase 1                                     284   1e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36705.1|  squalene synthase 1                                     284   1e-90   Glycyrrhiza uralensis [Chinese licorice]
ref|NP_001280921.1|  squalene synthase-like                             284   1e-90   Malus domestica [apple tree]
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  284   1e-90   Sesamum indicum [beniseed]
gb|ACX42424.1|  squalene synthase                                       284   2e-90   Bupleurum chinense
gb|AIK21786.1|  squalene synthase                                       284   2e-90   Panax notoginseng [san-qi]
gb|KHG01756.1|  Squalene synthase                                       283   2e-90   Gossypium arboreum [tree cotton]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    283   2e-90   Gossypium raimondii
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                283   3e-90   Erythranthe guttata [common monkey flower]
gb|ADG36706.1|  squalene synthase 1                                     283   3e-90   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  283   3e-90   Nelumbo nucifera [Indian lotus]
gb|KJB12169.1|  hypothetical protein B456_002G004400                    283   3e-90   Gossypium raimondii
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       282   6e-90   Tarenaya hassleriana [spider flower]
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       282   6e-90   Tarenaya hassleriana [spider flower]
gb|ACT52826.1|  squalene synthase 1                                     282   6e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|AFN61199.1|  squalene synthase                                       282   6e-90   Chlorophytum borivilianum
gb|ADG36711.1|  squalene synthase 1                                     282   7e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36699.1|  squalene synthase 1                                     282   8e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36707.1|  squalene synthase 1                                     282   8e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36701.1|  squalene synthase 1                                     282   8e-90   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36704.1|  squalene synthase 1                                     281   2e-89   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36703.1|  squalene synthase 1                                     281   2e-89   Glycyrrhiza uralensis [Chinese licorice]
gb|AFK29284.1|  putative squalene synthase 2                            281   2e-89   Salvia miltiorrhiza [Chinese salvia]
gb|ADG36709.1|  squalene synthase 1                                     281   2e-89   Glycyrrhiza uralensis [Chinese licorice]
gb|ABG66304.1|  squalene synthase                                       281   3e-89   Polygala tenuifolia [Chinese senega-root]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  280   3e-89   
gb|ACZ71037.1|  squalene synthase                                       280   3e-89   Panax ginseng [Asiatic ginseng]
gb|ADD54645.1|  squalene synthase                                       280   3e-89   Bruguiera gymnorhiza [Burma mangrove]
gb|ACQ90302.1|  squalene synthase                                       280   3e-89   Gynostemma pentaphyllum [jiaogulan]
emb|CAJ77654.1|  squalene synthase 1                                    280   5e-89   Glycyrrhiza eurycarpa
gb|AFT92039.1|  squalene synthase                                       280   6e-89   Euphorbia pekinensis
dbj|BAA13083.1|  squalene synthase                                      280   7e-89   Glycyrrhiza glabra
gb|AAR20329.1|  squalene synthase                                       280   8e-89   Artemisia annua [sweet Annie]
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  279   1e-88   Populus euphratica
gb|ADG36708.1|  squalene synthase 1                                     278   2e-88   Glycyrrhiza uralensis [Chinese licorice]
gb|KJB32574.1|  hypothetical protein B456_005G247700                    278   4e-88   Gossypium raimondii
emb|CAJ58419.1|  squalene synthase                                      278   4e-88   Panax quinquefolius
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       277   4e-88   Eucalyptus grandis [rose gum]
gb|AAR20328.1|  squalene synthase                                       277   7e-88   Artemisia annua [sweet Annie]
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       277   8e-88   Eucalyptus grandis [rose gum]
ref|XP_002313765.1|  squalene synthase family protein                   276   9e-88   Populus trichocarpa [western balsam poplar]
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      276   2e-87   
gb|AIX97193.1|  squalene synthase                                       275   3e-87   Matricaria chamomilla var. recutita [German chamomile]
gb|ABX10442.1|  squalene synthase 2                                     275   5e-87   Gossypium hirsutum [American cotton]
gb|KHG07441.1|  Squalene synthase                                       274   7e-87   Gossypium arboreum [tree cotton]
gb|AAG14896.2|AF302464_1  squalene synthase                             275   7e-87   Artemisia annua [sweet Annie]
gb|KHN25422.1|  Squalene synthase                                       274   9e-87   Glycine soja [wild soybean]
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             276   1e-86   
gb|ABQ96265.1|  squalene synthase                                       274   1e-86   Psammosilene tunicoides
gb|KJB12171.1|  hypothetical protein B456_002G004400                    273   2e-86   Gossypium raimondii
ref|NP_195190.1|  Squalene synthase 1                                   271   8e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  271   1e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             269   9e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             268   2e-84   Eutrema salsugineum [saltwater cress]
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       267   2e-84   
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       268   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010432389.1|  PREDICTED: squalene synthase                       268   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  268   2e-84   Camelina sativa [gold-of-pleasure]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    268   3e-84   Arabis alpina [alpine rockcress]
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       268   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009110610.1|  PREDICTED: squalene synthase                       267   5e-84   
gb|EPS74249.1|  hypothetical protein M569_00507                         263   6e-84   Genlisea aurea
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       266   6e-84   Phoenix dactylifera
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       266   8e-84   Phoenix dactylifera
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       266   1e-83   Brassica rapa
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             266   1e-83   Capsella rubella
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  266   1e-83   Elaeis guineensis
gb|AGW25489.1|  squalene synthase                                       265   2e-83   Paris polyphylla var. yunnanensis
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             265   2e-83   
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  264   9e-83   Eucalyptus grandis [rose gum]
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       262   1e-82   
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  263   2e-82   Brassica rapa
gb|AAY22201.1|  squalene synthase                                       261   3e-82   Datura inoxia [downy thornapple]
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       261   5e-82   Phoenix dactylifera
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  261   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  260   1e-81   Nicotiana sylvestris
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             260   2e-81   Capsella rubella
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  260   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002869132.1|  squalene synthase 2                                259   4e-81   
gb|AFY63035.1|  squalene synthase                                       259   6e-81   Alisma plantago-aquatica subsp. orientale
gb|KJB32578.1|  hypothetical protein B456_005G247700                    258   8e-81   Gossypium raimondii
gb|AEX26931.1|  squalene synthase 1-3                                   249   8e-81   Solanum tuberosum [potatoes]
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  258   1e-80   Camelina sativa [gold-of-pleasure]
emb|CDX72493.1|  BnaC07g45150D                                          258   2e-80   
gb|AGN32410.1|  squalene synthase                                       258   2e-80   Dioscorea zingiberensis
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       258   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       257   3e-80   Camelina sativa [gold-of-pleasure]
gb|AHB20141.2|  squalene synthase                                       256   6e-80   Fritillaria thunbergii
gb|AAB61927.1|  squalene synthase 2                                     256   6e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195191.2|  squalene synthase 2                                   256   8e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  256   9e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    256   9e-80   Arabis alpina [alpine rockcress]
gb|AGI56082.1|  squalene synthase                                       256   1e-79   Dendrobium officinale
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  255   2e-79   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY17472.1|  BnaC03g65910D                                          256   2e-79   Brassica napus [oilseed rape]
ref|XP_009591242.1|  PREDICTED: squalene synthase-like                  249   1e-78   
emb|CDX69076.1|  BnaC01g03770D                                          253   2e-78   
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  253   2e-78   Eucalyptus grandis [rose gum]
gb|ACI14294.1|  squalene synthase                                       248   2e-78   Linum usitatissimum
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          252   3e-78   Amborella trichopoda
emb|CDX72494.1|  BnaC07g45160D                                          251   5e-78   
ref|XP_009110500.1|  PREDICTED: squalene synthase                       251   6e-78   Brassica rapa
emb|CDY45323.1|  BnaA03g52960D                                          244   1e-77   Brassica napus [oilseed rape]
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          250   2e-77   Sorghum bicolor [broomcorn]
emb|CDX75451.1|  BnaA01g02510D                                          250   2e-77   
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  246   5e-76   Oryza brachyantha
ref|NP_001130502.1|  uncharacterized protein LOC100191601               244   2e-75   
ref|NP_001104839.1|  squalene synthase1                                 244   3e-75   Zea mays [maize]
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              244   3e-75   
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  244   4e-75   Eucalyptus grandis [rose gum]
ref|NP_001051625.1|  Os03g0805100                                       243   6e-75   
gb|EEE60131.1|  hypothetical protein OsJ_13016                          243   7e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AFJ15526.1|  squalene synthase                                       241   2e-74   Azadirachta indica [Indian-lilac]
emb|CDX75450.1|  BnaA01g02520D                                          240   1e-73   
emb|CDX69075.1|  BnaC01g03780D                                          238   5e-73   
emb|CDX76294.1|  BnaA08g11060D                                          238   9e-73   
gb|ABI14439.1|  squalene synthase                                       236   4e-72   Taxus cuspidata [ichii]
gb|AHI96421.1|  squalene synthase                                       231   6e-70   Pinus massoniana [Chinese red pine]
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  230   6e-70   
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       229   7e-70   
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  230   9e-70   Solanum tuberosum [potatoes]
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       229   2e-69   Solanum lycopersicum
gb|ABK24732.1|  unknown                                                 228   8e-69   Picea sitchensis
dbj|BAJ87710.1|  predicted protein                                      225   5e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY45322.1|  BnaA03g52950D                                          224   1e-67   Brassica napus [oilseed rape]
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  222   8e-67   Brachypodium distachyon [annual false brome]
ref|NP_001059129.1|  Os07g0200700                                       219   1e-65   
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      209   9e-63   
gb|AEX58673.1|  squalene synthase                                       211   3e-62   Huperzia serrata [toothed club-moss]
gb|AIW04729.1|  squalene synthase                                       209   2e-61   Dryopteris fragrans
ref|XP_001775898.1|  predicted protein                                  207   5e-61   
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  207   5e-61   Brachypodium distachyon [annual false brome]
ref|XP_001773253.1|  predicted protein                                  201   1e-59   
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  201   1e-58   Nicotiana sylvestris
gb|EMT03383.1|  Squalene synthetase                                     198   4e-57   
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             182   1e-51   
ref|XP_003058046.1|  predicted protein                                  182   4e-51   Micromonas pusilla CCMP1545
ref|XP_005851990.1|  hypothetical protein CHLNCDRAFT_18492              175   3e-50   Chlorella variabilis
ref|XP_001417488.1|  predicted protein                                  179   8e-50   Ostreococcus lucimarinus CCE9901
ref|XP_011395550.1|  Squalene synthase                                  179   9e-50   Auxenochlorella protothecoides
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           176   1e-49   Coccomyxa subellipsoidea C-169
emb|CDM86349.1|  unnamed protein product                                176   2e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002501456.1|  predicted protein                                  176   1e-48   Micromonas commoda
ref|XP_001756673.1|  predicted protein                                  175   1e-48   
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  175   1e-48   
ref|XP_007512409.1|  squalene synthase                                  176   2e-48   Bathycoccus prasinos
ref|XP_003078740.1|  FDFT_NICBE Farnesyl-diphosphate farnesyltran...    169   2e-48   
emb|CEF97547.1|  Squalene/phytoene synthase                             169   2e-46   Ostreococcus tauri
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              168   8e-46   Volvox carteri f. nagariensis
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           166   2e-45   Chlamydomonas reinhardtii
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              164   2e-44   
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 162   2e-43   Monoraphidium neglectum
gb|ADP89473.1|  squalene synthase                                       152   1e-42   Betula platyphylla [Asian white birch]
ref|XP_008351286.1|  PREDICTED: squalene synthase-like                  150   2e-42   Malus domestica [apple tree]
gb|KDD74507.1|  squalene/phytoene synthase                              155   8e-42   Helicosporidium sp. ATCC 50920
gb|ABW37701.1|  squalene synthase                                       150   1e-41   Panax notoginseng [san-qi]
sp|G0Y287.1|BOSS_BOTBR  RecName: Full=Botryococcus squalene synth...    157   2e-41   Botryococcus braunii
gb|AEY76157.1|  squalene synthase                                       146   2e-40   Dioscorea zingiberensis
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  150   4e-39   Botryococcus braunii
ref|XP_004986173.1|  PREDICTED: squalene synthase-like                  139   6e-38   
gb|ABA01562.1|  squalene synthase                                       138   2e-37   Bupleurum falcatum
gb|ACF35716.1|  squalene synthase 1                                     135   6e-37   Glycyrrhiza uralensis [Chinese licorice]
gb|ACF35714.1|  squalene synthase 1                                     135   7e-37   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_005837525.1|  farnesyl-diphosphate farnesyltransferase           143   1e-36   Guillardia theta CCMP2712
gb|EMT23370.1|  Squalene synthetase                                     141   4e-36   
ref|XP_011004277.1|  PREDICTED: squalene synthase-like                  134   1e-35   Populus euphratica
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  139   1e-35   
gb|EAY92248.1|  hypothetical protein OsI_13969                          134   4e-35   Oryza sativa Indica Group [Indian rice]
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        137   6e-35   Xenopus tropicalis [western clawed frog]
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         137   7e-35   
ref|XP_006681876.1|  hypothetical protein BATDEDRAFT_14137              135   4e-34   Batrachochytrium dendrobatidis JAM81
gb|KJE94382.1|  farnesyl-diphosphate farnesyltransferase 1              132   6e-34   Capsaspora owczarzaki ATCC 30864
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            135   1e-33   Cuculus canorus
ref|XP_004346713.1|  farnesyl-diphosphate farnesyltransferase 1         132   1e-33   Capsaspora owczarzaki ATCC 30864
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            134   1e-33   
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            135   1e-33   Cuculus canorus
emb|CCC50058.1|  putative farnesyltransferase                           134   2e-33   Trypanosoma vivax Y486
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            134   3e-33   Python bivittatus
ref|NP_001034383.1|  squalene synthase                                  134   4e-33   Gallus gallus [bantam]
ref|XP_005146462.1|  PREDICTED: squalene synthase                       134   4e-33   Melopsittacus undulatus
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    133   5e-33   Botryococcus braunii
gb|ELT92149.1|  hypothetical protein CAPTEDRAFT_164295                  133   6e-33   Capitella teleta
ref|XP_005075330.1|  PREDICTED: squalene synthase                       132   8e-33   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008170096.1|  PREDICTED: squalene synthase                       132   1e-32   
ref|XP_003498025.1|  PREDICTED: squalene synthase isoform X2            132   1e-32   
dbj|BAE36836.1|  unnamed protein product                                132   1e-32   
ref|NP_034321.2|  squalene synthase                                     132   2e-32   
ref|XP_008977274.1|  PREDICTED: squalene synthase isoform X2            131   2e-32   
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  132   2e-32   
ref|XP_003386611.1|  PREDICTED: squalene synthase-like                  129   2e-32   
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            131   2e-32   
gb|ESL10210.1|  farnesyltransferase                                     130   4e-32   
ref|XP_005044492.1|  PREDICTED: squalene synthase                       130   4e-32   
ref|XP_009210757.1|  PREDICTED: squalene synthase isoform X3            130   4e-32   
gb|AAF00038.1|  squalene synthase                                       130   4e-32   
gb|KFO77427.1|  Squalene synthase                                       130   4e-32   
ref|XP_006716310.1|  PREDICTED: squalene synthase isoform X1            130   5e-32   
ref|XP_003225597.2|  PREDICTED: squalene synthase                       130   5e-32   
ref|NP_062111.1|  squalene synthase                                     130   6e-32   
ref|XP_010863270.1|  PREDICTED: squalene synthase                       130   6e-32   
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             130   6e-32   
gb|AAL91344.1|  squalene synthase                                       125   6e-32   
ref|XP_005528843.1|  PREDICTED: squalene synthase                       130   6e-32   
dbj|BAA06102.1|  squalene synthase                                      130   8e-32   
ref|XP_008629248.1|  PREDICTED: squalene synthase                       130   9e-32   
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            130   9e-32   
ref|NP_001247653.1|  squalene synthase                                  129   1e-31   
ref|XP_002588446.1|  hypothetical protein BRAFLDRAFT_198828             124   1e-31   
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    129   1e-31   
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             129   1e-31   
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            129   1e-31   
ref|NP_004453.3|  squalene synthase isoform 1                           129   1e-31   
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               129   1e-31   
gb|AAB33404.1|  squalene synthase                                       129   1e-31   
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1              129   1e-31   
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2            129   1e-31   
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1            129   1e-31   
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            129   1e-31   
ref|XP_806809.1|  farnesyltransferase                                   129   2e-31   
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  129   2e-31   
ref|XP_002186800.1|  PREDICTED: squalene synthase                       129   2e-31   
ref|XP_008997579.1|  PREDICTED: squalene synthase-like isoform X2       128   2e-31   
ref|XP_004707702.1|  PREDICTED: squalene synthase isoform X2            129   2e-31   
ref|XP_010771634.1|  PREDICTED: squalene synthase isoform X2            129   2e-31   
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       129   2e-31   
ref|XP_008574546.1|  PREDICTED: squalene synthase isoform X3            128   2e-31   
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             129   2e-31   
ref|XP_008826308.1|  PREDICTED: squalene synthase                       129   2e-31   
ref|XP_005495474.1|  PREDICTED: squalene synthase                       129   2e-31   
ref|XP_004671442.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    129   2e-31   
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2            128   3e-31   
ref|XP_009046088.1|  hypothetical protein LOTGIDRAFT_56072              124   3e-31   
ref|XP_008290524.1|  PREDICTED: squalene synthase-like                  127   3e-31   
ref|XP_007128199.1|  PREDICTED: squalene synthase isoform X2            128   3e-31   
ref|XP_007192741.1|  PREDICTED: squalene synthase isoform X1            128   4e-31   
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            128   4e-31   
ref|XP_008311147.1|  PREDICTED: squalene synthase isoform X2            128   5e-31   
gb|EMP27211.1|  Squalene synthase                                       129   5e-31   
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  125   5e-31   
ref|NP_001189454.1|  squalene synthase                                  127   5e-31   
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             127   5e-31   
ref|XP_005683583.1|  PREDICTED: squalene synthase                       127   5e-31   
gb|AHG98484.1|  FDFT1                                                   125   5e-31   
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                  127   5e-31   
ref|XP_006906366.1|  PREDICTED: squalene synthase isoform X2            127   5e-31   
ref|XP_010971494.1|  PREDICTED: squalene synthase                       127   7e-31   
ref|XP_806417.1|  farnesyltransferase                                   127   8e-31   
ref|XP_010993460.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    127   8e-31   
gb|EKG06138.1|  squalene synthase, putative                             127   8e-31   
ref|NP_001267081.1|  squalene synthase                                  127   8e-31   
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            127   9e-31   
ref|XP_005859689.1|  PREDICTED: squalene synthase                       127   9e-31   
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2             126   1e-30   
ref|NP_001161120.1|  squalene synthase                                  126   1e-30   
gb|EMS67019.1|  Squalene synthase                                       117   2e-30   
ref|XP_004004500.1|  PREDICTED: squalene synthase                       126   2e-30   
ref|XP_004541881.1|  PREDICTED: squalene synthase-like isoform X2       126   2e-30   
ref|NP_001013022.1|  squalene synthase                                  126   2e-30   
ref|XP_010838568.1|  PREDICTED: squalene synthase                       126   2e-30   
ref|XP_006060304.1|  PREDICTED: squalene synthase                       126   2e-30   
sp|Q32KR6.1|FDFT_BOVIN  RecName: Full=Squalene synthase; Short=SQ...    126   2e-30   
gb|EDL20655.1|  mCG10034                                                125   2e-30   
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                  125   3e-30   
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2            125   3e-30   
ref|XP_004707701.1|  PREDICTED: squalene synthase isoform X1            125   3e-30   
ref|XP_003971766.1|  PREDICTED: squalene synthase-like                  125   4e-30   
ref|XP_004278741.1|  PREDICTED: squalene synthase                       125   4e-30   
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  125   4e-30   
ref|XP_008120692.1|  PREDICTED: squalene synthase-like                  125   4e-30   
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            125   4e-30   
gb|KFW77295.1|  Squalene synthase                                       125   4e-30   
gb|ESA03184.1|  hypothetical protein GLOINDRAFT_619                     125   5e-30   
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            125   6e-30   
gb|ELR63024.1|  Squalene synthase                                       124   6e-30   
ref|XP_008311146.1|  PREDICTED: squalene synthase isoform X1            124   6e-30   
ref|XP_003757973.1|  PREDICTED: squalene synthase                       125   7e-30   
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2            124   7e-30   
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2            124   7e-30   
gb|AFJ73943.1|  squalene synthase                                       120   7e-30   
gb|KFO99755.1|  Squalene synthase                                       124   7e-30   
ref|XP_007618604.1|  PREDICTED: squalene synthase isoform X1            124   8e-30   
gb|KFH73802.1|  farnesyl-diphosphate farnesyltransferase                117   8e-30   
ref|XP_007471181.1|  PREDICTED: squalene synthase isoform X2            124   8e-30   
gb|KFW01543.1|  Squalene synthase                                       124   1e-29   
ref|XP_005535962.1|  squalene synthase                                  120   1e-29   
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                  123   1e-29   
ref|XP_003868895.1|  GTP-binding protein                                120   1e-29   
gb|EKF38258.1|  squalene synthase, putative                             124   1e-29   
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            123   1e-29   
ref|XP_002619326.1|  hypothetical protein CLUG_00485                    121   2e-29   
ref|XP_007238776.1|  PREDICTED: squalene synthase                       123   2e-29   
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            123   2e-29   
ref|XP_004766139.1|  PREDICTED: squalene synthase isoform X2            122   2e-29   
gb|KFP31735.1|  Squalene synthase                                       123   2e-29   
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            123   2e-29   
gb|AFJ73947.1|  squalene synthase                                       120   2e-29   
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            123   2e-29   
ref|XP_010771633.1|  PREDICTED: squalene synthase isoform X1            123   2e-29   
ref|XP_005425026.1|  PREDICTED: squalene synthase                       123   3e-29   
ref|XP_006906365.1|  PREDICTED: squalene synthase isoform X1            123   3e-29   
gb|AFJ73953.1|  squalene synthase                                       119   3e-29   
ref|XP_008116142.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    123   3e-29   
ref|XP_007374454.1|  hypothetical protein SPAPADRAFT_60279              119   3e-29   
ref|XP_004198715.1|  Piso0_002102                                       120   3e-29   
ref|XP_004395309.1|  PREDICTED: squalene synthase isoform 2             122   3e-29   
ref|XP_004848518.1|  PREDICTED: squalene synthase isoform X2            122   3e-29   
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            122   3e-29   
ref|XP_005513697.1|  PREDICTED: squalene synthase                       122   3e-29   
ref|XP_008116141.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    122   4e-29   
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...    122   4e-29   
ref|XP_006729443.1|  PREDICTED: squalene synthase isoform X2            122   4e-29   
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       121   4e-29   
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    121   4e-29   
pdb|3WEJ|A  Chain A, Crystal Structure Of The Human Squalene Synt...    121   4e-29   
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1            122   4e-29   
gb|AFJ73959.1|  squalene synthase                                       119   4e-29   
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1                122   4e-29   
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            122   4e-29   
ref|XP_004766138.1|  PREDICTED: squalene synthase isoform X1            122   4e-29   
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    121   4e-29   
gb|AFJ73951.1|  squalene synthase                                       119   5e-29   
ref|XP_004088003.1|  PREDICTED: squalene synthase                       122   5e-29   
gb|AFJ73955.1|  squalene synthase                                       119   5e-29   
ref|XP_004541880.1|  PREDICTED: squalene synthase-like isoform X1       121   5e-29   
pdb|3WC9|A  Chain A, The Complex Structure Of Hssqs Wtih Ligand, ...    121   5e-29   
gb|AFJ73957.1|  squalene synthase                                       118   5e-29   
gb|AEP82679.1|  farnesyltransferase                                     118   5e-29   
ref|XP_005562631.1|  PREDICTED: squalene synthase isoform X3            122   6e-29   
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1             122   6e-29   
ref|XP_005095010.1|  PREDICTED: squalene synthase-like isoform X1       122   6e-29   
gb|KFV73970.1|  Squalene synthase                                       121   6e-29   
gb|AFJ73941.1|  squalene synthase                                       118   6e-29   
dbj|BAO39180.1|  squalene synthetase                                    120   7e-29   
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            121   7e-29   
gb|AFJ73935.1|  squalene synthase                                       118   7e-29   
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1            122   8e-29   
gb|AFJ73937.1|  squalene synthase                                       118   8e-29   
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1            122   8e-29   
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1            122   8e-29   
ref|XP_006993063.1|  PREDICTED: squalene synthase                       121   9e-29   
dbj|BAG60195.1|  unnamed protein product                                121   1e-28   
ref|NP_001274679.1|  squalene synthase isoform 3                        121   1e-28   
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2            121   1e-28   
ref|XP_010743678.1|  PREDICTED: squalene synthase-like                  119   1e-28   
ref|XP_004338669.1|  farnesyldiphosphate farnesyltransferase            116   1e-28   
emb|CCE44873.1|  hypothetical protein CPAR2_406760                      117   1e-28   
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1            121   1e-28   
ref|XP_001467618.1|  putative farnesyltransferase                       117   1e-28   
emb|CBJ48968.1|  Isopentenyl-diphosphate delta-isomerase type 1 f...    115   1e-28   
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            121   1e-28   
gb|AFJ73961.1|  squalene synthase                                       117   1e-28   
ref|XP_003863390.1|  farnesyltransferase, putative                      117   1e-28   
gb|AFJ73945.1|  squalene synthase                                       117   1e-28   
gb|AFJ73939.1|  squalene synthase                                       117   1e-28   
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1            121   2e-28   
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            120   2e-28   
ref|XP_002735807.1|  PREDICTED: squalene synthase-like                  119   2e-28   
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1            120   2e-28   
pdb|3WCB|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    120   2e-28   
pdb|3WCA|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    120   2e-28   
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1            120   2e-28   
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            120   2e-28   
emb|CCC92493.1|  unnamed protein product                                119   3e-28   
gb|AFJ73933.1|  squalene synthase                                       117   3e-28   
ref|XP_001915483.1|  PREDICTED: squalene synthase                       120   3e-28   
ref|XP_006642983.1|  PREDICTED: squalene synthase-like                  120   3e-28   
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                120   3e-28   
ref|WP_040444080.1|  hypothetical protein                               117   3e-28   
ref|XP_007882609.1|  PREDICTED: squalene synthase                       120   3e-28   
ref|XP_008247080.1|  PREDICTED: squalene synthase isoform X1            120   3e-28   
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1            120   4e-28   
emb|CBH13794.1|  farnesyltransferase, putative                          116   4e-28   
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              117   4e-28   
ref|XP_847542.1|  farnesyltransferase                                   116   4e-28   
emb|CCD12912.1|  unnamed protein product                                119   4e-28   
emb|CCD17497.1|  unnamed protein product                                118   5e-28   
emb|CDR47668.1|  CYFA0S36e00188g1_1                                     116   5e-28   
gb|KCW84806.1|  hypothetical protein EUGRSUZ_B01607                     112   5e-28   
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            119   5e-28   
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    118   6e-28   
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1             119   7e-28   
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              117   7e-28   
emb|CAN64028.1|  hypothetical protein VITISV_030715                     117   7e-28   
emb|CAG09159.1|  unnamed protein product                                119   1e-27   
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            119   1e-27   
ref|XP_004614762.1|  PREDICTED: squalene synthase                       117   1e-27   
ref|XP_790906.1|  PREDICTED: squalene synthase                          118   1e-27   
ref|XP_010805999.1|  PREDICTED: squalene synthase isoform X1            118   1e-27   
ref|XP_004083804.1|  PREDICTED: squalene synthase                       118   1e-27   
ref|XP_007128198.1|  PREDICTED: squalene synthase isoform X1            118   1e-27   
ref|XP_005008182.1|  PREDICTED: squalene synthase isoform X2            119   1e-27   
gb|EMG47120.1|  Squalene synthetase                                     116   1e-27   
ref|XP_004328595.1|  PREDICTED: squalene synthase                       118   1e-27   
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           118   1e-27   
emb|CDK28655.1|  unnamed protein product                                112   2e-27   
ref|XP_003984893.2|  PREDICTED: squalene synthase                       117   2e-27   
gb|EPX74343.1|  squalene synthase Erg9                                  111   3e-27   
ref|XP_002494415.1|  ZYRO0A00924p                                       113   3e-27   
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2            117   3e-27   
ref|NP_985991.1|  AFR444Cp                                              110   3e-27   
ref|XP_003225609.1|  PREDICTED: squalene synthase-like                  116   3e-27   
ref|XP_004395308.1|  PREDICTED: squalene synthase isoform 1             117   3e-27   
ref|XP_001645634.1|  hypothetical protein Kpol_541p19                   111   4e-27   
ref|XP_006172265.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl-dip...    117   4e-27   



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML+KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLRKVSRSFSLVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVK PIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKAPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMRMGAGMAKFICKE  158



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHIYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQQAIEDITMRMGAGMAKFICKE  158



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL I
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGI  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIQQLPL  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELEKHYKEAIEDITMRMGAGMAKFICKE  158



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ET DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ET DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ET DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ET DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+Y+VLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITMRMGAGMAKFICKE  158



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKE  158



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMA+FICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMARFICKE  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMARFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSR FALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRGFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK+ ++ +  +      G      +  ET DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKLYQQAIEDITMRMGAGMAKFICKEVETTDDYDEYCHYVAGLVGL  178



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAF ELG+ YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMRMGAGMAKFICKE  158



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD++WHF CG KDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDQDWHFSCGAKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKSYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAM27472.1| squalene synthase [Nicotiana tabacum]
Length=290

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKE  158



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAF ELG+ YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMRMGAGMAKFICKE  158



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKE  158



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLE GK YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLEHGKLYQQAIEDITMRMGAGMAKFICKE  158



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL AML+HPDDVYPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLAAMLRHPDDVYPLVKLKMAARHAEKQIPPEPHWAFCYTMLHKVSRSFGLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FH HIYDR+WHF CGT++YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILLAFHHHIYDRDWHFSCGTREYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q HHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKE  158



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW F YTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFRYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETLDDYDEYCHYVAGLVGL  178



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L+HPDD YPL+KLK+A++  EKQIP QPHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMASKHAEKQIPAQPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQEAIE+IT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKSYQEAIENITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKSYQEAIENITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETLDDYDEYCHYVAGLVGL  178



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+GA+L+HPDD YPL+KLK+AAR  EKQIPP+P WGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSVGAILRHPDDFYPLLKLKMAARNAEKQIPPEPRWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFH+HIY+ EWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIDFHKHIYNPEWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKSYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG++ A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTVRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQ+AIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITLRMGAGMAKFICKE  158



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M +LGA+LKHPDD+YPLIKLK+A  Q EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRTLGAILKHPDDLYPLIKLKVAVMQAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDA+C+FYLVLRALDTVEDDT+IATEVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTNIATEVKVPILMAFHRHIYDREWHFACGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELG +YQ+ IEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGSSYQKVIEDITMRMGAGMAKFICKE  158



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGKNYQEAIEDIT RMGAGMA+FICKE
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKRMGAGMAEFICKE  158


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVG+
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAEFICKEVETVDDYDEYCHYVAGLVGM  178



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG L A+LKHP+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVI+QLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIKQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+Y+EAIEDITMRMGAGMAKFI KE
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMRMGAGMAKFIYKE  158



>gb|KDO43896.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=294

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEXRN  595
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE  +
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKEVES  161



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YP++KLK+A R  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPMVKLKLAVRSAEKQIPAEPHWAFCYSMLHKVSRSFGLVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSIATEVKVPIL+DFHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIATEVKVPILMDFHRHIYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG+ YQEAIEDITM+MGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMKMGAGMAKFICKE  158



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKE  158



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP P+WGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPNWGFCYSMLHKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K+YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMRMGAGMAKFICKE  158



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKE  158



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKE  158



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKE  158



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHVVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+ HW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPELHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q HHVSTAFLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHV+TAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHV+TAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIA +VKVPIL+ FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIAADVKVPILLAFHRHIYDPDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EK+IPPQPHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARNAEKRIPPQPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQEAI+DIT RMGAGMAKFIC+E
Sbjct  121  QFHHVSTAFLELGKSYQEAIDDITKRMGAGMAKFICQE  158



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LKHPDD+YP++KLK+A R  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLRAILKHPDDLYPMVKLKLAVRNAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAV IFYLVLRALDTVEDDTSI+ EVKVPIL  FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVRIFYLVLRALDTVEDDTSISAEVKVPILKAFHRHIYDREWHFACGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGKNYQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  +  +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQDAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VS AFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHDVSAAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  Y++AIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMRMGAGMAKFICKE  158



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGKNYQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKRMGAGMAKFICKE  158



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  Y++AIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMRMGAGMAKFICKE  158



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+A+C+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD  WHF CGTK+YKVLMD
Sbjct  61   ELRNAICLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPNWHFACGTKNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFILKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG L A+LKHP+D+YPL+KLK+AA+  EKQIP QPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAAQYAEKQIPSQPHWAFCYIMLHKVSRSFSLVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK Y+EAIEDITMRMGAGMAKFI KE
Sbjct  121  QFHHVSTAFLELGKQYKEAIEDITMRMGAGMAKFIYKE  158



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPSEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKRMGAGMAKFICKE  158



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMRMGAGMAKFICKE  158



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L+HPDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLAP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+A+CIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  MLKHPDD+YPL+KLKIA+RQI+KQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIKKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSIAT+VKVPIL+ FHRHIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSIATDVKVPILLAFHRHIYDPEWHFACGTNNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFIMKE  158


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFIMKEVETIDDYDEYCHYVAGLVGL  178



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMRMGAGMAKFICKE  158



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLDA  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  +QEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGFQEAIEDITMRMGAGMAKFICKE  158



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKRMGAGMAKFICKE  158



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   288 bits (736),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L+HPDDVYPLIKLK+AAR  EK+IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALLRHPDDVYPLIKLKMAARNAEKRIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDT+EDDTSI T+VKVPIL +F+RH+Y+ +WHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTIEDDTSIPTDVKVPILKEFYRHMYNPKWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG+ YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMRMGAGMAKFICKE  158



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   288 bits (737),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKRMGAGMAKFICKE  158



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL   YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMRMGAGMAKFICKE  158



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL   YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMRMGAGMAKFICKE  158



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   287 bits (735),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD+YPL+KLK+AAR  EKQIP +PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVKHPDDLYPLLKLKMAARHAEKQIPSEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL  FHRHIYDR+WHF CGTK+YKVLM 
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATEVKVPILKAFHRHIYDRDWHFSCGTKEYKVLMG  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VSTAFLEL KNYQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHLVSTAFLELAKNYQEAIEDITDRMGAGMAKFICKE  158



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNSSWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKE  158



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG+ YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD+YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIY+++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYEKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHH+S AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHLSNAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD +WHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPDWHFACGTNNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG  YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  EFHHVSTAFLELGTGYQEAIEDITKRMGAGMAKFILKE  158



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+ HWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPESHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL  FHRHIYD  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILKAFHRHIYDNNWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELG  Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLELGSGYKEAIEDITMRMGAGMAKFICKE  158



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AA+  EKQIP QPHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKHAEKQIPAQPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYD EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDPEWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q HH+STAFLELGK+YQEAIEDIT +MGAGMAKFICKE
Sbjct  121  QIHHLSTAFLELGKSYQEAIEDITKKMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKSYQEAIEDITKKMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SLGA+LK+PDD +PL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MASLGAILKNPDDFFPLLKLKMAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIDTDVKVPILKAFHRHIYDHDWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKDYQDAIEDITKRMGAGMAKFICKE  158


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  +  +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKDYQDAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             FHHVS AFLELGK YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  GFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICKE  158



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   285 bits (729),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F +LG   ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLDLGSGYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFICKE  158


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F +LG   ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLDLGSGYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   285 bits (728),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTS+AT+VKVPIL+ FH HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVATDVKVPILLAFHEHIYDPEWHFACGTNNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKRMGAGMAKFILKE  158


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITKRMGAGMAKFILKEVETIDDYDEYCHYVAGLVGL  178



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD + HF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDRHFGCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGKNYQ+AIED+T RMGAGMAKFICKE
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDLTKRMGAGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  +  +  L      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKNYQDAIEDLTKRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   284 bits (727),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 2/160 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFAL IQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALAIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHF--LCGTKDYKVL  466
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF  L GTK+YKVL
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSLLGGTKEYKVL  120

Query  467  MDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            MDQFHHVSTAFLELGK+YQ+AI+DIT+RMGAGMAKFICKE
Sbjct  121  MDQFHHVSTAFLELGKHYQQAIQDITLRMGAGMAKFICKE  160



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPSEPHWAFCYTMLQKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPIL+ FH+HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILLAFHQHIYDPEWHFACGTNNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG  YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  EFHHVSTAFLELGNGYQEAIEDITKRMGAGMAKFILKE  158



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SL A+ +HPDD+YP++KLK+AAR+ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLQAIWRHPDDLYPMVKLKLAARRAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+ EVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSISMEVKVPILMAFHRHIYDREWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG  YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKLAEKQIPPQPHWAFCYSMLHKVSRSFCLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELGK YQEAIEDITMRMGAGMAKFIC+E
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMRMGAGMAKFICQE  158



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGM+KFICKE
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMSKFICKE  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F +LG   ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLDLGSGYKEAIEDITMRMGAGMSKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+ HIYDR+WHF CGTK++KVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYHHIYDRDWHFSCGTKEFKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAK+ICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKYICKE  158



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKFICKE  158



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SL A+LKHPDD+YP++KLK+AAR+ EKQI  +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLRAILKHPDDLYPMVKLKLAARKAEKQIRSEPHWAFCYSMLLKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTS+AT+VKVPIL+DFH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSVATDVKVPILMDFHQHIYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELG  YQ+AIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGSGYQQAIEDITMRMGAGMAKFICKE  158



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHH STAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG +LKHPDD+YPL KLK+AAR + KQIPP+PHWGFCY ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTVLKHPDDIYPLFKLKMAARNVGKQIPPEPHWGFCYKMLHKVSRSFSLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSIA+++KVPIL +FH+HIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIASDIKVPILKNFHQHIYDGDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VSTAFLELG++YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHLVSTAFLELGRSYQEAIEDITKRMGAGMAKFICKE  158



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLRMGAGMAKFICKE  158



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQ+AIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLRMGAGMAKFICKE  158



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQ+AIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLRMGAGMAKFICKE  158



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+ GA+LKHPDD YP++KL +A +   KQIPPQPHW FCYTML KVSRSFALVIQQL +
Sbjct  1    MGTFGAILKHPDDFYPIMKLAMAMKSAAKQIPPQPHWAFCYTMLHKVSRSFALVIQQLDV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRDAVC+FYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTKDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRALDTVEDDTSIPTDVKVPILNSFHRHIYDCEWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLELGK YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITRRMGAGMAKFICKE  158


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIEDITRRMGAGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHH STAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIESITKRMGAGMAKFICNE  158



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNE  158



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNE  158



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M +LGA+LKHP+D+YP++KLK+AARQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVNLGAILKHPEDLYPMVKLKLAARQAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSIA+EVKVPIL  FHRHIY+ EWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIASEVKVPILKAFHRHIYNSEWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFLELGK YQEAIE+ITMRMG GMAKFICKE
Sbjct  121  EFHHVSVAFLELGKGYQEAIENITMRMGEGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +     +G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKGYQEAIENITMRMGEGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKGMGAGMAKFICNE  158



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+A R  EKQIP +PHWGF Y+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAVLKHPDDFYPLLKLKLAVRHAEKQIPHEPHWGFSYSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTS+ T+VKVPIL  FHRHIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSVPTDVKVPILKAFHRHIYDREWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL K YQEAIEDIT RMG GMAKFICKE
Sbjct  121  QFHHVSTAFLELDKGYQEAIEDITQRMGVGMAKFICKE  158



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M +LGA+L+HPD+ YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRNLGAILRHPDEFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHH+S AFLEL K YQ AIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHLSAAFLELEKGYQNAIEDITRRMGAGMAKFICKE  158



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFL+LG +Y+EAIEDITMRMGAGMAKFICKE
Sbjct  121  EFHHVSNAFLDLGSSYKEAIEDITMRMGAGMAKFICKE  158


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F +LG   ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLDLGSSYKEAIEDITMRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+ KHPDD+YPL+KLK+A +  EKQIPPQPHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIFKHPDDLYPLLKLKMAMKHAEKQIPPQPHWGFCYTMLHKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVC+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR+WHF CGTKDYKVLMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIATDVKVPILIAFHHHLYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             FHHVSTAF ELGK +QEAIE+IT RMGAGMAKFI KE
Sbjct  121  LFHHVSTAFSELGKGHQEAIEEITKRMGAGMAKFISKE  158


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G     ++  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FSELGKGHQEAIEEITKRMGAGMAKFISKEVETIDDYDEYCHYVAGLVGL  178



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS GA+L+HPDD YPL+KLK+AAR  EKQIP +PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAILRHPDDFYPLLKLKMAARNAEKQIPQEPHWGFCYTMLHKVSRSFALVIQQLQP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI T++KVPILI+FHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIETDIKVPILINFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQEAI D+T RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELEKGYQEAIGDVTNRMGAGMAKFICKE  158



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PH  FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHRAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT RMGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKRMGAGMAKFICNE  158



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   280 bits (715),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLK+AA+  EK IP  PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKNAEKHIPALPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDA+CIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKV MD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHVYDREWHFPCGTKEYKVPMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK+YQ+ IEDI  RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKSYQDVIEDIAKRMGAGMAKFICKE  158



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPD+VYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDEVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VK PILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKEPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL KNYQ AIE+IT  MGAGMAKFIC E
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKEMGAGMAKFICNE  158



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   280 bits (715),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKE  158



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHP D+YPL+KLK+AA+  EKQIPP+PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPPEPHWAFCYSMLHRVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH+VS AFLELGK Y EAIEDIT RMGAGMAKFI KE
Sbjct  121  QFHNVSNAFLELGKGYHEAIEDITKRMGAGMAKFILKE  158



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPGEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTA LEL KNYQ AIE+IT  MGAGMAKFIC E
Sbjct  121  QFHHVSTALLELEKNYQAAIENITKGMGAGMAKFICNE  158



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRA DTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRAFDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVS AFL+LG  Y+EAIEDITMRMGAGMAKF+CKE
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMRMGAGMAKFLCKE  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F +LG   ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLDLGSGYKEAIEDITMRMGAGMAKFLCKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGK+YQEAIEDIT RMG GMA FICKE
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKRMGVGMANFICKE  158


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +3

Query  492  LLFWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            + F  LGK  ++ +  +      G  +   +  ETIDDYDEYCHYVAGLVGL
Sbjct  127  MAFLELGKSYQEAIEDITKRMGVGMANFICKEVETIDDYDEYCHYVAGLVGL  178



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   277 bits (708),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  116  GSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE  295
             SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  +
Sbjct  1    SSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNPQ  60

Query  296  LRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQ  475
            LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMDQ
Sbjct  61   LRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMDQ  120

Query  476  FHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            FHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  FHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKE  157



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   277 bits (708),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELGK+YQEAIEDIT RMG GMA FICKE
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKRMGVGMANFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +3

Query  492  LLFWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            + F  LGK  ++ +  +      G  +   +  ETIDDYDEYCHYVAGLVGL
Sbjct  127  MAFLELGKSYQEAIEDITKRMGVGMANFICKEVETIDDYDEYCHYVAGLVGL  178



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHP D+YPL+KLK+AA+   KQIP +PHW FCY+ML +VSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPADLYPLLKLKMAAKHAAKQIPSEPHWAFCYSMLHRVSRSFAFVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR WHF CGT DY+VLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRNWHFSCGTNDYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VSTAFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHDVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++++PDD YPL KLK+AAR  EKQIP +PHW FC++ML KVSRSFA VIQQL  
Sbjct  1    MGSLGALVRNPDDFYPLFKLKMAARHAEKQIPSEPHWAFCFSMLLKVSRSFAFVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   KLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQ AIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELEKGYQVAIEDITKRMGAGMAKFICKE  158



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL A+LKHPDD +PL+KLK+AA + EKQIP +PHW F Y+ML KVSR+FALVIQQL  
Sbjct  1    MGSLKAVLKHPDDFFPLLKLKMAANKAEKQIPSEPHWAFSYSMLHKVSRNFALVIQQLNP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHQHIYNRDWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL + YQEAIEDITMRMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMRMGAGMAKFICKE  158



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHP D YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPGDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILEEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDPDWHFSCGTKNYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLEL + YQEAI DITMRM AGMAKFICKE
Sbjct  121  QFHHVSTAFLELKRGYQEAIGDITMRMSAGMAKFICKE  158



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  137  KHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCI  316
            +  D+ YPL+KLKI AR  EKQIPP+PHW FCYTML KVSRSFALVIQQL IELR+AVCI
Sbjct  4    RSEDEFYPLLKLKIVARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGIELRNAVCI  63

Query  317  FYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTA  496
            FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLM QFHHVSTA
Sbjct  64   FYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMGQFHHVSTA  123

Query  497  FLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            FLELGKNYQEAIEDIT RMGAGMAKFICKE
Sbjct  124  FLELGKNYQEAIEDITKRMGAGMAKFICKE  153


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  124  FLELGKNYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  173



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  110  KMGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLP  289
            KMGSLGA+LKHP D+YPL+KLK+AA+  EKQIP +PHW FCY+ML +VSRSFALVIQQL 
Sbjct  63   KMGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPREPHWAFCYSMLPRVSRSFALVIQQLD  122

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTK+YKVLM
Sbjct  123  TELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKEYKVLM  182

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            DQFH+VS AFLELGK YQEAIEDIT RMGAGMAKFI KE
Sbjct  183  DQFHNVSNAFLELGKGYQEAIEDITKRMGAGMAKFILKE  221



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LK+PD+ YPL+KLK+A ++ EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKYPDEFYPLLKLKMAIKEAEKQIPQEHHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSIATEVKVPIL  FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIATEVKVPILRAFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL + YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELDRGYQEAIEDITKRMGAGMAKFICKE  158



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K   EAIEDIT+RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGL-EAIEDITLRMGAGMAKFICKE  157



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   271 bits (694),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIYD +WH+ CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQE  158



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPD+ YPL+KLK+A ++ EKQIPP+ HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDEFYPLLKLKMAVKEAEKQIPPEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI  +VK+PIL +FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIDNDVKLPILRNFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL + YQ AIEDIT RMGAGMAKFICKE
Sbjct  121  EFHHVSTAFLELDRGYQLAIEDITKRMGAGMAKFICKE  158



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTNEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRRMGAGMAKFICQE  158



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PIL  FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILKAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SLG +L++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MASLGTILRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQE  158



>gb|EPS74249.1| hypothetical protein M569_00507, partial [Genlisea aurea]
Length=292

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG++GA+L+HP+D  P++KLK+A ++ EKQIP +P W FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGTVGAILRHPNDFIPMLKLKMAMKKAEKQIPEEPQWRFCYSMLHRVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDA+C+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR WHF CGTKDYK+LMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTSIATDVKVPILISFHSHLYDRGWHFSCGTKDYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+V TAF ELG++YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  EFHNVQTAFSELGRSYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG ML++PDD++PL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIFPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FH+HIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHQHIYNTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  158



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LGA+++HP+D+YPL+KLK+AA +I++QIP +PHW F Y MLQKVSRSFALVIQQL +
Sbjct  1    MGMLGAIMEHPEDLYPLVKLKMAADRIKRQIPGEPHWAFSYAMLQKVSRSFALVIQQLGL  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDCDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQ AIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGPSYQVAIEDITKRMGAGMAKFICKE  158



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG + A+L HP D+Y L+KLK+AA +IE+QIP +PHW F YTMLQKVSRSFA+VIQQL  
Sbjct  1    MGMMAAVLDHPGDLYVLVKLKMAASRIERQIPAEPHWAFAYTMLQKVSRSFAIVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLEL K YQEAIE+IT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELDKGYQEAIEEITKRMGAGMAKFICKE  158



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +++HPD++YPL+KLKIA  + + QIP +PH  FCY+MLQKVS+SF+LVIQQL  
Sbjct  1    MGSLSTIVRHPDEIYPLLKLKIAITKAQNQIPLEPHLAFCYSMLQKVSKSFSLVIQQLAT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILI FHRHI+DR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPVEIKVPILIAFHRHIFDRNWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKF+CKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFVCKE  158



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPD++YPL+KLK+ AR  EKQ+P QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDELYPLLKLKMKARNAEKQLPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCI YLVLRALDTVEDDTSI  +VKVPIL  F +H++D+EWHF CGTK+ KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPVDVKVPILKAFLQHVFDKEWHFSCGTKECKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQE IE+IT RMGAGMAKFICKE
Sbjct  121  QFHHVSTAFLELGKRYQEVIEEITKRMGAGMAKFICKE  158



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKRMGAGMAKFICKE  158



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q HHVS AFLEL K YQEAIE+IT RMGAGMAKFIC E
Sbjct  121  QLHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICHE  158



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  182  ARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDT  361
            AR  EKQIPP+PHWGFCY ML KVSRSFALVIQQLP+ELRDAVCIFYLVLRALDTVEDDT
Sbjct  1    ARHAEKQIPPEPHWGFCYLMLHKVSRSFALVIQQLPVELRDAVCIFYLVLRALDTVEDDT  60

Query  362  SIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDI  541
            SI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMDQFHHVSTAFLELGK+YQ+AIEDI
Sbjct  61   SIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMDQFHHVSTAFLELGKHYQQAIEDI  120

Query  542  TMRMGAGMAKFICKE  586
            TMRMGAGMAKFICKE
Sbjct  121  TMRMGAGMAKFICKE  135



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELG +YQ+AIEDIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKRMGAGMAKFICKE  158



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG L AM+ HPD+VYP++KLK+A+ +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLAAMVTHPDEVYPMVKLKLASDRIRRQIPAEPHWSFSYSMLQKVSRSFALVIQQLEP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVC+FYLVLRALDTVEDDTSI +++KVPIL +F+ HIYDR+WHF CG KDYK+LMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYLHIYDRKWHFSCGAKDYKILMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH VSTAFLEL K+YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  KFHLVSTAFLELDKSYQEAIEDITRRMGAGMAKFICKE  158



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +G +++HP+++YPLIKL + A+  EKQIP +P+W FCY ML+ +SRSF+LVIQQLP+
Sbjct  1    MGIIGDIVRHPNEIYPLIKLLVTAKLAEKQIPSKPNWSFCYLMLRNISRSFSLVIQQLPL  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EWHF CGT  YK LMD
Sbjct  61   ELRDAVCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEWHFSCGTDAYKDLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLELG NYQ+ IEDITMRMG GMAKFI  E
Sbjct  121  QFHHVSMAFLELGTNYQQVIEDITMRMGEGMAKFISTE  158



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+  E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVEMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIED+T RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDVTKRMGAGMAKFICKE  158



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCYTML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYTMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMG GMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGEGMAKFICKE  158



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTSI  E KVPILI FHRH+YD  WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPMETKVPILIAFHRHLYDGGWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +GA+L+HP+D+  L+KLK+A R+IEKQIPP+PHWGF YTMLQ+VSRSFA+VIQQL  
Sbjct  1    MGVVGAILEHPEDLVALLKLKVAVRKIEKQIPPEPHWGFSYTMLQRVSRSFAIVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLR LDT+EDDTSI T+ K+PIL  FH+HIYD +WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRGLDTIEDDTSIPTDTKLPILNSFHQHIYDPDWHFSCGVKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             FH+VS AFLEL K+Y++AIEDIT RMGAGMAKFICKE
Sbjct  121  NFHYVSNAFLELDKSYKDAIEDITKRMGAGMAKFICKE  158



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 6/158 (4%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR      GTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDR------GTKNYKVLMD  114

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVSTAFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  115  EFHHVSTAFLELEKGYQEAIEDITKRMGAGMAKFICKE  152



>gb|AEX26931.1| squalene synthase 1-3 [Solanum tuberosum]
Length=136

 Score =   249 bits (636),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+LK PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKTPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNY  520
            QFHHVSTAFLELGK Y
Sbjct  121  QFHHVSTAFLELGKLY  136



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMGAGMA FICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMATFICKE  158



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 139/167 (83%), Gaps = 9/167 (5%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC---------G  445
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C         G
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKFYSIQTLGG  120

Query  446  TKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            TK+YKVLMDQFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  TKEYKVLMDQFHHVSAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  167



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +GAM+++P +   L+KLK+AA +I +QIPP+ HW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MGMMGAMVENPGEAVALVKLKVAAARIARQIPPEEHWAFAYTMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLRALDTVEDDTSI  +VKVPIL  FH HIYDR+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPADVKVPILQAFHCHIYDRDWHFSCGAKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH+VSTAFLELGK YQEAI+DIT RMGAGMAKFICKE
Sbjct  121  KFHYVSTAFLELGKGYQEAIDDITRRMGAGMAKFICKE  158


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 34/63 (54%), Gaps = 5/63 (8%)
 Frame = +3

Query  459  KFSWTSSIMFLLLFWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGL  638
            KF + S+      F  LGK  ++ +  +      G      +  ET+DDYDEYCHYVAGL
Sbjct  121  KFHYVSTA-----FLELGKGYQEAIDDITRRMGAGMAKFICKEVETVDDYDEYCHYVAGL  175

Query  639  VGL  647
            VGL
Sbjct  176  VGL  178



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFICKE  158



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +   L HP+D+Y L+K+K AA Q+EKQIPP PHW FCYTMLQKVSRSFA VIQQL  
Sbjct  1    MGMMKEALMHPEDLYVLVKMKRAAAQVEKQIPPDPHWAFCYTMLQKVSRSFAFVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI  ++K+PIL  FHRHIY+ +WHF CGTKDYKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPEDIKLPILESFHRHIYNPDWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             F ++STAFLELGK+YQE IEDIT RMG GMAKFICKE
Sbjct  121  NFRNISTAFLELGKSYQEGIEDITERMGKGMAKFICKE  158


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +     +G      +  ET+DDYDEYCHYVAGLVGL
Sbjct  129  FLELGKSYQEGIEDITERMGKGMAKFICKEVETVDDYDEYCHYVAGLVGL  178



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFL+L K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFL+L K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKRMGAGMAKFICKE  158



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG ++ +P++VYPL+KLK+AA +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLGTVVAYPEEVYPLVKLKLAADRIRRQIPAEPHWAFSYSMLQKVSRSFALVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI +++KVPIL +F+RHIYD EWHF CGTKDYKVLMD
Sbjct  61   QLRNAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYRHIYDCEWHFSCGTKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            + H VSTAFLEL ++YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  KLHLVSTAFLELERSYQEAIEDITKRMGAGMAKFICKE  158



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  289
            MGSL  +L HPD++YPL KL IA  + + QIP  +PH  FCY+ML KVS+SF+LVIQQL 
Sbjct  1    MGSLSTILSHPDEIYPLFKLVIAITKAKNQIPFHEPHLAFCYSMLHKVSKSFSLVIQQLG  60

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILIDFHRH+YDR+WHF CGTKDYKVLM
Sbjct  61   TELRNAVCLFYLILRALDTVEDDTSIPIEIKVPILIDFHRHMYDRDWHFSCGTKDYKVLM  120

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +QFHHVS AFLEL K YQEAIEDIT RMGAGMAKFICKE
Sbjct  121  NQFHHVSAAFLELDKGYQEAIEDITKRMGAGMAKFICKE  159



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG + A+L+HP+D+ PL K+ + A QI++QIPP+PHWGF Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMVKAVLEHPEDLIPLTKMMMTAEQIKRQIPPEPHWGFAYSMLQKVSRSFALVIQQLDA  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLRALDTVEDDTSI  ++KVPIL++FH+HIYDR+WHF CGT  YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPVDIKVPILLEFHKHIYDRDWHFSCGTNAYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FH +S AFLELGK+YQEAIED+T+RMGAGMAKF+ KE
Sbjct  121  KFHFISIAFLELGKSYQEAIEDVTLRMGAGMAKFMFKE  158



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M SLGA++KHPD+ YPL+KLK+A  + EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLGAIMKHPDEFYPLLKLKMAVNKAEKQIPSEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTS+A +VK+PIL  FH HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSLADDVKIPILRAFHEHIYDRDWHFSCGTKHYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +F++V TAFLEL + YQ AIEDIT RMGAGMAKF+CKE
Sbjct  121  EFNYVRTAFLELDRGYQVAIEDITKRMGAGMAKFVCKE  158



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 140/174 (80%), Gaps = 16/174 (9%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC----------  442
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKSEESFNLFD  120

Query  443  ------GTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
                  GTK+YKVLMDQFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  121  LSHPFGGTKEYKVLMDQFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  174



>ref|XP_009591242.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=282

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +G +++HPD+VYPL+KL +AA+ IEK  P QPHW FC T L KVSRSFAL+IQQLP 
Sbjct  1    MGMMGKIMRHPDEVYPLMKLMLAAKLIEKGTPLQPHWAFCNTTLHKVSRSFALLIQQLPT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC++YLVLR LDTVEDDTS+ATEV+VPIL + + H YDREWHF CGTK +KVLMD
Sbjct  61   DLRNAVCVYYLVLRVLDTVEDDTSLATEVRVPILRNVYCHFYDREWHFSCGTKAFKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFH VSTAFLEL KNYQE I+DIT RMG GMAKF+CKE
Sbjct  121  QFHDVSTAFLELDKNYQEVIKDITKRMGEGMAKFLCKE  158



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  289
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIIKAQNQIPLDDPHLALCYSLLQKVSRSFSLVIQQLG  60

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF+CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRDWHFICGTEEYKVLM  120

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            DQFHHVS AFLEL K YQEAIEDIT RMGAGMAKFI +E
Sbjct  121  DQFHHVSAAFLELEKGYQEAIEDITKRMGAGMAKFISRE  159



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG +LKHPD++Y L+KLK+ AR  EKQIP QPHW F Y+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGVILKHPDELYHLLKLKMEARNAEKQIPQQPHWRFGYSMLRKFSKTFAFVIEQLPT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCI YLVLRALDTVEDDTSI  EVKVPIL  F  H++D+EWH  CGTK  KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPIEVKVPILKAFLEHVFDKEWHLSCGTKKCKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQE IEDIT RMG GMAKFICKE
Sbjct  121  QFHHVSTAFLELGKRYQEVIEDITKRMGVGMAKFICKE  158



>gb|ACI14294.1| squalene synthase [Linum usitatissimum]
Length=271

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +2

Query  194  EKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIAT  373
            EKQIPP PHWGFCYTML KVSRSFALVIQQL  ELRDAVCIFYLVLRALDTVEDDTSIAT
Sbjct  2    EKQIPPHPHWGFCYTMLLKVSRSFALVIQQLGTELRDAVCIFYLVLRALDTVEDDTSIAT  61

Query  374  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRM  553
            EVKVPIL DFHRHIYD+EWHF CGTKDYKVLMD+FHHVSTAFLELG+ YQEAIEDIT RM
Sbjct  62   EVKVPILNDFHRHIYDQEWHFSCGTKDYKVLMDEFHHVSTAFLELGRGYQEAIEDITKRM  121

Query  554  GAGMAKFICKEXRN  595
            G GMAKFI KE  +
Sbjct  122  GDGMAKFILKEVES  135



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG++LKHP D+  L+KLK A+   EKQ+PP+PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGKLGSLLKHPADLPALVKLKFASLYAEKQVPPEPHWAFCYTMLQKVSRSFALVIQQLEP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLR LDTVEDDTSI  +VK+PIL  FHRHIYD  WHF CGT  YK+LMD
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPADVKLPILESFHRHIYDVNWHFSCGTNHYKMLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             F HV+++FLELG+ YQEAIEDIT  MGAGMAKFICKE
Sbjct  121  HFQHVASSFLELGRRYQEAIEDITKGMGAGMAKFICKE  158


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LG+  ++ +  +  G   G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  129  FLELGRRYQEAIEDITKGMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  178



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KVS++F+L+IQQL  
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVSKTFSLIIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPILI FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCLFYLILRALDTVEDDTSIPTEIKVPILIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQE IEDIT RMGAGMAKFI KE
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKRMGAGMAKFISKE  158



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  289
            MGSL  +L+HPD++YPL++LK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLRLKLAIMKAQNQIPLDDPHLAVCYSLLQKVSRSFSLVIQQLG  60

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF CGTK+YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPIEIKVPILLAFHRHIYDRDWHFTCGTKEYKVLM  120

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            DQFHHVS AFLEL + YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKRMGAGMAKFISKE  159



>emb|CDY45323.1| BnaA03g52960D [Brassica napus]
Length=218

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSL  +L HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KV ++F+L+IQQL  
Sbjct  1    MGSLSTILIHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVFKTFSLIIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPI I FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCVFYLILRALDTVEDDTSIPTEIKVPIRIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQE IEDIT RMGAGMAKFI KE
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKRMGAGMAKFISKE  158



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  301
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQLP +LR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFGYSMLQKVSRSFALVIQQLPPQLR  59

Query  302  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  481
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WHF CGT  Y+VLMD FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHFSCGTNHYRVLMDNFH  119

Query  482  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            HVSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKE
Sbjct  120  HVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKE  154



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  289
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIMKAQNQIPLDDPHLAICYSLLQKVSRSFSLVIQQLG  60

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR WHF CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRGWHFTCGTEEYKVLM  120

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            DQFHHVS AFLEL + YQEAIEDIT RMGAGMAKFI KE
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKRMGAGMAKFISKE  159



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V PL+KL++AA ++++QIPP+ HW F YTMLQKVSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRLKRQIPPEEHWAFAYTMLQKVSRSFALVIQQLGPDLRNA  61

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VCIFYLVLRALDTVEDDTSI TEVKVPIL  FH+HIY+R+WH+ CGTKDYKVLMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPTEVKVPILQQFHKHIYNRDWHYSCGTKDYKVLMDKFRLV  121

Query  488  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKE
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKE  154



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  301
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  302  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  481
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  482  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             VSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKE
Sbjct  120  LVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKE  154



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  301
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  302  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  481
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WH+ CGT  YK+LMD+F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHYSCGTNHYKMLMDKFR  119

Query  482  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            HVSTAFLELG+ YQ+AIE++T RMGAGMAKFICKE
Sbjct  120  HVSTAFLELGEGYQKAIEEVTRRMGAGMAKFICKE  154



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  301
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  302  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  481
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  482  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             VSTAFLELG+ YQ+AIE+IT RMGAGMAKFICKE
Sbjct  120  LVSTAFLELGQGYQKAIEEITRRMGAGMAKFICKE  154



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLGA+LKHPD+      LK+ AR  EK IP QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDE------LKMEARNAEKLIPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  54

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVCI YLVLRALDTVEDDTSI   VKVPIL  F +H++D+EWH  CG+K+ KVLMD
Sbjct  55   ELRDAVCILYLVLRALDTVEDDTSIPVAVKVPILKAFLQHVFDKEWHLSCGSKECKVLMD  114

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFLELGK YQE IEDIT RMGAGMAKFICKE
Sbjct  115  QFHHVSTAFLELGKRYQEVIEDITKRMGAGMAKFICKE  152



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  488  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKE
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKE  154



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  488  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            STAFLELG+ YQEAIE+IT  MGAGMAKFICKE
Sbjct  122  STAFLELGQGYQEAIEEITRLMGAGMAKFICKE  154



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  176  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVED  355
            +A R  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  +LR+AVCIFYLVLRALDTVED
Sbjct  1    MAVRHAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGTDLRNAVCIFYLVLRALDTVED  60

Query  356  DTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIE  535
            DTSI  +VKVPILI F  H+YDR WHF CGTK+YKVLMDQFH VSTAFLELGK YQEAIE
Sbjct  61   DTSIPADVKVPILIAFRHHVYDRNWHFSCGTKEYKVLMDQFHLVSTAFLELGKGYQEAIE  120

Query  536  DITMRMGAGMAKFICKE  586
            DIT RMGAGMAKFICKE
Sbjct  121  DITKRMGAGMAKFICKE  137


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  498  FWNLGKIIRKQLRILP*GWVQGWQSLYARRXETIDDYDEYCHYVAGLVGL  647
            F  LGK  ++ +  +      G      +  ETIDDYDEYCHYVAGLVGL
Sbjct  108  FLELGKGYQEAIEDITKRMGAGMAKFICKEVETIDDYDEYCHYVAGLVGL  157



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 11/158 (7%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQE  147



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 11/158 (7%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTNEYKVLMD  109

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVS AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKRMGAGMAKFICQE  147



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 11/158 (7%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHV+ AFLEL K YQEAIE+IT RMGAGMAKFIC+E
Sbjct  110  QFHHVAAAFLELEKGYQEAIEEITKRMGAGMAKFICQE  147



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            M S+GA+LKHP+DV  L+K+K AA    KQIP  P   FCYTMLQKVSRSFA VIQQL +
Sbjct  1    MASIGAILKHPEDVPALLKMKFAAAHASKQIPLDPDLAFCYTMLQKVSRSFAFVIQQLGL  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLR LDTVEDD SI  + K+PIL +FH+HIYD  WHF CG  DYK LMD
Sbjct  61   ELRNAVCVFYLVLRGLDTVEDDMSIPVDTKLPILTNFHQHIYDPSWHFSCGVNDYKELMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVSTAFL LGK YQE IE+IT RMGAGMAKFI +E
Sbjct  121  QFHHVSTAFLALGKRYQEGIEEITKRMGAGMAKFIRQE  158



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+GA+LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIGALLKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG   YK LM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILKAFYKHIYDPSWHFSCGVNHYKELME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVST FL LG+ YQEAIE+IT +MGAGMAKFICKE
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKKMGAGMAKFICKE  158



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQLPI  292
            +G ++KHPD++YPL+KL ++A+++EK+      QPHW FCY +L+KVSRSFALVIQQLP 
Sbjct  1    MGEIMKHPDELYPLMKLMLSAKRVEKKTSVWLLQPHWAFCYAILRKVSRSFALVIQQLPS  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRD VC++YLVLRALDTVEDDTS+ TEV+VPIL DF+ H++D EWHF C T  +KVLMD
Sbjct  61   DLRDVVCVYYLVLRALDTVEDDTSLTTEVRVPILKDFYSHLHDPEWHFSCDTIAFKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVST+ LEL  +YQE I+DIT RMG GMAKF+CKE
Sbjct  121  QFHHVSTSLLELDTDYQEVIKDITKRMGEGMAKFLCKE  158



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  283
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  284  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  463
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  464  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKE
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKE  161



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  283
            M  +  +L HPD++YPL+KL + A+++EK+      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MELMQEILMHPDELYPLVKLMLTAKRVEKKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  284  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  463
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +WHF CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWHFSCGTKAFKV  120

Query  464  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKE
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKE  161



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  283
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  284  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  463
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  464  LMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            LMDQFHHVSTAFLEL  NYQE I+DIT RMG GMAKF+CKE
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKRMGEGMAKFLCKE  161



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGS+  +LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIRTILKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG KDYK LM+
Sbjct  61   DLRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILEAFYKHIYDPSWHFSCGVKDYKELME  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +FHHVST FL LG+ YQEAIE+IT RMGAGMAKFIC E
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKRMGAGMAKFICSE  158



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V  L++LK+AA +I +QIPP+ HW F Y MLQ+VSRSFALVIQQL  ELR+A
Sbjct  2    GVLSRPEEVAALVRLKVAAGRIRRQIPPEAHWAFAYDMLQRVSRSFALVIQQLGPELRNA  61

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VC+FYLVLRALDTVEDDT I  EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  V
Sbjct  62   VCVFYLVLRALDTVEDDTGIPNEVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQV  121

Query  488  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            STAFLELG+ YQ+AIE+IT RMG GMAKFIC E
Sbjct  122  STAFLELGEGYQKAIEEITRRMGEGMAKFICME  154



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 125/158 (79%), Gaps = 10/158 (6%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSC----------  110

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +++    AFLEL K YQEAIE+IT RMGAGMAKFIC E
Sbjct  111  KWYQGIQAFLELEKGYQEAIEEITKRMGAGMAKFICHE  148



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +2

Query  122  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  301
            +GA L  P++V PL+K+  AA +I +QIPPQ HW F Y MLQKVSRSFALVIQQL  +LR
Sbjct  1    MGA-LSRPEEVAPLVKMAAAAWRIRRQIPPQEHWAFAYDMLQKVSRSFALVIQQLGPDLR  59

Query  302  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  481
            +AVCIFYLVLRALDTVEDDT + TEVK+PIL +F+RHIY+ +WHF CG   Y+VLMD F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTGVPTEVKLPILQEFYRHIYNPDWHFSCGRGHYRVLMDNFR  119

Query  482  HVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            HVS AFLEL + YQ AIE+IT RMGAGMA +ICKE
Sbjct  120  HVSIAFLELDQGYQNAIEEITRRMGAGMAIYICKE  154



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 130/162 (80%), Gaps = 6/162 (4%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP----QPHWGFCYTMLQKVSRSFALVIQ  280
            MG +GA+L    +   L++L+ AA ++ +++        HW F Y+ML +VSRSFA+VIQ
Sbjct  1    MGVVGALLG--PEAEALVRLRAAAWRLRREVAAATDDDEHWAFAYSMLHRVSRSFAIVIQ  58

Query  281  QLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  460
            QL  +LR+AVC+FYLVLRALDTVEDDTSI TE+KVPIL +FHRHIY+R+WHF CGTKD K
Sbjct  59   QLGPDLRNAVCVFYLVLRALDTVEDDTSIPTEIKVPILQEFHRHIYNRDWHFSCGTKDCK  118

Query  461  VLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +LMD+FH+V TAFLELG  YQEAIE+IT RMGAGMAKFICKE
Sbjct  119  ILMDKFHYVLTAFLELGSGYQEAIEEITRRMGAGMAKFICKE  160



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   209 bits (531),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  239  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  418
            ML KVSRSFALVIQQL  +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY
Sbjct  1    MLHKVSRSFALVIQQLDTKLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIY  60

Query  419  DREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +R+WHF CGTK YKVLMD+FHHVSTAFLEL K YQ AIEDIT RMGAGMAKFICKE
Sbjct  61   NRDWHFSCGTKHYKVLMDEFHHVSTAFLELEKGYQVAIEDITKRMGAGMAKFICKE  116



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG L  +L+HP++V  L+K+K  A +++ Q+P  PH  FCY MLQKVSRSFA+VIQQL  
Sbjct  1    MGVLTTVLQHPNEVPALLKMKFMASRLKWQLPSDPHRSFCYEMLQKVSRSFAVVIQQLGP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRDAVC+FYLVLR LDTVEDD SI  + KVPIL  FH  IYD  W F+CG KDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRGLDTVEDDMSIPLDTKVPILKAFHETIYDPAWRFVCGEKDYKVLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QFHHVST FL L K +Q+ I +IT RMG GMAKFI  E
Sbjct  121  QFHHVSTTFLNLDKKFQDVIAEITQRMGNGMAKFIVTE  158



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQ-PHWGFCYTMLQKVSRSFALVIQQLP  289
            MG L  +L+HP+++  L+KL+IAA  +   +P       FCY MLQ+VSRSFALVIQQL 
Sbjct  1    MGLLKGVLEHPEEIPALVKLRIAAATLRLHVPAHDADLSFCYLMLQRVSRSFALVIQQLG  60

Query  290  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  469
             ELRDA+CIFYLVLRALDTVEDD SI+ + K+P+L  FH++I+D  WHF CG +DYKVLM
Sbjct  61   TELRDAICIFYLVLRALDTVEDDMSISVDTKLPVLKSFHKNIHDPTWHFPCGERDYKVLM  120

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            D+FHHVS AFL+L K YQ AIED   +MG GMAKFICKE
Sbjct  121  DEFHHVSMAFLKLHKRYQVAIEDAANKMGHGMAKFICKE  159



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +G ++KHPD++ PLIKLKIAA + +K IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGIIGTLVKHPDEIPPLIKLKIAAHRAQKAIPKDPNLAFCYRMLTRVSRSFSIVIQQLSP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYLVLR LDTVEDD +I  ++KVPIL  FH+HIYD  W F CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTVEDDMAIPIDIKVPILKAFHKHIYDPSWKFSCGEKDYKELMN  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +F  VS AFL L + YQ+ I ++T RMG GMAKFI  E
Sbjct  121  KFELVSNAFLNLEEGYQKVIAEMTERMGNGMAKFIESE  158



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = +2

Query  161  LIKLKIAARQIEKQIPPQP---HWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVL  331
            L+KL++AA +++ QIPPQ    HW F Y MLQKVSRSFA VIQQL  +LR+AVCIFYL+L
Sbjct  10   LVKLRVAAGRVKLQIPPQEEEEHWAFAYDMLQKVSRSFAFVIQQLGPDLRNAVCIFYLLL  69

Query  332  RALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELG  511
            RALDTVEDDTSI TEVK+ IL +FHRH+Y+  WH+ CGT +Y+VLMD+F +VSTAFLEL 
Sbjct  70   RALDTVEDDTSIPTEVKLTILQEFHRHVYNPSWHYSCGTGNYRVLMDKFRYVSTAFLELD  129

Query  512  KNYQEAIEDITMRMGAGMAKFICKE  586
            +  QEAI++IT RMG GM+KFICKE
Sbjct  130  QGCQEAIKEITKRMGEGMSKFICKE  154



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +  ++KHPD++ PL+KLK+ A + ++ IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGLMETLVKHPDEIRPLVKLKVDAMRAQRAIPKDPYLAFCYRMLMRVSRSFSIVIQQLRT  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYLVLR LDT+EDD +I  ++KVPIL  FH HIYD  W F+CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTIEDDMAIPIDIKVPILKSFHEHIYDPSWKFVCGEKDYKELMN  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFI  577
            +F  VS AFL L + YQ  I ++T RMG GMAKFI
Sbjct  121  KFECVSNAFLNLDEGYQRVIAEMTNRMGVGMAKFI  155



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 113/148 (76%), Gaps = 14/148 (9%)
 Frame = +2

Query  176  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA-----------VCIFY  322
            +AA+ IEK+ P QPHW FCYT L+ VS   AL+IQQLP +LR +           VC++Y
Sbjct  2    VAAKLIEKRTPLQPHWAFCYTTLRNVS---ALLIQQLPTDLRTSLSLVNFRPTLQVCVYY  58

Query  323  LVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFL  502
            LV RALDTVEDDTS+A EV+VPIL +F+ H YDREWHF CGT  +KVLMDQFHHVSTAFL
Sbjct  59   LVRRALDTVEDDTSLAIEVRVPILRNFYCHFYDREWHFSCGTNAFKVLMDQFHHVSTAFL  118

Query  503  ELGKNYQEAIEDITMRMGAGMAKFICKE  586
            E  KNYQE I+DIT RMG GMAKF+CKE
Sbjct  119  EFDKNYQEVIKDITKRMGEGMAKFLCKE  146



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 125/199 (63%), Gaps = 46/199 (23%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVPALLRLKLAAGRIRRQIPPQDHWAFAYDMLQRVSRSFALVIQQLGPDLRNA  61

Query  308  V--------------------------------------CIFYLVLRALDTVEDDTSIAT  373
            V                                      C+FYLVLRALDTVEDDT+I  
Sbjct  62   VSTQFSPFPFPSGSPPIRIPEISETFTAADVALVLTLQVCVFYLVLRALDTVEDDTAIPN  121

Query  374  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKN--------YQEA  529
            EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  VSTAFLELG+         YQ+A
Sbjct  122  EVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQVSTAFLELGEGHSLSIKCKYQKA  181

Query  530  IEDITMRMGAGMAKFICKE  586
            IE+IT RMG GMAKFIC E
Sbjct  182  IEEITRRMGEGMAKFICTE  200



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMDQFHHV
Sbjct  9    VCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMDQFHHV  68

Query  488  STAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            STAFLELGK YQ+AIEDIT RMGAGMAKFICKE
Sbjct  69   STAFLELGKGYQDAIEDITKRMGAGMAKFICKE  101



>ref|XP_003058046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57997.1| predicted protein [Micromonas pusilla CCMP1545]
Length=454

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  +LKHP D  PL+++K+ A +  K++P +P+  FCY ML KVSRSFA+VIQQLP 
Sbjct  1    MGALTLLLKHPSDFIPLVRVKMMADK-AKKLPKEPNLAFCYDMLNKVSRSFAIVIQQLPH  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL+DAVCIFYLVLRALDT+EDD +I  + K P L  FH+ IYD ++ + CG K YK LMD
Sbjct  60   ELQDAVCIFYLVLRALDTIEDDMAIPEKTKCPELEKFHQKIYDPKYVYPCGEKHYKRLMD  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            ++  V+  FL L K YQ+ I DIT RMG GM+ FI +E
Sbjct  120  EYTKVTAVFLSLKKEYQDVIADITKRMGKGMSNFIRRE  157



>ref|XP_005851990.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
 gb|EFN59888.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
Length=261

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG +L HPD++ P+  + +AAR+  KQ+P +P   FCY ML +VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLTHPDELVPMASMFMAARR-AKQLPQEPGLAFCYDMLNRVSRSFAIVIQQLPH  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRDAVC+FYLVLRALDTVEDD  +  +VKVP+L  FH   YDR W   CG+ +Y  LM+
Sbjct  60   GLRDAVCVFYLVLRALDTVEDDMGLDPKVKVPLLRCFHEKSYDRSWKMSCGSGEYVRLME  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKEXRN  595
             +  V+  F  L K YQ+ I DI  +MGAGMA F+  +  +
Sbjct  120  NYPLVTDVFQGLDKRYQQVIADICKKMGAGMADFVTADAAD  160



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L A+L HP DV PL+++K+ A    K++P  P   +CY +L KVSRSFA+VIQ+L  
Sbjct  1    MGALRAVLSHPGDVAPLVRVKMMA-NAAKRLPKDPDLAYCYDVLNKVSRSFAIVIQRLDA  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYLVLRALDTVEDD SI  E KVP L+ FH +IYD  +   CG K YK LM 
Sbjct  60   ELRDAVCVFYLVLRALDTVEDDMSIPIERKVPDLLAFHEYIYDANYSADCGEKHYKDLMK  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             +  V++ FL L K Y+  I DIT RMG GMAKFI KE
Sbjct  120  NYPRVTSVFLGLKKEYRTVIADITKRMGHGMAKFIEKE  157



>ref|XP_011395550.1| Squalene synthase [Auxenochlorella protothecoides]
 gb|KFM22694.1| Squalene synthase [Auxenochlorella protothecoides]
Length=458

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG +L HPD++ P+  + +AAR+    +P  P   FCY+ML KVSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPDEIIPMAAMYLAARR-AAVLPHDPDLAFCYSMLNKVSRSFAIVIQQLPE  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            +LRDAVC+FYLVLRALDTVEDD +I    KVPIL+ FH   Y+++W   CG   Y  LM+
Sbjct  60   QLRDAVCVFYLVLRALDTVEDDMAIDQAEKVPILLSFHEKTYEKDWSMKCGHGHYVELME  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q+  V  AF  L   YQE I DI  RMGAGMA+FI KE
Sbjct  120  QYPVVCAAFQGLEPQYQEVITDICRRMGAGMAEFIVKE  157



>ref|XP_005651444.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26900.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=347

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG L  +L+HPD++ PL+++  AA++  K +P      FCY ML +VSRSFA+VIQ+LP 
Sbjct  1    MGKLREVLEHPDELIPLVQMAFAAKR-AKVLPKDKSLAFCYDMLNRVSRSFAVVIQRLPT  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYLVLRALDTVEDD ++    KVP+L  FH  IYDR W   CG   Y  LM 
Sbjct  60   ELRDAVCLFYLVLRALDTVEDDMAVPVATKVPLLRVFHEKIYDRSWKMSCGYGPYVDLMQ  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            Q+  V+ AFL L   YQ+ I DIT RMG GMA+FI KE
Sbjct  120  QYSLVTDAFLRLKPMYQKVIADITRRMGEGMAEFIEKE  157



>emb|CDM86349.1| unnamed protein product [Triticum aestivum]
Length=346

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  128  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  307
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALV+QQL  +LR+A
Sbjct  2    GLLSRPEEVPALLRLKLAAGRIRRQIPPQEHWAFAYHMLQRVSRSFALVVQQLGTDLRNA  61

Query  308  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  487
            VCIFYLVLRALD VEDDT+I  +VK+PIL DF+RHIY+ +W F CG   Y+VLMD F  V
Sbjct  62   VCIFYLVLRALDIVEDDTAIPNKVKLPILRDFYRHIYNLDWLFSCGENYYRVLMDNFRQV  121

Query  488  STAFLELGK  514
            S AFLELG+
Sbjct  122  SMAFLELGE  130



>ref|XP_002501456.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62714.1| predicted protein [Micromonas sp. RCC299]
Length=455

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+L  +LKHP D+ PL ++K  A Q  K++P +P+  FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGALSLILKHPGDILPLYRVKCMADQ-AKKLPKEPNLRFCYHMLNLVSRSFAIVIQQLPH  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            EL+DAVC+FYLVLRALDTVEDD SI  + K   L  F + IYD E+ + CG K YKVLMD
Sbjct  60   ELQDAVCVFYLVLRALDTVEDDMSIPDKPKCAELEIFWKKIYDPEYVYPCGEKHYKVLMD  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            ++  V+  FL L K YQ+ I DIT RMGAGM+ FI +E
Sbjct  120  EYPKVTAVFLSLKKEYQDVIADITKRMGAGMSNFIKRE  157



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 114/158 (72%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG +GA+LK+P+D++ L+KLK+A+    + IP  P+  FCY ML++VS SF++VI QL  
Sbjct  1    MGIIGAILKNPEDLHHLLKLKMASAAANRAIPSDPNLAFCYQMLRRVSGSFSIVILQLEP  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LR+AVC+FYLVLR L  VEDD +I  ++KV +L + H+ I+DR++HF CG  DYK+LMD
Sbjct  61   GLRNAVCVFYLVLRGLQAVEDDLTIPYDLKVELLRNLHKKIFDRDFHFPCGNNDYKLLMD  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +F+ V  AFL L   YQE I +IT RMG GM K++  E
Sbjct  121  KFYLVILAFLGLTTGYQEVITEITERMGEGMVKYLNTE  158



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 90/112 (80%), Gaps = 11/112 (10%)
 Frame = +2

Query  251  VSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW  430
            +SRS AL+           VC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EW
Sbjct  57   ISRSIALL-----------VCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEW  105

Query  431  HFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            HF CGT  YK LMD FHHVSTAFLELGKNYQE IEDITMRMG GMAKFI KE
Sbjct  106  HFSCGTNAYKDLMDHFHHVSTAFLELGKNYQEVIEDITMRMGGGMAKFINKE  157



>ref|XP_007512409.1| squalene synthase [Bathycoccus prasinos]
 emb|CCO17009.1| squalene synthase [Bathycoccus prasinos]
Length=462

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG++  +L+HP DV+PL+++K  A +  K++P + +  FCY ML KVSRSFA+VIQQL  
Sbjct  1    MGAISVLLRHPFDVFPLLRVKKMADEA-KKLPKEENLAFCYDMLNKVSRSFAIVIQQLDE  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW-HFLCGTKDYKVLM  469
            ELRDAVCIFYLVLRALDT+EDD +I    KVP L+ FH  IYD E+ H  CG K YK LM
Sbjct  60   ELRDAVCIFYLVLRALDTIEDDMAIDNAEKVPQLLKFHEDIYDPEYKHLTCGEKHYKTLM  119

Query  470  DQFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             ++  V+  FL L K Y++ I DIT RMG GMA FI  E
Sbjct  120  VEYPKVTNVFLRLKKPYKDVIADITRRMGKGMADFIESE  158



>ref|XP_003078740.1| FDFT_NICBE Farnesyl-diphosphate farnesyltransferase (ISS), partial 
[Ostreococcus tauri]
Length=210

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANR-AKRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             +  V++ FL+L K Y++ I DI  RMGAGMAKFI KE
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARRMGAGMAKFIEKE  157



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANRA-KRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             +  V++ FL+L K Y++ I DI  RMGAGMAKFI KE
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARRMGAGMAKFIEKE  157



>ref|XP_002946755.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
 gb|EFJ51981.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
Length=447

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 103/158 (65%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG +L HPD+  PL+++  AA Q   ++P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGEVLSHPDEFLPLVRMARAA-QKATRLPKDPDLAFCYGILNDVSRSFAIVIQQLPN  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRDA+C+FYLVLR LDTVEDD ++    KVP L  FH  IYDR +   CG K YK LM 
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMALEVSFKVPQLRSFHERIYDRGFTMACGYKHYKRLMA  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QF  V   FL L   +Q+ I DIT RMG GMA FI KE
Sbjct  120  QFGTVVNVFLSLEPAHQKVIADITRRMGHGMADFIEKE  157



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG +L HP+++ PL+++  AA++  K +P  P   FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPNEIMPLLRMYRAAKRATK-LPKDPDLAFCYGMLNDVSRSFAIVIQQLPN  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRD++C+FYLVLR LDTVEDD ++  + K+P L  FH  IYDR +   CG   YK LM 
Sbjct  60   PLRDSICVFYLVLRGLDTVEDDMALDVDFKLPELRRFHERIYDRGFTMECGYNHYKRLMA  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            QF  V   FL L   +Q  I DIT RMG GMA+FI KE
Sbjct  120  QFGVVVNVFLALPPPHQAVIADITRRMGYGMAEFIEKE  157



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG + A+++HP ++  L+++K+AA +     P  PH  +CY +L  VSRSFA+V+Q L  
Sbjct  1    MGMVEALIRHPGELPALLQMKLAAARAAHAFPADPHMAYCYRILLLVSRSFAVVVQHLNQ  60

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
            E+RDAVCIFY+VLRALDTVEDD SI  E K  +L +F++H+ D  W F+C    Y VLM 
Sbjct  61   EIRDAVCIFYVVLRALDTVEDDMSIPVETKTTVLEEFYKHLEDPSWRFVCKWNFYIVLMK  120

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
             F+H+S AFL+L K YQ  I DIT RMG GMA+FI KE
Sbjct  121  NFNHLSLAFLQLSKEYQCVISDITKRMGYGMAEFIRKE  158



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 1/158 (1%)
 Frame = +2

Query  113  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  292
            MG LG +L HP+++ PL K+  A++Q  K +P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLAHPEEIIPLAKMFYASKQACK-LPLDPKLAFCYDILNTVSRSFAVVIQQLPN  59

Query  293  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  472
             LRDA+C+FYLVLR LDTVEDD +I  + K+P L+ FH +IY   ++  CG   Y  LM 
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMAIPNDKKIPDLLKFHEYIYQPGFNMQCGYGHYVRLMR  119

Query  473  QFHHVSTAFLELGKNYQEAIEDITMRMGAGMAKFICKE  586
            +F  V   FL L   +Q  I DIT RMGAGMA+F+ +E
Sbjct  120  EFGTVVDVFLSLDARFQSVIADITRRMGAGMAEFVERE  157



>gb|ADP89473.1| squalene synthase [Betula platyphylla]
Length=148

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  335  ALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGK  514
            ALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTK+YKVLMDQFHHVSTAFLEL K
Sbjct  1    ALDTVEDDTSIPTDVKVPILKAFHRHIYDCEWHFSCGTKEYKVLMDQFHHVSTAFLELEK  60

Query  515  NYQEAIEDITMRMGAGMAKFICKE  586
            +YQEAIE+IT RMGAGMAKFICKE
Sbjct  61   SYQEAIEEITKRMGAGMAKFICKE  84



>ref|XP_008351286.1| PREDICTED: squalene synthase-like [Malus domestica]
Length=112

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  418
            MLQKVSRSF L IQQL  E R+ VC+FYLVLRALDTV+DDTSIAT+VKV IL+ FHRHIY
Sbjct  1    MLQKVSRSFVLAIQQLDTEPRNVVCLFYLVLRALDTVKDDTSIATDVKVTILLAFHRHIY  60

Query  419  DREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEA  529
            D  W+F CGT +YKVLMD+FHHVSTAFLELG+    A
Sbjct  61   DPNWYFTCGTDNYKVLMDEFHHVSTAFLELGEGETRA  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000