BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022K14

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGY49286.1|  putative membrane bound NAC transcription factor 1      312   4e-99   Nicotiana benthamiana
ref|XP_009608176.1|  PREDICTED: uncharacterized protein LOC104102223    312   6e-99   Nicotiana tomentosiformis
ref|NP_001274765.1|  uncharacterized LOC102593794                       312   7e-99   Solanum tuberosum [potatoes]
ref|XP_010318064.1|  PREDICTED: uncharacterized protein LOC101253566    311   2e-98   
ref|XP_009759914.1|  PREDICTED: uncharacterized protein LOC104212382    310   3e-98   Nicotiana sylvestris
gb|AAM47025.1|  nam-like protein 1                                      299   2e-94   Petunia x hybrida [garden petunia]
ref|XP_009760821.1|  PREDICTED: NAC domain-containing protein 74-...    285   5e-91   Nicotiana sylvestris
ref|XP_011075874.1|  PREDICTED: NAC domain-containing protein 45        290   1e-90   Sesamum indicum [beniseed]
ref|XP_006347316.1|  PREDICTED: uncharacterized protein LOC102605066    290   2e-90   Solanum tuberosum [potatoes]
ref|XP_009760820.1|  PREDICTED: uncharacterized protein LOC104213...    289   6e-90   Nicotiana sylvestris
ref|XP_009596681.1|  PREDICTED: NAC domain-containing protein 74-...    287   2e-89   Nicotiana tomentosiformis
gb|EYU45332.1|  hypothetical protein MIMGU_mgv1a003123mg                285   8e-89   Erythranthe guttata [common monkey flower]
ref|XP_004241429.1|  PREDICTED: uncharacterized protein LOC101257973    281   2e-87   
gb|EPS67213.1|  hypothetical protein M569_07559                         285   2e-87   Genlisea aurea
emb|CDP04976.1|  unnamed protein product                                279   2e-86   Coffea canephora [robusta coffee]
gb|AGT96630.1|  NAC transcription factor                                253   1e-79   Suaeda liaotungensis
gb|AGV29473.1|  putative NAC domain class transcription factor          248   2e-75   Tamarix hispida
gb|AGL39710.1|  NAC transcription factor 054                            249   3e-75   Jatropha curcas
ref|XP_010671303.1|  PREDICTED: NAC domain-containing protein 86-...    249   6e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002317040.2|  hypothetical protein POPTR_0011s15230g             250   6e-75   
ref|XP_010671302.1|  PREDICTED: uncharacterized protein LOC104888...    248   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006377879.1|  hypothetical protein POPTR_0011s15230g             249   2e-74   
ref|XP_006377880.1|  hypothetical protein POPTR_0011s15230g             249   2e-74   
ref|XP_010045303.1|  PREDICTED: uncharacterized protein LOC104434047    246   4e-74   Eucalyptus grandis [rose gum]
gb|AIA57510.1|  NAC domain-containing protein                           241   3e-73   Boehmeria nivea [Chinese silk-plant]
gb|KJB52429.1|  hypothetical protein B456_008G261400                    246   1e-72   Gossypium raimondii
ref|XP_011004356.1|  PREDICTED: uncharacterized protein LOC105110...    244   1e-72   Populus euphratica
ref|XP_002521312.1|  transcription factor, putative                     243   1e-72   
gb|KCW72635.1|  hypothetical protein EUGRSUZ_E01095                     243   1e-72   Eucalyptus grandis [rose gum]
gb|KHG02383.1|  NAC domain-containing 74                                247   1e-72   Gossypium arboreum [tree cotton]
ref|XP_011004351.1|  PREDICTED: uncharacterized protein LOC105110...    243   3e-72   Populus euphratica
gb|KJB52427.1|  hypothetical protein B456_008G261400                    245   3e-72   Gossypium raimondii
ref|XP_003615518.1|  NAC domain protein                                 236   4e-72   
ref|XP_011004350.1|  PREDICTED: uncharacterized protein LOC105110...    243   4e-72   Populus euphratica
ref|XP_010056056.1|  PREDICTED: uncharacterized protein LOC104444143    243   4e-72   Eucalyptus grandis [rose gum]
gb|KJB52428.1|  hypothetical protein B456_008G261400                    245   5e-72   Gossypium raimondii
emb|CAN73792.1|  hypothetical protein VITISV_034893                     243   7e-72   Vitis vinifera
ref|NP_001280864.1|  uncharacterized LOC103438687                       245   8e-72   Malus domestica [apple tree]
ref|XP_010103069.1|  NAC domain-containing protein 78                   240   9e-72   Morus notabilis
ref|XP_007210371.1|  hypothetical protein PRUPE_ppa001291mg             244   1e-71   Prunus persica
ref|XP_006441281.1|  hypothetical protein CICLE_v10019368mg             238   1e-71   
ref|XP_006441278.1|  hypothetical protein CICLE_v10019368mg             238   1e-71   
ref|NP_001280863.1|  uncharacterized LOC103439966                       238   2e-71   Malus domestica [apple tree]
ref|XP_009360232.1|  PREDICTED: uncharacterized protein LOC103950728    244   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_009361256.1|  PREDICTED: NAC domain-containing protein 74-...    238   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_010104895.1|  NAC domain-containing protein 78                   241   4e-71   
ref|XP_008381552.1|  PREDICTED: uncharacterized protein LOC103444404    238   4e-71   Malus domestica [apple tree]
gb|AGV29497.1|  putative NAC domain class transcription factor          228   4e-71   Tamarix hispida
ref|XP_006377878.1|  hypothetical protein POPTR_0011s15230g             239   4e-71   
ref|XP_006441279.1|  hypothetical protein CICLE_v10019368mg             238   5e-71   Citrus clementina [clementine]
ref|XP_006441280.1|  hypothetical protein CICLE_v10019368mg             238   5e-71   Citrus clementina [clementine]
ref|XP_008245853.1|  PREDICTED: uncharacterized protein LOC103344010    242   5e-71   Prunus mume [ume]
ref|XP_008234624.1|  PREDICTED: NAC domain-containing protein 7-like    237   6e-71   Prunus mume [ume]
gb|KDO44489.1|  hypothetical protein CISIN_1g007393mg                   238   6e-71   Citrus sinensis [apfelsine]
gb|KDO44488.1|  hypothetical protein CISIN_1g007393mg                   238   6e-71   Citrus sinensis [apfelsine]
ref|XP_006478082.1|  PREDICTED: NAC domain-containing protein 69-...    238   7e-71   Citrus sinensis [apfelsine]
ref|XP_006478081.1|  PREDICTED: NAC domain-containing protein 69-...    238   7e-71   Citrus sinensis [apfelsine]
ref|XP_006478080.1|  PREDICTED: NAC domain-containing protein 69-...    238   7e-71   Citrus sinensis [apfelsine]
ref|XP_010662939.1|  PREDICTED: NAC domain-containing protein 77        237   8e-71   Vitis vinifera
ref|XP_008360722.1|  PREDICTED: uncharacterized protein LOC103424418    242   8e-71   Malus domestica [apple tree]
ref|XP_003615517.1|  NAC domain protein                                 238   1e-70   Medicago truncatula
gb|AFK41148.1|  unknown                                                 238   1e-70   Medicago truncatula
ref|XP_008462914.1|  PREDICTED: NAC domain-containing protein 74        237   2e-70   Cucumis melo [Oriental melon]
gb|AGL39711.1|  NAC transcription factor 055                            237   2e-70   Jatropha curcas
ref|XP_007039299.1|  NAC domain-containing protein 78, putative i...    238   2e-70   
ref|XP_009351898.1|  PREDICTED: uncharacterized protein LOC103943342    235   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_011470170.1|  PREDICTED: NAC domain-containing protein 86        235   4e-70   Fragaria vesca subsp. vesca
ref|XP_004156529.1|  PREDICTED: NAC domain-containing protein 74-...    235   7e-70   
ref|XP_007039300.1|  NAC domain-containing protein 78, putative i...    236   1e-69   
ref|XP_004137298.1|  PREDICTED: NAC domain-containing protein 74-...    235   1e-69   
ref|XP_007039234.1|  NAC domain class transcription factor, putat...    232   1e-69   
ref|NP_001276287.1|  NAC domain protein                                 234   2e-69   Glycine max [soybeans]
gb|KJB52425.1|  hypothetical protein B456_008G261400                    235   2e-69   Gossypium raimondii
gb|KFK27735.1|  hypothetical protein AALP_AA8G422400                    231   2e-69   Arabis alpina [alpine rockcress]
gb|AIA57515.1|  NAC domain-containing protein                           235   2e-69   Boehmeria nivea [Chinese silk-plant]
ref|XP_006291082.1|  hypothetical protein CARUB_v10017199mg             230   2e-69   Capsella rubella
ref|XP_010241066.1|  PREDICTED: uncharacterized protein LOC104585...    234   2e-69   
ref|XP_007039233.1|  NAC domain class transcription factor, putat...    233   2e-69   
ref|XP_010241065.1|  PREDICTED: uncharacterized protein LOC104585...    234   3e-69   Nelumbo nucifera [Indian lotus]
gb|KJB52426.1|  hypothetical protein B456_008G261400                    236   3e-69   Gossypium raimondii
gb|KHN46203.1|  NAC domain-containing protein 78                        233   3e-69   Glycine soja [wild soybean]
ref|XP_002300524.2|  hypothetical protein POPTR_0001s45700g             234   4e-69   
ref|XP_010533527.1|  PREDICTED: uncharacterized protein LOC104809290    234   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_006596412.1|  PREDICTED: NAC domain-containing protein 12-...    233   4e-69   Glycine max [soybeans]
gb|KHN40025.1|  NAC domain-containing protein 78                        233   4e-69   Glycine soja [wild soybean]
ref|XP_010503613.1|  PREDICTED: NAC domain-containing protein 19-...    229   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_011004357.1|  PREDICTED: uncharacterized protein LOC105110...    234   6e-69   Populus euphratica
gb|KJB39512.1|  hypothetical protein B456_007G017500                    228   6e-69   Gossypium raimondii
ref|XP_011038026.1|  PREDICTED: uncharacterized protein LOC105135051    234   6e-69   Populus euphratica
ref|XP_010525539.1|  PREDICTED: NAC domain-containing protein 67-...    229   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_007141360.1|  hypothetical protein PHAVU_008G189100g             232   7e-69   Phaseolus vulgaris [French bean]
ref|XP_011004354.1|  PREDICTED: uncharacterized protein LOC105110...    234   8e-69   Populus euphratica
gb|KJB18878.1|  hypothetical protein B456_003G073300                    231   8e-69   Gossypium raimondii
ref|XP_010515305.1|  PREDICTED: NAC domain-containing protein 19-...    229   8e-69   Camelina sativa [gold-of-pleasure]
gb|AES72662.2|  M20/M25/M40 family peptidase                            225   8e-69   Medicago truncatula
ref|XP_010426468.1|  PREDICTED: NAC domain-containing protein 74        229   8e-69   Camelina sativa [gold-of-pleasure]
ref|XP_011004355.1|  PREDICTED: uncharacterized protein LOC105110...    234   8e-69   Populus euphratica
ref|XP_011004352.1|  PREDICTED: uncharacterized protein LOC105110...    234   9e-69   Populus euphratica
ref|XP_003602412.1|  NAC domain-containing protein                      232   1e-68   Medicago truncatula
ref|XP_011081340.1|  PREDICTED: uncharacterized protein LOC105164...    231   2e-68   
ref|XP_003602413.1|  NAC domain-containing protein                      232   2e-68   
ref|XP_011081339.1|  PREDICTED: uncharacterized protein LOC105164...    231   2e-68   Sesamum indicum [beniseed]
ref|XP_004514021.1|  PREDICTED: uncharacterized protein LOC101501154    232   2e-68   Cicer arietinum [garbanzo]
ref|XP_007136363.1|  hypothetical protein PHAVU_009G039000g             231   2e-68   Phaseolus vulgaris [French bean]
ref|XP_011070419.1|  PREDICTED: NAC domain-containing protein 4-like    231   2e-68   Sesamum indicum [beniseed]
ref|XP_010519577.1|  PREDICTED: NAC domain-containing protein 67-...    229   2e-68   Tarenaya hassleriana [spider flower]
gb|KDO76787.1|  hypothetical protein CISIN_1g009388mg                   230   2e-68   Citrus sinensis [apfelsine]
ref|XP_002867065.1|  predicted protein                                  229   3e-68   
ref|XP_006306958.1|  hypothetical protein CARUB_v10008529mg             232   3e-68   Capsella rubella
ref|XP_006306959.1|  hypothetical protein CARUB_v10008529mg             232   3e-68   Capsella rubella
ref|XP_006306957.1|  hypothetical protein CARUB_v10008529mg             232   3e-68   Capsella rubella
gb|KJB24042.1|  hypothetical protein B456_004G125900                    228   3e-68   Gossypium raimondii
ref|XP_010432258.1|  PREDICTED: NAC domain-containing protein 1-l...    229   3e-68   Camelina sativa [gold-of-pleasure]
gb|KHF99264.1|  NAC domain-containing 78 -like protein                  231   4e-68   Gossypium arboreum [tree cotton]
ref|XP_006287681.1|  hypothetical protein CARUB_v10000892mg             226   4e-68   
emb|CDY05939.1|  BnaC08g21160D                                          227   4e-68   
gb|KJB18876.1|  hypothetical protein B456_003G073300                    231   4e-68   Gossypium raimondii
gb|KJB39511.1|  hypothetical protein B456_007G017500                    229   4e-68   Gossypium raimondii
ref|XP_002317831.2|  hypothetical protein POPTR_0012s00760g             230   6e-68   
ref|XP_006287682.1|  hypothetical protein CARUB_v10000892mg             227   6e-68   Capsella rubella
ref|XP_010432259.1|  PREDICTED: NAC domain-containing protein 1-l...    229   6e-68   
gb|KJB24041.1|  hypothetical protein B456_004G125900                    227   7e-68   Gossypium raimondii
ref|XP_006286077.1|  hypothetical protein CARUB_v10007613mg             228   7e-68   Capsella rubella
gb|KFK34231.1|  hypothetical protein AALP_AA5G118000                    226   7e-68   Arabis alpina [alpine rockcress]
ref|NP_567986.3|  NAC transcription factor-like 9                       228   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493709.1|  PREDICTED: NAC domain-containing protein 74        227   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010437454.1|  PREDICTED: uncharacterized protein LOC104721220    228   9e-68   Camelina sativa [gold-of-pleasure]
gb|KHN19577.1|  NAC domain-containing protein 78                        229   1e-67   Glycine soja [wild soybean]
ref|XP_003526771.1|  PREDICTED: uncharacterized protein LOC100808469    229   1e-67   Glycine max [soybeans]
ref|XP_010421284.1|  PREDICTED: NAC domain-containing protein 74-...    226   1e-67   Camelina sativa [gold-of-pleasure]
gb|KHG07501.1|  NAC domain-containing 78 -like protein                  229   1e-67   Gossypium arboreum [tree cotton]
ref|NP_001119122.1|  NAC transcription factor-like 9                    228   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874210.1|  tip                                                226   1e-67   Arabidopsis lyrata subsp. lyrata
ref|NP_001190927.1|  NAC transcription factor-like 9                    228   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197847.3|  TCV-interacting protein                               226   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529684.1|  PREDICTED: NAC domain-containing protein 86        230   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_006439176.1|  hypothetical protein CICLE_v10019282mg             230   1e-67   Citrus clementina [clementine]
ref|XP_010446907.1|  PREDICTED: NAC domain-containing protein 86-...    228   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010499853.1|  PREDICTED: NAC domain-containing protein 86-...    230   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010499852.1|  PREDICTED: NAC domain-containing protein 86-...    230   2e-67   
gb|KHG05224.1|  NAC domain-containing 78 -like protein                  228   2e-67   Gossypium arboreum [tree cotton]
ref|XP_006476249.1|  PREDICTED: uncharacterized protein LOC102621962    230   2e-67   Citrus sinensis [apfelsine]
ref|XP_002877683.1|  ANAC062                                            226   2e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_010499854.1|  PREDICTED: NAC domain-containing protein 86-...    230   2e-67   
emb|CDY08139.1|  BnaA06g15870D                                          225   2e-67   Brassica napus [oilseed rape]
ref|XP_009151462.1|  PREDICTED: uncharacterized protein LOC103874777    229   2e-67   Brassica rapa
ref|XP_004502779.1|  PREDICTED: uncharacterized protein LOC101492664    229   2e-67   Cicer arietinum [garbanzo]
gb|AIU39715.1|  NAC transcription factor 14                             229   3e-67   Brassica napus [oilseed rape]
ref|XP_010456676.1|  PREDICTED: NAC domain-containing protein 2-like    227   3e-67   Camelina sativa [gold-of-pleasure]
gb|AAF31292.1|AC006424_21  CDS                                          228   3e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66161.1|  BnaCnng49700D                                          229   3e-67   Brassica napus [oilseed rape]
gb|AHJ79190.1|  NAC domain protein NAC49                                229   3e-67   Gossypium hirsutum [American cotton]
ref|XP_002321956.2|  hypothetical protein POPTR_0015s00640g             228   3e-67   
ref|XP_006394714.1|  hypothetical protein EUTSA_v10004105mg             226   3e-67   
gb|KFK45050.1|  hypothetical protein AALP_AA1G337500                    229   3e-67   Arabis alpina [alpine rockcress]
gb|KFK45049.1|  hypothetical protein AALP_AA1G337500                    229   3e-67   Arabis alpina [alpine rockcress]
ref|XP_009149732.1|  PREDICTED: NAC transcription factor 29             225   3e-67   Brassica rapa
ref|XP_003602411.1|  IAA-amino acid hydrolase ILR1-like protein         224   4e-67   
ref|XP_006394715.1|  hypothetical protein EUTSA_v10004105mg             225   4e-67   Eutrema salsugineum [saltwater cress]
gb|ACU23644.1|  unknown                                                 228   4e-67   Glycine max [soybeans]
ref|NP_001276211.1|  uncharacterized LOC100777071                       228   4e-67   
ref|XP_006404132.1|  hypothetical protein EUTSA_v10010340mg             225   4e-67   Eutrema salsugineum [saltwater cress]
ref|XP_004309509.1|  PREDICTED: uncharacterized protein LOC101295292    230   5e-67   Fragaria vesca subsp. vesca
gb|EYU35608.1|  hypothetical protein MIMGU_mgv1a022295mg                224   6e-67   Erythranthe guttata [common monkey flower]
ref|NP_174582.3|  protein NAC 014                                       228   7e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973954.1|  protein NAC 014                                       228   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478725.1|  PREDICTED: uncharacterized protein LOC104757...    228   9e-67   
ref|XP_010478726.1|  PREDICTED: uncharacterized protein LOC104757...    228   1e-66   
ref|XP_006415127.1|  hypothetical protein EUTSA_v10007021mg             228   1e-66   Eutrema salsugineum [saltwater cress]
gb|KJB37428.1|  hypothetical protein B456_006G203800                    221   2e-66   Gossypium raimondii
ref|XP_002893753.1|  ANAC014                                            227   2e-66   
ref|NP_190522.1|  transcription factor NTL6                             223   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043746.1|  PREDICTED: uncharacterized protein LOC105139114    225   5e-66   Populus euphratica
gb|KHG14091.1|  NAC domain-containing 78 -like protein                  224   6e-66   Gossypium arboreum [tree cotton]
gb|AIS36139.1|  NAC transcription factor 91-1                           221   6e-66   Brassica napus [oilseed rape]
ref|XP_009111638.1|  PREDICTED: NAC domain-containing protein 74 ...    221   6e-66   Brassica rapa
ref|XP_009111639.1|  PREDICTED: NAC domain-containing protein 2 i...    221   6e-66   Brassica rapa
emb|CDX86970.1|  BnaC03g52400D                                          218   6e-66   
ref|XP_010542182.1|  PREDICTED: uncharacterized protein LOC104815470    226   6e-66   Tarenaya hassleriana [spider flower]
gb|KJB37424.1|  hypothetical protein B456_006G203800                    222   7e-66   Gossypium raimondii
gb|KJB37426.1|  hypothetical protein B456_006G203800                    221   1e-65   Gossypium raimondii
gb|KJB37423.1|  hypothetical protein B456_006G203800                    222   1e-65   Gossypium raimondii
ref|XP_010461128.1|  PREDICTED: NAC domain-containing protein 86        225   2e-65   
gb|AHJ79172.1|  NAC domain protein NAC31                                222   2e-65   Gossypium hirsutum [American cotton]
ref|XP_011003273.1|  PREDICTED: NAC domain-containing protein 45-...    223   2e-65   Populus euphratica
ref|XP_011003272.1|  PREDICTED: NAC domain-containing protein 45-...    223   3e-65   Populus euphratica
gb|AIS36140.1|  NAC transcription factor 91-2                           219   8e-65   Brassica napus [oilseed rape]
emb|CDX80455.1|  BnaC07g29890D                                          218   9e-65   
ref|XP_009150983.1|  PREDICTED: protein ATAF2-like isoform X2           218   1e-64   Brassica rapa
ref|XP_009150982.1|  PREDICTED: protein ATAF2-like isoform X1           218   1e-64   Brassica rapa
emb|CAN73478.1|  hypothetical protein VITISV_037597                     209   2e-64   Vitis vinifera
emb|CDX88115.1|  BnaA06g27060D                                          217   3e-64   
emb|CDP12257.1|  unnamed protein product                                219   5e-64   Coffea canephora [robusta coffee]
ref|XP_010660382.1|  PREDICTED: uncharacterized protein LOC104877280    219   1e-63   Vitis vinifera
emb|CDX87118.1|  BnaC09g04330D                                          222   2e-63   
ref|XP_009150140.1|  PREDICTED: NAC transcription factor 29-like        213   6e-63   Brassica rapa
ref|XP_008783552.1|  PREDICTED: uncharacterized protein LOC103702771    218   1e-62   Phoenix dactylifera
ref|XP_004972796.1|  PREDICTED: uncharacterized protein LOC101763561    218   1e-62   Setaria italica
ref|XP_009385839.1|  PREDICTED: uncharacterized protein LOC103973...    217   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385838.1|  PREDICTED: uncharacterized protein LOC103973...    217   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389904.1|  PREDICTED: uncharacterized protein LOC103976...    216   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010919012.1|  PREDICTED: uncharacterized protein LOC105043...    214   5e-62   Elaeis guineensis
ref|XP_002518952.1|  transcription factor, putative                     214   6e-62   
ref|XP_010919011.1|  PREDICTED: uncharacterized protein LOC105043...    214   1e-61   Elaeis guineensis
ref|XP_008811393.1|  PREDICTED: NAC domain-containing protein 74-...    205   2e-61   
ref|XP_009389911.1|  PREDICTED: uncharacterized protein LOC103976...    214   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391053.1|  PREDICTED: uncharacterized protein LOC103977...    214   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391051.1|  PREDICTED: uncharacterized protein LOC103977...    214   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061034.1|  Os08g0157900                                       214   4e-61   
ref|XP_002445085.1|  hypothetical protein SORBIDRAFT_07g003900          213   7e-61   Sorghum bicolor [broomcorn]
ref|XP_010234378.1|  PREDICTED: uncharacterized protein LOC100838012    213   3e-60   Brachypodium distachyon [annual false brome]
ref|XP_010934041.1|  PREDICTED: uncharacterized protein LOC105054...    211   3e-60   Elaeis guineensis
ref|XP_010934040.1|  PREDICTED: uncharacterized protein LOC105054...    211   3e-60   Elaeis guineensis
ref|XP_008808290.1|  PREDICTED: uncharacterized protein LOC103720389    209   7e-60   Phoenix dactylifera
ref|XP_010941181.1|  PREDICTED: uncharacterized protein LOC105059...    210   1e-59   Elaeis guineensis
ref|XP_010941180.1|  PREDICTED: uncharacterized protein LOC105059...    210   1e-59   
ref|XP_006659850.1|  PREDICTED: uncharacterized protein LOC102700454    209   2e-59   Oryza brachyantha
ref|XP_008788721.1|  PREDICTED: uncharacterized protein LOC103706...    209   2e-59   Phoenix dactylifera
ref|XP_008788722.1|  PREDICTED: uncharacterized protein LOC103706...    209   2e-59   Phoenix dactylifera
gb|EEC82928.1|  hypothetical protein OsI_27885                          209   3e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006846446.1|  hypothetical protein AMTR_s00018p00071850          206   7e-59   Amborella trichopoda
ref|XP_009397631.1|  PREDICTED: uncharacterized protein LOC103982434    206   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389125.1|  PREDICTED: NAC domain-containing protein 19-...    201   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383033.1|  PREDICTED: NAC domain-containing protein 67-...    201   2e-58   
ref|XP_009390804.1|  PREDICTED: NAC transcription factor 29-like        198   1e-57   
gb|AGL39704.1|  NAC transcription factor 048                            193   2e-57   Jatropha curcas
dbj|BAJ97142.1|  predicted protein                                      204   2e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT07892.1|  NAC domain-containing protein 78                        204   2e-57   
emb|CBI38740.3|  unnamed protein product                                196   2e-57   Vitis vinifera
gb|EMS48745.1|  NAC domain-containing protein 78                        204   2e-57   Triticum urartu
gb|EYU22270.1|  hypothetical protein MIMGU_mgv1a022636mg                189   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_009145987.1|  PREDICTED: NAC domain-containing protein 78        191   2e-56   Brassica rapa
emb|CDX92153.1|  BnaA05g22540D                                          189   3e-56   
ref|XP_009413063.1|  PREDICTED: uncharacterized protein LOC103994...    194   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010505816.1|  PREDICTED: NAC domain-containing protein 86-...    190   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010465831.1|  PREDICTED: NAC domain-containing protein 86-...    190   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006298357.1|  hypothetical protein CARUB_v10014426mg             190   4e-56   
ref|XP_004157040.1|  PREDICTED: uncharacterized protein LOC101224912    199   4e-56   
ref|XP_004148915.1|  PREDICTED: uncharacterized protein LOC101209310    199   4e-56   Cucumis sativus [cucumbers]
ref|XP_003600640.1|  NAC domain protein                                 199   4e-56   Medicago truncatula
ref|XP_008439242.1|  PREDICTED: protein BEARSKIN1                       190   5e-56   Cucumis melo [Oriental melon]
ref|XP_003537430.2|  PREDICTED: uncharacterized protein LOC100808596    199   5e-56   Glycine max [soybeans]
ref|XP_010487668.1|  PREDICTED: NAC domain-containing protein 86-...    190   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004137396.1|  PREDICTED: NAC domain-containing protein 74-...    190   5e-56   Cucumis sativus [cucumbers]
ref|XP_006406699.1|  hypothetical protein EUTSA_v10021408mg             190   5e-56   Eutrema salsugineum [saltwater cress]
ref|XP_011072043.1|  PREDICTED: NAC domain-containing protein 86        189   5e-56   
gb|KHN24171.1|  NAC domain-containing protein 74                        199   5e-56   Glycine soja [wild soybean]
ref|XP_008463166.1|  PREDICTED: uncharacterized protein LOC103501372    199   6e-56   Cucumis melo [Oriental melon]
ref|NP_188400.1|  NAC domain containing protein 57                      189   7e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AIU39717.1|  NAC transcription factor 57                             189   7e-56   Brassica napus [oilseed rape]
ref|XP_002883083.1|  predicted protein                                  189   7e-56   Arabidopsis lyrata subsp. lyrata
emb|CBI24139.3|  unnamed protein product                                190   9e-56   Vitis vinifera
emb|CDX95832.1|  BnaC05g35830D                                          188   9e-56   
ref|XP_010690417.1|  PREDICTED: NAC domain-containing protein 86-...    192   9e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009790485.1|  PREDICTED: NAC domain-containing protein 74 ...    189   1e-55   Nicotiana sylvestris
ref|XP_003546832.1|  PREDICTED: NAC domain-containing protein 68-...    192   1e-55   Glycine max [soybeans]
ref|XP_004299481.1|  PREDICTED: NAC domain-containing protein 86        189   1e-55   Fragaria vesca subsp. vesca
ref|XP_010661534.1|  PREDICTED: uncharacterized protein LOC100252...    197   1e-55   Vitis vinifera
ref|XP_009621552.1|  PREDICTED: NAC domain-containing protein 74 ...    189   1e-55   Nicotiana tomentosiformis
ref|XP_002268892.1|  PREDICTED: NAC transcription factor NAM-B1-l...    196   1e-55   Vitis vinifera
ref|XP_010645088.1|  PREDICTED: NAC domain-containing protein 45        191   2e-55   Vitis vinifera
ref|XP_007010878.1|  NAC domain containing protein 57                   188   2e-55   Theobroma cacao [chocolate]
ref|XP_008813657.1|  PREDICTED: NAC domain-containing protein 74-...    193   2e-55   
ref|XP_002525485.1|  transcription factor, putative                     187   3e-55   Ricinus communis
ref|XP_006364397.1|  PREDICTED: NAC domain-containing protein 74-...    187   3e-55   Solanum tuberosum [potatoes]
ref|XP_010908788.1|  PREDICTED: NAC domain-containing protein 86-...    193   3e-55   
ref|XP_010661535.1|  PREDICTED: uncharacterized protein LOC100252...    196   3e-55   Vitis vinifera
gb|KDO61523.1|  hypothetical protein CISIN_1g036998mg                   188   3e-55   Citrus sinensis [apfelsine]
emb|CDO98612.1|  unnamed protein product                                187   3e-55   Coffea canephora [robusta coffee]
gb|KFK39102.1|  hypothetical protein AALP_AA3G201200                    187   4e-55   Arabis alpina [alpine rockcress]
ref|XP_008383208.1|  PREDICTED: NAC transcription factor 29-like        191   4e-55   
ref|XP_003532905.1|  PREDICTED: NAC domain-containing protein 74-...    190   4e-55   Glycine max [soybeans]
ref|XP_010037008.1|  PREDICTED: NAC domain-containing protein 74        187   4e-55   Eucalyptus grandis [rose gum]
ref|XP_010092473.1|  NAC domain-containing protein 78                   190   4e-55   Morus notabilis
ref|XP_010069496.1|  PREDICTED: NAC domain-containing protein 74-...    187   5e-55   Eucalyptus grandis [rose gum]
gb|KJB08197.1|  hypothetical protein B456_001G070700                    187   5e-55   Gossypium raimondii
gb|EMT33279.1|  NAC domain-containing protein 74                        186   7e-55   
ref|XP_008778272.1|  PREDICTED: uncharacterized protein LOC103698082    196   7e-55   Phoenix dactylifera
ref|XP_011000782.1|  PREDICTED: NAC domain-containing protein 86-...    187   8e-55   Populus euphratica
ref|XP_008371963.1|  PREDICTED: protein BEARSKIN1-like                  190   8e-55   
ref|XP_008653037.1|  PREDICTED: NAC domain-containing protein 74-...    186   9e-55   
gb|AIB05550.1|  NAC transcription factor                                186   9e-55   
gb|EMT23614.1|  NAC domain-containing protein 78                        195   9e-55   
ref|XP_004140020.1|  PREDICTED: NAC domain-containing protein 43-...    190   1e-54   
ref|XP_003552888.2|  PREDICTED: uncharacterized protein LOC100818019    196   1e-54   
ref|XP_003549188.1|  PREDICTED: NAC domain-containing protein 74-...    186   1e-54   
ref|XP_002318332.2|  no apical meristem family protein                  186   1e-54   
gb|KHN08773.1|  NAC domain-containing protein 74                        196   1e-54   
ref|XP_007149170.1|  hypothetical protein PHAVU_005G047300g             189   1e-54   
ref|XP_006441340.1|  hypothetical protein CICLE_v10024520mg             186   1e-54   
ref|XP_010055345.1|  PREDICTED: NAC domain-containing protein 78        189   1e-54   
ref|XP_011047785.1|  PREDICTED: NAC domain-containing protein 86 ...    186   1e-54   
ref|XP_001765136.1|  predicted protein                                  184   1e-54   
ref|XP_010934906.1|  PREDICTED: uncharacterized protein LOC105054...    196   1e-54   
ref|XP_009363322.1|  PREDICTED: NAC domain-containing protein 19-...    189   1e-54   
ref|XP_010934904.1|  PREDICTED: uncharacterized protein LOC105054...    196   1e-54   
ref|XP_006374257.1|  no apical meristem family protein                  186   2e-54   
ref|XP_003534099.1|  PREDICTED: NAC domain-containing protein 74-...    186   2e-54   
ref|XP_009386284.1|  PREDICTED: NAC domain-containing protein 78-...    188   2e-54   
ref|XP_006398354.1|  hypothetical protein EUTSA_v10001200mg             187   2e-54   
ref|XP_004957582.1|  PREDICTED: NAC domain-containing protein 78-...    186   2e-54   
gb|KDO57313.1|  hypothetical protein CISIN_1g0079381mg                  190   2e-54   
ref|XP_004235381.1|  PREDICTED: NAC domain-containing protein 86 ...    186   2e-54   
gb|EAY88306.1|  hypothetical protein OsI_09763                          195   2e-54   
ref|XP_006350487.1|  PREDICTED: NAC domain-containing protein 78-...    190   2e-54   
ref|XP_007152594.1|  hypothetical protein PHAVU_004G143100g             185   2e-54   
ref|NP_001288459.1|  uncharacterized LOC103630963                       194   2e-54   
ref|XP_010934905.1|  PREDICTED: uncharacterized protein LOC105054...    195   2e-54   
ref|XP_010663931.1|  PREDICTED: NAC domain-containing protein 86 ...    185   2e-54   
ref|XP_006422300.1|  hypothetical protein CICLE_v10005341mg             188   2e-54   
ref|XP_006649289.1|  PREDICTED: uncharacterized protein LOC102717876    194   2e-54   
ref|NP_001173241.1|  Os03g0119966                                       194   3e-54   
ref|XP_009760809.1|  PREDICTED: protein ATAF2-like                      187   3e-54   
ref|XP_011095829.1|  PREDICTED: NAC transcription factor 29             188   3e-54   
ref|XP_004293835.1|  PREDICTED: NAC domain-containing protein 86        188   3e-54   
ref|XP_002460636.1|  hypothetical protein SORBIDRAFT_02g032230          184   4e-54   
ref|XP_002468623.1|  hypothetical protein SORBIDRAFT_01g049240          194   4e-54   
ref|XP_009790484.1|  PREDICTED: NAC domain-containing protein 74 ...    185   4e-54   
ref|XP_009588904.1|  PREDICTED: protein BEARSKIN1-like                  192   4e-54   
gb|AGL39702.1|  NAC transcription factor 046                            187   4e-54   
ref|XP_004985948.1|  PREDICTED: uncharacterized protein LOC101753...    194   4e-54   
ref|XP_009413062.1|  PREDICTED: uncharacterized protein LOC103994...    193   4e-54   
ref|XP_009130344.1|  PREDICTED: protein BEARSKIN1 isoform X2            191   4e-54   
tpg|DAA42981.1|  TPA: putative NAC domain transcription factor su...    194   4e-54   
ref|XP_007214075.1|  hypothetical protein PRUPE_ppa017765mg             188   4e-54   
ref|XP_004985947.1|  PREDICTED: uncharacterized protein LOC101753...    194   4e-54   
ref|XP_009340546.1|  PREDICTED: NAC transcription factor 29-like        188   4e-54   
ref|XP_010238477.1|  PREDICTED: NAC domain-containing protein 86-...    184   4e-54   
ref|XP_009340131.1|  PREDICTED: NAC transcription factor 29-like        188   4e-54   
ref|NP_197228.1|  NAC domain containing protein 86                      191   4e-54   
ref|XP_009621551.1|  PREDICTED: NAC domain-containing protein 74 ...    184   5e-54   
ref|XP_003595952.1|  NAC domain protein                                 187   5e-54   
ref|XP_009598688.1|  PREDICTED: protein BEARSKIN1-like isoform X2       189   5e-54   
emb|CDY43143.1|  BnaA05g32430D                                          191   5e-54   
ref|XP_008653036.1|  PREDICTED: NAC domain-containing protein 74-...    184   5e-54   
ref|XP_010270699.1|  PREDICTED: NAC domain-containing protein 45        184   6e-54   
ref|XP_010908787.1|  PREDICTED: NAC domain-containing protein 86-...    194   6e-54   
ref|XP_004515256.1|  PREDICTED: NAC domain-containing protein 78-...    184   6e-54   
ref|XP_009392206.1|  PREDICTED: NAC domain-containing protein 74        184   6e-54   
gb|KDO44487.1|  hypothetical protein CISIN_1g007393mg                   192   6e-54   
ref|XP_010694972.1|  PREDICTED: NAC domain-containing protein 86-...    184   6e-54   
ref|NP_001056531.1|  Os06g0101800                                       187   6e-54   
ref|XP_003562178.1|  PREDICTED: uncharacterized protein LOC100843938    194   6e-54   
gb|KEH26851.1|  NAC transcription factor-like protein                   184   7e-54   
emb|CDX77674.1|  BnaC07g19280D                                          185   7e-54   
gb|KJB37103.1|  hypothetical protein B456_006G189600                    184   7e-54   
ref|XP_010270697.1|  PREDICTED: NAC domain-containing protein 45 ...    194   7e-54   
ref|XP_009765145.1|  PREDICTED: NAC domain-containing protein 78-...    192   7e-54   
ref|XP_009624151.1|  PREDICTED: NAC domain-containing protein 72-...    186   7e-54   
ref|XP_006660950.1|  PREDICTED: NAC domain-containing protein 74-...    183   8e-54   
ref|XP_010270698.1|  PREDICTED: NAC domain-containing protein 45 ...    193   8e-54   
ref|XP_004488556.1|  PREDICTED: NAC domain-containing protein 78-...    187   8e-54   
ref|XP_006408330.1|  hypothetical protein EUTSA_v10022055mg             190   9e-54   
gb|EAY99297.1|  hypothetical protein OsI_21263                          193   9e-54   
gb|KJB26959.1|  hypothetical protein B456_004G268400                    186   1e-53   
ref|XP_009101506.1|  PREDICTED: NAC transcription factor 29-like        185   1e-53   
ref|XP_010492671.1|  PREDICTED: NAC domain-containing protein 86-...    190   1e-53   
ref|XP_010551125.1|  PREDICTED: NAC domain-containing protein 86        183   1e-53   
emb|CDY28745.1|  BnaCnng06310D                                          190   1e-53   
ref|XP_009131585.1|  PREDICTED: protein SOMBRERO-like                   190   1e-53   
gb|EEE64934.1|  hypothetical protein OsJ_19800                          193   1e-53   
ref|XP_007022771.1|  NAC domain containing protein 20                   186   1e-53   
gb|KFK37763.1|  hypothetical protein AALP_AA3G026600                    188   1e-53   
ref|XP_006846443.1|  hypothetical protein AMTR_s00018p00070180          181   1e-53   
ref|XP_008225989.1|  PREDICTED: protein BEARSKIN1                       186   1e-53   
ref|XP_004245880.1|  PREDICTED: NAC domain-containing protein 86-...    186   2e-53   
ref|XP_010940742.1|  PREDICTED: NAC domain-containing protein 86-...    190   2e-53   
gb|EYU38937.1|  hypothetical protein MIMGU_mgv1a0250772mg               186   2e-53   
ref|XP_009385171.1|  PREDICTED: uncharacterized protein LOC103972538    191   2e-53   
ref|XP_008456283.1|  PREDICTED: NAC domain-containing protein 76        187   2e-53   
ref|NP_001146336.1|  putative NAC domain transcription factor sup...    192   2e-53   
ref|XP_008662160.1|  PREDICTED: putative NAC domain transcription...    192   2e-53   
ref|XP_006855594.1|  hypothetical protein AMTR_s00044p00058960          193   3e-53   
ref|XP_008662159.1|  PREDICTED: putative NAC domain transcription...    192   3e-53   
gb|AFN55265.1|  NAC domain protein                                      183   3e-53   
ref|NP_001169185.1|  putative NAC domain transcription factor sup...    192   3e-53   
ref|XP_008662161.1|  PREDICTED: putative NAC domain transcription...    192   3e-53   
ref|XP_011013575.1|  PREDICTED: NAC domain-containing protein 74-...    185   3e-53   
ref|XP_011000781.1|  PREDICTED: NAC domain-containing protein 86-...    183   3e-53   
ref|XP_010315723.1|  PREDICTED: NAC domain-containing protein 86-...    190   3e-53   
ref|XP_006400258.1|  hypothetical protein EUTSA_v10013344mg             189   3e-53   
emb|CDY16943.1|  BnaC09g40700D                                          189   3e-53   
ref|XP_008343143.1|  PREDICTED: uncharacterized protein LOC103405...    192   3e-53   
emb|CDX70745.1|  BnaC03g08290D                                          189   3e-53   
ref|XP_011096933.1|  PREDICTED: NAC domain-containing protein 45        191   3e-53   
ref|XP_001753211.1|  predicted protein                                  179   3e-53   
ref|XP_008381391.1|  PREDICTED: uncharacterized protein LOC103444...    192   4e-53   
gb|KGN46789.1|  hypothetical protein Csa_6G135450                       186   4e-53   
ref|XP_010940228.1|  PREDICTED: NAC domain-containing protein 45-...    182   4e-53   
ref|XP_006661516.1|  PREDICTED: NAC domain-containing protein 74-...    182   4e-53   
ref|XP_010420434.1|  PREDICTED: NAC domain-containing protein 86-...    189   4e-53   
ref|XP_010529123.1|  PREDICTED: NAC domain-containing protein 86-...    183   4e-53   
ref|NP_001063877.1|  Os09g0552900                                       181   4e-53   
ref|XP_006430405.1|  hypothetical protein CICLE_v10011293mg             191   5e-53   
ref|XP_006481957.1|  PREDICTED: protein FEZ-like                        191   5e-53   
gb|EMS58787.1|  NAC domain-containing protein 78                        184   5e-53   
ref|XP_010420435.1|  PREDICTED: NAC domain-containing protein 86-...    189   5e-53   
ref|XP_010099671.1|  NAC domain-containing protein 74                   182   5e-53   
ref|XP_011047783.1|  PREDICTED: NAC domain-containing protein 86 ...    182   5e-53   
ref|XP_009370574.1|  PREDICTED: uncharacterized protein LOC103959...    191   5e-53   
gb|EYU32440.1|  hypothetical protein MIMGU_mgv1a007979mg                186   5e-53   
ref|XP_006290189.1|  hypothetical protein CARUB_v10003869mg             188   5e-53   
ref|XP_008227899.1|  PREDICTED: uncharacterized protein LOC103327366    191   5e-53   
ref|XP_002311281.1|  hypothetical protein POPTR_0008s08100g             184   6e-53   
gb|ABR16648.1|  unknown                                                 192   6e-53   
ref|XP_009774486.1|  PREDICTED: NAC domain-containing protein 67-...    186   6e-53   
emb|CBI27341.3|  unnamed protein product                                191   6e-53   
ref|XP_008804874.1|  PREDICTED: NAC domain-containing protein 74        181   6e-53   
ref|XP_010434593.1|  PREDICTED: NAC domain-containing protein 86-...    183   6e-53   
ref|XP_002267333.1|  PREDICTED: NAC domain-containing protein 86        191   6e-53   
ref|XP_009130343.1|  PREDICTED: protein BEARSKIN1 isoform X1            188   6e-53   
ref|XP_004289565.1|  PREDICTED: NAC domain-containing protein 86 ...    191   6e-53   
ref|XP_010935330.1|  PREDICTED: NAC domain-containing protein 86        181   6e-53   
ref|XP_007215001.1|  hypothetical protein PRUPE_ppa002384mg             191   7e-53   
emb|CDP12993.1|  unnamed protein product                                184   7e-53   
ref|XP_010501258.1|  PREDICTED: NAC domain-containing protein 86-...    183   7e-53   
ref|XP_010507160.1|  PREDICTED: NAC domain-containing protein 45        187   7e-53   
ref|NP_186970.2|  NAC domain containing protein 45                      188   7e-53   
ref|XP_009128881.1|  PREDICTED: NAC domain-containing protein 74-...    183   7e-53   
ref|XP_002865174.1|  ANAC096                                            183   7e-53   
ref|XP_009367106.1|  PREDICTED: uncharacterized protein LOC103956792    191   7e-53   
ref|XP_002884362.1|  predicted protein                                  188   7e-53   
ref|XP_006847701.1|  hypothetical protein AMTR_s00149p00068500          185   7e-53   
emb|CDY59580.1|  BnaA02g36760D                                          183   8e-53   
gb|KJB22460.1|  hypothetical protein B456_004G048200                    190   8e-53   
gb|AIA57517.1|  NAC domain-containing protein                           183   8e-53   
ref|XP_010318339.1|  PREDICTED: NAC domain-containing protein 86 ...    181   8e-53   
ref|XP_006297561.1|  hypothetical protein CARUB_v10013584mg             187   8e-53   
ref|XP_006409228.1|  hypothetical protein EUTSA_v10023058mg             187   8e-53   
ref|XP_009401257.1|  PREDICTED: NAC domain-containing protein 72-...    185   9e-53   
ref|XP_010105605.1|  NAC domain-containing protein 78                   187   9e-53   
ref|XP_010463767.1|  PREDICTED: NAC domain-containing protein 45        187   9e-53   
ref|XP_010453910.1|  PREDICTED: NAC domain-containing protein 86-...    188   9e-53   
ref|XP_010663930.1|  PREDICTED: NAC domain-containing protein 86 ...    181   1e-52   
ref|XP_010485657.1|  PREDICTED: NAC domain-containing protein 45-...    187   1e-52   
ref|XP_009598687.1|  PREDICTED: uncharacterized protein LOC104094...    189   1e-52   
ref|XP_004490776.1|  PREDICTED: uncharacterized protein LOC101514...    189   1e-52   
ref|XP_010480185.1|  PREDICTED: NAC domain-containing protein 86-...    183   1e-52   
ref|XP_009119137.1|  PREDICTED: protein BEARSKIN1-like                  187   1e-52   
ref|XP_006858416.1|  hypothetical protein AMTR_s00071p00055960          189   1e-52   
ref|XP_011076898.1|  PREDICTED: NAC domain-containing protein 78-...    185   1e-52   
gb|EPS65704.1|  nam-like protein 4                                      180   1e-52   
emb|CDY63046.1|  BnaA06g40380D                                          182   1e-52   
ref|XP_010462486.1|  PREDICTED: NAC domain-containing protein 86-...    182   1e-52   
ref|XP_002316156.1|  hypothetical protein POPTR_0010s18180g             184   2e-52   
ref|XP_010062323.1|  PREDICTED: NAC domain-containing protein 78        190   2e-52   
ref|XP_007032209.1|  NAC domain protein, IPR003441, putative isof...    189   2e-52   
ref|XP_011014226.1|  PREDICTED: NAC transcription factor 29-like        183   2e-52   
gb|EYU27595.1|  hypothetical protein MIMGU_mgv1a026788mg                183   2e-52   
gb|KCW69453.1|  hypothetical protein EUGRSUZ_F02910                     189   2e-52   
gb|AHJ79162.1|  NAC domain protein NAC21                                182   2e-52   
gb|EPS65413.1|  hypothetical protein M569_09365                         183   2e-52   
ref|XP_008812440.1|  PREDICTED: NAC domain-containing protein 74-...    180   2e-52   
ref|XP_004135638.1|  PREDICTED: NAC transcription factor ONAC010-...    179   2e-52   
dbj|BAJ90716.1|  predicted protein                                      181   2e-52   
ref|XP_006352840.1|  PREDICTED: NAC domain-containing protein 72-...    183   2e-52   
ref|XP_009382805.1|  PREDICTED: uncharacterized protein LOC103970...    189   3e-52   
ref|XP_006391326.1|  hypothetical protein EUTSA_v10018275mg             189   3e-52   
gb|KJB37104.1|  hypothetical protein B456_006G189600                    180   3e-52   
ref|XP_009382806.1|  PREDICTED: uncharacterized protein LOC103970...    189   3e-52   
emb|CDY49932.1|  BnaCnng18420D                                          186   3e-52   
ref|XP_004957583.1|  PREDICTED: NAC domain-containing protein 74-...    179   3e-52   
ref|XP_009400096.1|  PREDICTED: NAC domain-containing protein 72-...    182   3e-52   
emb|CDP01698.1|  unnamed protein product                                189   3e-52   
gb|AAM34774.1|AF509874_1  nam-like protein 11                           182   3e-52   
ref|XP_010940229.1|  PREDICTED: NAC domain-containing protein 45-...    179   3e-52   
ref|XP_009382804.1|  PREDICTED: uncharacterized protein LOC103970...    189   3e-52   
ref|XP_003549977.1|  PREDICTED: NAC domain-containing protein 78-...    182   4e-52   
ref|XP_002888465.1|  predicted protein                                  188   4e-52   
ref|XP_009382803.1|  PREDICTED: uncharacterized protein LOC103970...    189   4e-52   
gb|EAZ10016.1|  hypothetical protein OsI_32319                          183   4e-52   
ref|XP_010559290.1|  PREDICTED: NAC domain-containing protein 86-...    181   4e-52   
ref|XP_010316554.1|  PREDICTED: NAC domain-containing protein 86 ...    185   5e-52   
ref|XP_009127458.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    188   5e-52   
ref|XP_009355961.1|  PREDICTED: protein BEARSKIN1                       180   5e-52   
ref|XP_002526579.1|  hypothetical protein RCOM_1603380                  188   5e-52   
ref|XP_006436533.1|  hypothetical protein CICLE_v10031606mg             184   5e-52   
ref|NP_176766.1|  NAC domain containing protein 28                      188   5e-52   
ref|XP_010449530.1|  PREDICTED: NAC domain-containing protein 86-...    181   5e-52   
ref|XP_010528600.1|  PREDICTED: NAC domain-containing protein 86 ...    188   5e-52   
ref|XP_010104346.1|  NAC domain-containing protein 74                   182   6e-52   
ref|XP_006282042.1|  hypothetical protein CARUB_v10028284mg             181   6e-52   
ref|XP_010528598.1|  PREDICTED: NAC domain-containing protein 86 ...    187   6e-52   
ref|XP_008465949.1|  PREDICTED: NAC domain-containing protein 67-...    182   6e-52   
emb|CDX87703.1|  BnaC02g32460D                                          181   6e-52   
ref|XP_004157266.1|  PREDICTED: NAC transcription factor ONAC010-...    177   7e-52   
ref|XP_004171745.1|  PREDICTED: NAC domain-containing protein 74-...    176   7e-52   
ref|XP_007146987.1|  hypothetical protein PHAVU_006G087000g             188   7e-52   
ref|XP_007039543.1|  NAC domain protein, IPR003441                      182   8e-52   
ref|XP_010694967.1|  PREDICTED: NAC domain-containing protein 86-...    187   8e-52   
ref|XP_010494839.1|  PREDICTED: NAC domain-containing protein 86-...    180   8e-52   
ref|XP_003616168.1|  NAC domain protein                                 187   8e-52   
ref|XP_002460635.1|  hypothetical protein SORBIDRAFT_02g032220          179   9e-52   
ref|XP_010549796.1|  PREDICTED: NAC domain-containing protein 45 ...    185   9e-52   
ref|NP_199471.1|  NAC domain containing protein 96                      180   9e-52   
ref|XP_010549797.1|  PREDICTED: NAC domain-containing protein 45 ...    185   1e-51   
ref|XP_010275272.1|  PREDICTED: NAC domain-containing protein 45-...    182   1e-51   
ref|XP_010415136.1|  PREDICTED: NAC domain-containing protein 86-...    187   1e-51   
ref|XP_009136888.1|  PREDICTED: NAC domain-containing protein 78        180   1e-51   
ref|XP_011101542.1|  PREDICTED: NAC domain-containing protein 78 ...    183   1e-51   



>gb|AGY49286.1| putative membrane bound NAC transcription factor 1 [Nicotiana 
benthamiana]
Length=630

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   VAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPDMS VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I+++KGAK+GM
Sbjct  71   WDLPDMSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAKIGM  130

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+H GQ  FVLCRLF+K +LK D   E
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNDLKQDEHVE  189



>ref|XP_009608176.1| PREDICTED: uncharacterized protein LOC104102223 [Nicotiana tomentosiformis]
Length=636

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPDMS VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  71   WDLPDMSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  130

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+H GQ  FVLCRLFRK +LK D   E
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFRKNDLKQDEHVE  189



>ref|NP_001274765.1| uncharacterized LOC102593794 [Solanum tuberosum]
 gb|AGY49284.1| putative membrane bound NAC transcription factor 1 [Solanum tuberosum]
Length=639

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G++++VSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEP  70

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPD+S VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  71   WDLPDLSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  130

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRTHWVIHEYR TE   DG+H GQ  FVLCRLFRK +LK D   E
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATEKSLDGSHPGQGAFVLCRLFRKNDLKQDEHVE  189



>ref|XP_010318064.1| PREDICTED: uncharacterized protein LOC101253566 [Solanum lycopersicum]
Length=644

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +AVL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G++++VSVIREVDICK EP
Sbjct  11   IAVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEP  70

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPD+S VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I ++KG+K+GM
Sbjct  71   WDLPDLSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGSKIGM  130

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLVYY+GRAPEGKRTHWVIHEYR TE   DG+H GQ  FVLCRLFRK +LK D
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATEKSLDGSHPGQGAFVLCRLFRKNDLKQD  185



>ref|XP_009759914.1| PREDICTED: uncharacterized protein LOC104212382 [Nicotiana sylvestris]
Length=640

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            ++VL V++  G+PPL++LPVGYRFRPTDEELV+HYL++KI G+++EVSVIREVDICK EP
Sbjct  11   ISVLPVDKQMGIPPLNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEP  70

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPDMS VES DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I+++KGAK+GM
Sbjct  71   WDLPDMSVVESKDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAKIGM  130

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRTHWVIHEYR T+   DG+H GQ  FVLCRLF+K +LK D   E
Sbjct  131  KKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNDLKQDEHVE  189



>gb|AAM47025.1| nam-like protein 1 [Petunia x hybrida]
Length=585

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  112  MAVLKVERPTG---------LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIR  264
            MAVL  E P           +PPL+SLPVGYRFRPTDEELV+HYL++KI G++ EVSVIR
Sbjct  1    MAVLPGENPIAVHNNKEMGKIPPLNSLPVGYRFRPTDEELVNHYLRLKINGADNEVSVIR  60

Query  265  EVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS  444
            EVDICK EPWDLP  S VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I 
Sbjct  61   EVDICKLEPWDLPIWSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIV  120

Query  445  SRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            ++KGAK+GMKKTLVYY+GRAPEGKRTHWVIHEYR T+   DGTH GQ  F+LCRLFRK +
Sbjct  121  TKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGTHPGQGAFLLCRLFRKND  180

Query  625  LKLDXGAE  648
            LK D   E
Sbjct  181  LKQDEHVE  188



>ref|XP_009760821.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Nicotiana 
sylvestris]
Length=418

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +A L V +  G+PPL++LPVGYRFRPTDEELV+HYL++KI G   +V+VIREVDICK EP
Sbjct  10   IAGLPVGKHLGVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEP  69

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATE+GYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAKIGM  129

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+H GQ  FVLCRLF+K ELK D   E
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGSHTGQGAFVLCRLFKKNELKQDENVE  188



>ref|XP_011075874.1| PREDICTED: NAC domain-containing protein 45 [Sesamum indicum]
Length=623

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ +LPVGYRFRPTDEEL+DHYL++KI G   EVSVIRE+D+CK EPWDLPD+S +ES D
Sbjct  5    PVKALPVGYRFRPTDEELIDHYLRLKINGRHKEVSVIREIDVCKWEPWDLPDLSVIESTD  64

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
            NEWFFFCPKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKGAK+GMKKTLV+Y GRAP+
Sbjct  65   NEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAKIGMKKTLVFYTGRAPD  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            GKRT+WVIHEYR T+   DGTH GQ  FVLCRLF+K +LK D  AE
Sbjct  125  GKRTNWVIHEYRATDKSLDGTHPGQGAFVLCRLFKKTDLKQDEIAE  170



>ref|XP_006347316.1| PREDICTED: uncharacterized protein LOC102605066 [Solanum tuberosum]
Length=630

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            M V  V     +PPL++LP+GYRFRPTDEEL++HYL +KI G   +V VIRE+DICK EP
Sbjct  1    MTVPPVGNQVEVPPLNTLPIGYRFRPTDEELINHYLCLKINGCHNQVDVIREIDICKFEP  60

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPD+S VES+DNEW +FCP DRKYQNGQRLNRATERGYWKATGKDR I++RKGAK+GM
Sbjct  61   WDLPDLSVVESNDNEWLYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAKIGM  120

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+H GQ  FVLCRLF+K ELK D   E
Sbjct  121  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNELKQDENVE  179



>ref|XP_009760820.1| PREDICTED: uncharacterized protein LOC104213101 isoform X1 [Nicotiana 
sylvestris]
Length=645

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +A L V +  G+PPL++LPVGYRFRPTDEELV+HYL++KI G   +V+VIREVDICK EP
Sbjct  10   IAGLPVGKHLGVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEP  69

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATE+GYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAKIGM  129

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+H GQ  FVLCRLF+K ELK D   E
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGSHTGQGAFVLCRLFKKNELKQDENVE  188



>ref|XP_009596681.1| PREDICTED: NAC domain-containing protein 74-like [Nicotiana tomentosiformis]
Length=638

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            +AVL   +   +PPL++LPVGYRFRPTDEELV+HYL++KI G + +V VIREVDICK EP
Sbjct  10   IAVLPGGKQLEVPPLNTLPVGYRFRPTDEELVNHYLRLKINGCDDKVGVIREVDICKFEP  69

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
             DLPD+S VES DN+WFFFCP DRKYQNGQRLNRATERGYWKATGKDR I ++KGAK+GM
Sbjct  70   SDLPDLSVVESKDNDWFFFCPIDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAKIGM  129

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KKTLVYY+GRAPEGKRT+WVIHEYR T+   DG+H GQ  FVLCRLF+K ELK D   E
Sbjct  130  KKTLVYYIGRAPEGKRTNWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNELKQDENVE  188



>gb|EYU45332.1| hypothetical protein MIMGU_mgv1a003123mg [Erythranthe guttata]
Length=606

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P  +LPVGYRFRPTDEEL+DHYL++KI   + +VSVIRE+D+CK EPWDLPDMS +ES D
Sbjct  5    PAKALPVGYRFRPTDEELIDHYLRLKINRHDKDVSVIREIDVCKWEPWDLPDMSVIESFD  64

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
            NEWFFFCPKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKGAK+GMKKTLV+Y GRAP+
Sbjct  65   NEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAKIGMKKTLVFYTGRAPD  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            GKRT+WVIHEYR T+   DGTH GQ  FVL RLFRK ELK D  AE
Sbjct  125  GKRTNWVIHEYRATDKSLDGTHPGQGAFVLLRLFRKAELKQDEIAE  170



>ref|XP_004241429.1| PREDICTED: uncharacterized protein LOC101257973 [Solanum lycopersicum]
Length=595

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  145  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES  324
            +PPL++LP+GYRFRPTDEEL++HYL +KI G   +V VIRE+DICK EPWDLPD+S VES
Sbjct  13   VPPLNTLPIGYRFRPTDEELINHYLCLKINGCHDQVGVIREIDICKFEPWDLPDLSVVES  72

Query  325  HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRA  504
            +DNEWF+FCP DRKYQNGQRLNRATERGYWKATGKDR I++RKGAK+GMKKTLVYY GRA
Sbjct  73   NDNEWFYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAKIGMKKTLVYYNGRA  132

Query  505  PEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            PEGKRT+WVIHEYR T+   DG+  GQ  FVLCRLF+K ELK
Sbjct  133  PEGKRTNWVIHEYRATDKSLDGSRPGQGAFVLCRLFKKNELK  174



>gb|EPS67213.1| hypothetical protein M569_07559 [Genlisea aurea]
Length=790

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 7/175 (4%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL         P  ++PVGYRFRPTDEEL+DHYL++KI G E EV VIRE+D+CK EP
Sbjct  1    MAVLPA-------PARTMPVGYRFRPTDEELIDHYLRLKINGHEREVCVIREIDVCKWEP  53

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPD+S +ES DNEWFFF PKDRKYQNGQRLNRATE+GYWKATGKDR I+SRKG+K+GM
Sbjct  54   WDLPDLSVIESSDNEWFFFSPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGSKIGM  113

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAPEGKRT+WVIHEYR T+   DGTH GQ  FVLCRLF+K+E+KLD
Sbjct  114  KKTLVFYTGRAPEGKRTNWVIHEYRATDKSLDGTHPGQGAFVLCRLFKKMEIKLD  168



>emb|CDP04976.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+  LPVGYRFRPTDEEL+DHYL++KI G + +VS+IREVDICK EPWDLPD+S ++S+D
Sbjct  6    PVKQLPVGYRFRPTDEELIDHYLRLKINGLDKDVSIIREVDICKKEPWDLPDLSPIKSYD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
            NEWFFFCPKDRKYQNGQRLNRAT +GYWKATGKDR I +RKG K+GMKKTLV+Y+GRAP+
Sbjct  66   NEWFFFCPKDRKYQNGQRLNRATMKGYWKATGKDRNIRARKGTKIGMKKTLVFYIGRAPD  125

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            GKRT+WVIHEYR T  + DGTH GQ  FVLCRLF+K ELK D  A+
Sbjct  126  GKRTNWVIHEYRATNKELDGTHPGQGSFVLCRLFKKHELKQDETAD  171



>gb|AGT96630.1| NAC transcription factor [Suaeda liaotungensis]
Length=336

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  112  MAVLKVERPTGLP-PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  288
            M  L +  P  L  P  +LP+G+RF+PTD EL+DHYL++KI G E +V+ I+EVDICK E
Sbjct  1    MGALIIREPGALSTPFETLPLGFRFKPTDVELIDHYLRLKINGKEDDVACIKEVDICKVE  60

Query  289  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  468
            PWDLPD+S ++++D+EWF+FCP+DRKY NGQR NRATE GYWKATGKDRTI SRK  ++G
Sbjct  61   PWDLPDLSAIQTNDHEWFYFCPRDRKYPNGQRSNRATEAGYWKATGKDRTIKSRKLGEIG  120

Query  469  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV  621
            MKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+H GQ  FVLCRLF+K 
Sbjct  121  MKKTLVFYTGRAPKGQRTHWVIHEYRTTLEELDGSHPGQGAFVLCRLFKKA  171



>gb|AGV29473.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=547

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P  +LP+G+RF+PTD EL+DHYL++KI G+  +VSVIREVD+CK EPWDLPD+S ++S D
Sbjct  5    PFQNLPLGFRFKPTDVELIDHYLRLKIKGNHRDVSVIREVDVCKVEPWDLPDLSMIKSPD  64

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
            +EWFFFC +DRKY NGQR NRATE+GYWKATGKDR I SRK   +GMKKTLV+Y GRAP+
Sbjct  65   HEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRIVSRKMGLIGMKKTLVFYRGRAPK  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            GKRTHWVIHEYRTT ++ DGTH GQ  +V+CRLF K E
Sbjct  125  GKRTHWVIHEYRTTLDELDGTHPGQGSYVICRLFEKQE  162



>gb|AGL39710.1| NAC transcription factor 054 [Jatropha curcas]
 gb|KDP37577.1| hypothetical protein JCGZ_08268 [Jatropha curcas]
Length=573

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELV++YL++KI G++ EV VIRE+D+CK EPWDLPD+S ++++D 
Sbjct  6    LNSLPLGFRFRPTDEELVNYYLRLKINGNDREVRVIRELDVCKWEPWDLPDLSNIQTNDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP DRKY NG RLNRAT +GYWKATGKDR I S     +GMKKTLV+Y GRAP G
Sbjct  66   EWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPRG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRTHWVIHEYR TE++ DGT  GQ+PFV+CRLF+K +  +D   E
Sbjct  125  KRTHWVIHEYRATEDELDGTKPGQSPFVICRLFKKQDDTVDLNLE  169



>ref|XP_010671303.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=608

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  112  MAVLKVERPTGLP----PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDIC  279
            M  L VE+   +     P   LP+G+RF+PTD EL+DHYL++KI G + EV+ I EVDIC
Sbjct  1    MGALAVEKSGKMEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDIC  60

Query  280  KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA  459
            + EPWDLP +SF++S D+EWFFFCP+DRKY NGQR NRATE GYWKATGKDR+I SRK  
Sbjct  61   RVEPWDLPGLSFIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRKMG  120

Query  460  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV  621
             +GMKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+H GQ  FVLCRLF+K 
Sbjct  121  LIGMKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGSHPGQGAFVLCRLFKKA  174



>ref|XP_002317040.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|EEE97652.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=667

 Score =   250 bits (638),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP GKRT+WV+HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPE  167



>ref|XP_010671302.1| PREDICTED: uncharacterized protein LOC104888129 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=637

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  112  MAVLKVERPTGLP----PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDIC  279
            M  L VE+   +     P   LP+G+RF+PTD EL+DHYL++KI G + EV+ I EVDIC
Sbjct  1    MGALAVEKSGKMEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDIC  60

Query  280  KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA  459
            + EPWDLP +SF++S D+EWFFFCP+DRKY NGQR NRATE GYWKATGKDR+I SRK  
Sbjct  61   RVEPWDLPGLSFIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRKMG  120

Query  460  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV  621
             +GMKKTLV+Y GRAP+G+RTHWVIHEYRTT  + DG+H GQ  FVLCRLF+K 
Sbjct  121  LIGMKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGSHPGQGAFVLCRLFKKA  174



>ref|XP_006377879.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55676.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=672

 Score =   249 bits (636),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP GKRT+WV+HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPE  167



>ref|XP_006377880.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55677.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=697

 Score =   249 bits (636),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP GKRT+WV+HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPE  167



>ref|XP_010045303.1| PREDICTED: uncharacterized protein LOC104434047 [Eucalyptus grandis]
 gb|KCW88592.1| hypothetical protein EUGRSUZ_A00969 [Eucalyptus grandis]
Length=597

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            PL+SLP+G+RFRPTD+EL+DHYL++KI G + EV VIREVD+CK EPWDLPD+S +ES D
Sbjct  5    PLNSLPLGFRFRPTDQELIDHYLRLKINGRDREVRVIREVDVCKVEPWDLPDLSAIESRD  64

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I   +   +GMKKTLV+Y GRAP+
Sbjct  65   PEWFFFCPRDRKYPNGHRLNRATTAGYWKATGKDRKIKLGRDL-IGMKKTLVFYTGRAPK  123

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT  + DGTH GQ  FVLCRLFRK +  L+
Sbjct  124  GKRTYWVMHEYRTTLEELDGTHPGQGAFVLCRLFRKQDETLE  165



>gb|AIA57510.1| NAC domain-containing protein [Boehmeria nivea]
Length=502

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 136/170 (80%), Gaps = 10/170 (6%)
 Frame = +1

Query  109  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  288
            EM+VL          L+SLP+G+RFRPTDEELVD+YL+ KI G + +VSVIRE+D+CK E
Sbjct  5    EMSVLS---------LNSLPLGFRFRPTDEELVDYYLRFKINGVDEQVSVIREIDVCKWE  55

Query  289  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  468
            PWDLPD+S++ + D+EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S    ++G
Sbjct  56   PWDLPDLSYIPTRDHEWFFFCPQDRKYPNGNRLNRATSKGYWKATGKDRKIKSGT-REIG  114

Query  469  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            MKKTLV+Y GRAP+G RT+WV+HEYR T  +  GT+ GQ+PFVLCRLF+K
Sbjct  115  MKKTLVFYTGRAPKGTRTYWVMHEYRATLKELSGTNPGQSPFVLCRLFKK  164



>gb|KJB52429.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=782

 Score =   246 bits (628),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 104/159 (65%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D EW
Sbjct  8    TLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDLEW  67

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            FFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G+R
Sbjct  68   FFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKGER  126

Query  520  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            T+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  127  TNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRND  165



>ref|XP_011004356.1| PREDICTED: uncharacterized protein LOC105110869 isoform X6 [Populus 
euphratica]
Length=669

 Score =   244 bits (623),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>ref|XP_002521312.1| transcription factor, putative [Ricinus communis]
 gb|EEF41086.1| transcription factor, putative [Ricinus communis]
Length=597

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELV+ YL++KI G++ +V VIRE+D+CK EPWDLPDMS ++++D 
Sbjct  6    LNSLPLGFRFRPTDEELVNFYLRLKINGNDKDVRVIRELDVCKWEPWDLPDMSIIKTNDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP DRKY NG RLNRAT +GYWKATGKDR I S     +GMKKTLV+Y GRAP G
Sbjct  66   EWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIKS-GNTLIGMKKTLVFYTGRAPRG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
             RTHWVIHEYR TE+  DGT  GQ PFV+CRLF+K
Sbjct  125  TRTHWVIHEYRATEDDLDGTKPGQNPFVICRLFKK  159



>gb|KCW72635.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=628

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  + +LP+G+RFRPTDEEL+ HYL++KI G  +EV VI E+D+CK EPWDLPD+S ++
Sbjct  2    GVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAK---VGMKKTLV  486
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK  GA    +GMKKTLV
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAGLIGMKKTLV  121

Query  487  YYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            +Y GRAP+G+RTHW++HEYR TE   DGT  GQA +VLCRLFRK E K
Sbjct  122  FYRGRAPKGERTHWIMHEYRATEQDLDGTGPGQAAYVLCRLFRKAEEK  169



>gb|KHG02383.1| NAC domain-containing 74 [Gossypium arboreum]
Length=876

 Score =   247 bits (631),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 104/161 (65%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    METLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +RT+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  125  ERTNWIMHEYRPTTRELDGTAPGQSAFVLCRLFHKVEGRND  165



>ref|XP_011004351.1| PREDICTED: uncharacterized protein LOC105110869 isoform X2 [Populus 
euphratica]
Length=678

 Score =   243 bits (621),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>gb|KJB52427.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=790

 Score =   245 bits (625),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 104/159 (65%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D EW
Sbjct  8    TLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDLEW  67

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            FFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G+R
Sbjct  68   FFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKGER  126

Query  520  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            T+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  127  TNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRND  165



>ref|XP_003615518.1| NAC domain protein [Medicago truncatula]
Length=392

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK EPWDLPD+S V + D 
Sbjct  22   LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIVRNKDP  81

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +GMKKTLV+Y GRAP+
Sbjct  82   EWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLIGMKKTLVFYAGRAPK  139

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            G+RTHW++HEYR T  + DGT+ GQ P+VLCRLF+K +  L
Sbjct  140  GQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESL  180



>ref|XP_011004350.1| PREDICTED: uncharacterized protein LOC105110869 isoform X1 [Populus 
euphratica]
Length=699

 Score =   243 bits (621),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>ref|XP_010056056.1| PREDICTED: uncharacterized protein LOC104444143 [Eucalyptus grandis]
 gb|KCW72636.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=656

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 132/168 (79%), Gaps = 5/168 (3%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  + +LP+G+RFRPTDEEL+ HYL++KI G  +EV VI E+D+CK EPWDLPD+S ++
Sbjct  2    GVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-----VGMKKTLV  486
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK        +GMKKTLV
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAGLIGMKKTLV  121

Query  487  YYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            +Y GRAP+G+RTHW++HEYR TE   DGT  GQA +VLCRLFRK E K
Sbjct  122  FYRGRAPKGERTHWIMHEYRATEQDLDGTGPGQAAYVLCRLFRKAEEK  169



>gb|KJB52428.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=859

 Score =   245 bits (626),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 104/159 (65%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D EW
Sbjct  8    TLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDLEW  67

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            FFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G+R
Sbjct  68   FFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKGER  126

Query  520  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            T+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  127  TNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRND  165



>emb|CAN73792.1| hypothetical protein VITISV_034893 [Vitis vinifera]
Length=720

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 153/216 (71%), Gaps = 17/216 (8%)
 Frame = +1

Query  10   CFISVFLLKNTGRH--IRISLPPS-----LFLSLCELCGVEMAVLKVERPTGLPPLHSLP  168
            CF+S   +++  RH  +  SL PS     +  +L  L    MAVL           +SLP
Sbjct  35   CFLSALEVESDVRHLCVATSLGPSHNPFYIPSTLLLLNFPRMAVLS---------FNSLP  85

Query  169  VGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFF  348
            +G+RFRPTDEEL+ HYL++KI+G++ EV VIRE+D+CK EPWDLPD+S + ++D EWFFF
Sbjct  86   LGFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEIRTNDMEWFFF  145

Query  349  CPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHW  528
            CP+DRKY NG RLNRAT  GYWKATG+DR I S K   VGMKKTLV++ GRAP GKRT W
Sbjct  146  CPRDRKYPNGHRLNRATAAGYWKATGRDRQIKS-KTRLVGMKKTLVFHTGRAPHGKRTVW  204

Query  529  VIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            V+HEYR T  + DGTH GQA FVLCRLF+K + K +
Sbjct  205  VMHEYRATAKELDGTHPGQAAFVLCRLFKKQDEKAE  240



>ref|NP_001280864.1| uncharacterized LOC103438687 [Malus domestica]
 gb|ADL36810.1| NAC domain class transcription factor [Malus domestica]
Length=850

 Score =   245 bits (625),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 7/168 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQVGMKKTLVFY  125

Query  493  LGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             GRAP+G+RT W++HEYR T+ + DGT  GQ  FVLCRLF K E K D
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGTGPGQGAFVLCRLFHKPEEKAD  173



>ref|XP_010103069.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB94718.1| NAC domain-containing protein 78 [Morus notabilis]
Length=602

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 135/170 (79%), Gaps = 9/170 (5%)
 Frame = +1

Query  109  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  288
            EMAVL          L+SLP+G+RFRPTDEELVD+YL++KI G    VSVIRE+D+CK E
Sbjct  5    EMAVLSS--------LNSLPLGFRFRPTDEELVDYYLRLKINGEVQLVSVIREIDVCKLE  56

Query  289  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  468
            PWDLPD+S + + D EWFFFCP+DRKY NG RLNRAT+ GYWKATG+DR I S    ++G
Sbjct  57   PWDLPDLSMIPTRDPEWFFFCPQDRKYPNGHRLNRATKAGYWKATGRDRKIKSGT-LQIG  115

Query  469  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            MKKTLV+Y GRAP+GKRT+WV+HEYR T  + DGT+ GQ+PFVLCRLF+K
Sbjct  116  MKKTLVFYTGRAPKGKRTNWVMHEYRPTLQELDGTNPGQSPFVLCRLFKK  165



>ref|XP_007210371.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
 gb|EMJ11570.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
Length=862

 Score =   244 bits (623),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 107/168 (64%), Positives = 128/168 (76%), Gaps = 7/168 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVIKSDDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSTGQVGMKKTLVFY  125

Query  493  LGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             GRAP G+RT W++HEYR T+   DGT  GQ  FVLCRLF K E K D
Sbjct  126  RGRAPRGERTSWIMHEYRATQKDLDGTAPGQGAFVLCRLFHKPEEKAD  173



>ref|XP_006441281.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54521.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=509

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_006441278.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54518.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=510

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|NP_001280863.1| uncharacterized LOC103439966 [Malus domestica]
 gb|ADL36794.1| NAC domain class transcription factor [Malus domestica]
Length=541

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            ++SLP+G+RFRPTD EL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  6    MNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT RGYWKATGKDR I S K   +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDK-ILIGMKKTLVFHIGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            KRT+WV+HEYR T+ + DGT+ GQ+ FVLCRLF+K
Sbjct  125  KRTNWVMHEYRATQKELDGTNPGQSSFVLCRLFKK  159



>ref|XP_009360232.1| PREDICTED: uncharacterized protein LOC103950728 [Pyrus x bretschneideri]
Length=854

 Score =   244 bits (622),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 7/168 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQVGMKKTLVFY  125

Query  493  LGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             GRAP+G+RT W++HEYR T+ + DGT  GQ  FVLCRLF K E K D
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGTGPGQGAFVLCRLFHKPEEKAD  173



>ref|XP_009361256.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            ++SLP+G+RFRPTD EL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  6    MNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTTDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            KRT+WV+HEYRTT+ + DGT+ GQ+ FVLCRLF+K
Sbjct  125  KRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKK  159



>ref|XP_010104895.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXC02131.1| NAC domain-containing protein 78 [Morus notabilis]
Length=744

 Score =   241 bits (616),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 108/172 (63%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   L SLP+G+RFRPTDEEL++HYL++KI G  A+V VI E+D+CK EPWDLP  S ++
Sbjct  2    GTVSLESLPLGFRFRPTDEELINHYLRLKINGRNADVHVIPEIDVCKREPWDLPRQSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKT  480
            + D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SR           +GMKKT
Sbjct  62   TDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRSYRSASNTNGLIGMKKT  121

Query  481  LVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            LV+Y GRAP+G+RT+W++HEYR T    DGT  GQ  FVLCRLFRK E K D
Sbjct  122  LVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQEAFVLCRLFRKPEEKSD  173



>ref|XP_008381552.1| PREDICTED: uncharacterized protein LOC103444404 [Malus domestica]
Length=554

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLPD+S +++ D 
Sbjct  11   MDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPDLSVIQTTDP  70

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            +WFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  71   QWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            KRT+WV+HEYRTT+ + DGT+ GQ+ FVLCRLF+K
Sbjct  130  KRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKK  164



>gb|AGV29497.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=233

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P  +LP+G+RF+PTD EL+DHYL+ K+ G E +VSVI EVD+CK EPWDLP +S +ES D
Sbjct  5    PFQNLPLGFRFKPTDVELIDHYLRRKVNGYEKDVSVIGEVDVCKVEPWDLPALSKIESPD  64

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
            +EWFFFC +DRKY NGQR NRATE+GYWKATGKDR I+ +K   +GMKKTLV+Y GRAP+
Sbjct  65   HEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRITKKKSL-IGMKKTLVFYQGRAPK  123

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            GKR++WVIHEYRTT  + DGT+ GQ  +V+CRL +K E
Sbjct  124  GKRSNWVIHEYRTTLPELDGTNPGQGAYVICRLMKKQE  161



>ref|XP_006377878.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55675.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=647

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP GKRT+WV+HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  126  RAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPE  167



>ref|XP_006441279.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54519.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=605

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_006441280.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54520.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=604

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_008245853.1| PREDICTED: uncharacterized protein LOC103344010, partial [Prunus 
mume]
Length=826

 Score =   242 bits (618),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 7/168 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVIKSDDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV++
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSTGQVGMKKTLVFH  125

Query  493  LGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             GRAP G+RT W++HEYR T+   DGT  GQ  FVLCRLF K E K D
Sbjct  126  RGRAPRGERTSWIMHEYRATQKDLDGTAPGQGAFVLCRLFHKPEEKAD  173



>ref|XP_008234624.1| PREDICTED: NAC domain-containing protein 7-like [Prunus mume]
Length=548

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 10/177 (6%)
 Frame = +1

Query  106  VEMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKH  285
            V+M VL           ++LP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK 
Sbjct  4    VDMTVLST---------NTLPLGFRFRPTDEELIDYYLRSKINGNHKQVTVIREIDVCKW  54

Query  286  EPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV  465
            EPWDLPD+S + + D EWFFFCP+DRKY NG RLNRAT RGYWKATGKDR I S     +
Sbjct  55   EPWDLPDLSVIRTTDPEWFFFCPQDRKYPNGHRLNRATGRGYWKATGKDRQIKS-ATILI  113

Query  466  GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GMKKTLV++ GRAP+GKRT+WV+HEYRTT+ + DGT+ GQ PFVLCRLF+K +  ++
Sbjct  114  GMKKTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGTNPGQNPFVLCRLFKKQDETIE  170



>gb|KDO44489.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=605

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>gb|KDO44488.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=604

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_006478082.1| PREDICTED: NAC domain-containing protein 69-like isoform X3 [Citrus 
sinensis]
Length=604

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_006478081.1| PREDICTED: NAC domain-containing protein 69-like isoform X2 [Citrus 
sinensis]
Length=605

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_006478080.1| PREDICTED: NAC domain-containing protein 69-like isoform X1 [Citrus 
sinensis]
Length=610

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEELVD YL+MKI G   EVSVI E+D+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVIKTKDR  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+++GRAP+G
Sbjct  66   EWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIKSGNHL-IGMKKTLVFHMGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
            KRT+WV+HEYR T +  DGT  GQ+ FVLCRLF+K +  ++   E
Sbjct  125  KRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVE  169



>ref|XP_010662939.1| PREDICTED: NAC domain-containing protein 77 [Vitis vinifera]
 emb|CBI23105.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
             +SLP+G+RFRPTDEEL+ HYL++KI+G++ EV VIRE+D+CK EPWDLPD+S + ++D 
Sbjct  6    FNSLPLGFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEIRTNDM  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATG+DR I S K   VGMKKTLV++ GRAP G
Sbjct  66   EWFFFCPRDRKYPNGHRLNRATAAGYWKATGRDRQIKS-KTRLVGMKKTLVFHTGRAPHG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KRT WV+HEYR T  + DGTH GQA FVLCRLF+K + K +
Sbjct  125  KRTVWVMHEYRATAKELDGTHPGQAAFVLCRLFKKQDEKAE  165



>ref|XP_008360722.1| PREDICTED: uncharacterized protein LOC103424418 [Malus domestica]
Length=859

 Score =   242 bits (617),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 104/168 (62%), Positives = 130/168 (77%), Gaps = 7/168 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S ++S D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGHDSEVQVIPEIDVCRWEPWDLPKLSVIKSDDQ  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKTLVYY  492
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+         +VGMKKTLV+Y
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKFATNSNGQVGMKKTLVFY  125

Query  493  LGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             GRAP+G+RT W++HEYR T+ + DGT   Q  FVLCRLF K E K D
Sbjct  126  RGRAPKGERTSWIMHEYRATQKELDGTAPSQGAFVLCRLFHKPEEKAD  173



>ref|XP_003615517.1| NAC domain protein [Medicago truncatula]
 gb|AES98475.1| NAC transcription factor-like protein [Medicago truncatula]
Length=630

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK EPWDLPD+S V + D 
Sbjct  22   LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIVRNKDP  81

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +GMKKTLV+Y GRAP+
Sbjct  82   EWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLIGMKKTLVFYAGRAPK  139

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            G+RTHW++HEYR T  + DGT+ GQ P+VLCRLF+K +  L
Sbjct  140  GQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESL  180



>gb|AFK41148.1| unknown [Medicago truncatula]
Length=642

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 3/161 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+ LP+G+RFRPTDEELVD YL+MKI G+  EV VIREVD+CK EPWDLPD+S V + D 
Sbjct  22   LNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIVRNKDP  81

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP DRKY NG RLNRAT  GYWKATGKDR I S  GA  +GMKKTLV+Y GRAP+
Sbjct  82   EWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIKS--GATLIGMKKTLVFYAGRAPK  139

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            G+RTHW++HEYR T  + DGT+ GQ P+VLCRLF+K +  L
Sbjct  140  GQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESL  180



>ref|XP_008462914.1| PREDICTED: NAC domain-containing protein 74 [Cucumis melo]
Length=597

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT  + DGT+ GQ+ FVLCRLF+K +  ++
Sbjct  124  GKRTNWVVHEYRTTLKELDGTNPGQSAFVLCRLFKKQDESIE  165



>gb|AGL39711.1| NAC transcription factor 055 [Jatropha curcas]
 gb|KDP25178.1| hypothetical protein JCGZ_20334 [Jatropha curcas]
Length=605

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 13/179 (7%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         SLP+G+RFRPTDEELV+HYL++KI G  +EV VI EVDICK EP
Sbjct  1    MAVLSME---------SLPLGFRFRPTDEELVNHYLRLKINGRNSEVEVIPEVDICKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA----  459
            WDLP++S +++ D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SRK      
Sbjct  52   WDLPELSVIKTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIKSRKSGSNPI  111

Query  460  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             +GMKKTLV+Y GRAP+G+RT+W++HEYR T    DG+  GQ+ FVL RLFRK E K D
Sbjct  112  SIGMKKTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGSAPGQSAFVLFRLFRKPEEKTD  170



>ref|XP_007039299.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23800.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
Length=655

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 10/175 (6%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         +LP+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLP +S ++S D EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT  GQ  FVLCRLF K+E + D
Sbjct  111  KKTLVFYKGRAPKGQRTNWIMHEYRATAKDLDGTGPGQGAFVLCRLFHKLEERND  165



>ref|XP_009351898.1| PREDICTED: uncharacterized protein LOC103943342 [Pyrus x bretschneideri]
Length=546

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL+D+YL+ KI G+  +V+VIRE+D+CK EPWDLP +S +++ D 
Sbjct  11   MDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPGLSVIQTTDP  70

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT +GYWKATGKDR I S K   +GMKKTLV++ GRAP+G
Sbjct  71   EWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDK-ILIGMKKTLVFHTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            KRT+WV+HEYRTT+ + DGT+ GQ+ FVLCRLF+K
Sbjct  130  KRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKK  164



>ref|XP_011470170.1| PREDICTED: NAC domain-containing protein 86 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  L SLP+G+RFRPTDEEL++ YL+ KI G + EVSVIRE+D+C+ EPWDLPD+S ++
Sbjct  6    GVVSLSSLPLGFRFRPTDEELIEFYLRSKINGRDKEVSVIREIDVCRWEPWDLPDLSVIQ  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLG  498
            + D EWFFFCP+D+KY NG RLNRAT  GYWKATGKDR I S  GA  VGMKKTLV++ G
Sbjct  66   TQDPEWFFFCPQDKKYPNGFRLNRATIAGYWKATGKDRRIKS--GANLVGMKKTLVFHKG  123

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+GKRT+WV+HEYR T+ + DGT+ GQ+PFVLCRLF+K +  ++
Sbjct  124  RAPKGKRTNWVMHEYRATQKELDGTNPGQSPFVLCRLFKKQDESIE  169



>ref|XP_004156529.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
 gb|KGN53626.1| hypothetical protein Csa_4G091920 [Cucumis sativus]
Length=606

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYR T  + DGT+ GQ+ FVLCRLF+K +  ++
Sbjct  124  GKRTNWVVHEYRATLKELDGTNPGQSAFVLCRLFKKQDESIE  165



>ref|XP_007039300.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23801.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
Length=658

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = +1

Query  145  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES  324
            LP   S P+G+RFRPTDEEL++HYLK+KI G  +EV VI E+D+CK EPWDLP +S ++S
Sbjct  6    LPSDVSSPLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKS  65

Query  325  HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRA  504
             D EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRA
Sbjct  66   DDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRA  124

Query  505  PEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            P+G+RT+W++HEYR T    DGT  GQ  FVLCRLF K+E + D
Sbjct  125  PKGQRTNWIMHEYRATAKDLDGTGPGQGAFVLCRLFHKLEERND  168



>ref|XP_004137298.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
Length=596

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  +VSVIREVD+CK EPWDLPD+S +++ D 
Sbjct  6    LNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSIIKTKDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPE  510
            EWFFFCP+DRKY NG RL RAT  GYWKATGKDR I S  G K +GMKKTLV+Y GRAP+
Sbjct  66   EWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS--GTKLIGMKKTLVFYKGRAPK  123

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYR T  + DGT+ GQ+ FVLCRLF+K +  ++
Sbjct  124  GKRTNWVVHEYRATLKELDGTNPGQSAFVLCRLFKKQDESIE  165



>ref|XP_007039234.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23735.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
Length=496

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEA-EVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLPVG+RFRPTDEEL+D YL+ KI G+   EV VIRE+D+CK EPWDLPD+S + + D
Sbjct  6    LNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSAIATRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKKTLV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKTLVFYTGRAPR  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GKRT+WV+HEYRTT ++ DGT  GQ  FV+CRLF+K
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKK  160



>ref|NP_001276287.1| NAC domain protein [Glycine max]
 gb|AGO14647.1| NAC transcription factor [Glycine max]
Length=589

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  318
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  131

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+GKRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLE  177



>gb|KJB52425.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=654

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +RT+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  125  ERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRND  165



>gb|KFK27735.1| hypothetical protein AALP_AA8G422400 [Arabis alpina]
Length=464

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + EV VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGRDDEVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
             RT W+IHEYR TE   DGT +GQ PFV+C+LF+K ++  D  AE
Sbjct  130  TRTCWIIHEYRATEKDLDGTKSGQNPFVICKLFKKQDVVNDAAAE  174



>gb|AIA57515.1| NAC domain-containing protein [Boehmeria nivea]
Length=644

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   L SLP+G+RFRPTDEEL++HYL++K+ G  A+V VI E+D+CK EPWDLP +S ++
Sbjct  2    GTVTLESLPLGFRFRPTDEELINHYLRLKVNGRHADVHVIPEIDVCKWEPWDLPSLSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-------GAKVGMKKT  480
            + D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI SR           +GMKKT
Sbjct  62   TDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRAYRSPSNTNGLIGMKKT  121

Query  481  LVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            LV+Y GRAP+G+RTHW++HEYR T    DGT  GQ  FVLCRLFRK E K +
Sbjct  122  LVFYRGRAPKGERTHWIMHEYRPTLKDLDGTGPGQEAFVLCRLFRKSEEKAE  173



>ref|XP_006291082.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
 gb|EOA23980.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
Length=460

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKTSKTNIIGVKRTLVFHAGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WVIHEYR TEN   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELNL  169



>ref|XP_010241066.1| PREDICTED: uncharacterized protein LOC104585779 isoform X2 [Nelumbo 
nucifera]
Length=608

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  L +LP+G+RFRPTDEEL++HYL+ KI G E +V VI EVD+CK EPWDLP++S ++
Sbjct  6    GVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYL  495
            + D EWFFF P+DRKY NG R NRATE GYWKATGKDRTI +R      +GMKKTLV+Y 
Sbjct  66   NGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKARTSGMHLIGMKKTLVFYR  125

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GRAP G+RT+W++HEYR TE + DGTH GQ  FVLCRLF+K +++++
Sbjct  126  GRAPNGQRTNWIMHEYRATEEELDGTHPGQGAFVLCRLFKKSDVRIE  172



>ref|XP_007039233.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23734.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
Length=576

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEA-EVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLPVG+RFRPTDEEL+D YL+ KI G+   EV VIRE+D+CK EPWDLPD+S + + D
Sbjct  6    LNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSAIATRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKKTLV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKTLVFYTGRAPR  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GKRT+WV+HEYRTT ++ DGT  GQ  FV+CRLF+K
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKK  160



>ref|XP_010241065.1| PREDICTED: uncharacterized protein LOC104585779 isoform X1 [Nelumbo 
nucifera]
Length=609

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  L +LP+G+RFRPTDEEL++HYL+ KI G E +V VI EVD+CK EPWDLP++S ++
Sbjct  6    GVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYL  495
            + D EWFFF P+DRKY NG R NRATE GYWKATGKDRTI +R      +GMKKTLV+Y 
Sbjct  66   NGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKARTSGMHLIGMKKTLVFYR  125

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GRAP G+RT+W++HEYR TE + DGTH GQ  FVLCRLF+K +++++
Sbjct  126  GRAPNGQRTNWIMHEYRATEEELDGTHPGQGAFVLCRLFKKSDVRIE  172



>gb|KJB52426.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=721

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EPWDLP +S ++S D 
Sbjct  6    MGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDL  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG R NRAT++GYWKATGKDRTI S+K + +GMKKTLV+Y GRAP+G
Sbjct  66   EWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKK-SLIGMKKTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +RT+W++HEYR T  + DGT  GQ+ FVLCRLF KVE + D
Sbjct  125  ERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRND  165



>gb|KHN46203.1| NAC domain-containing protein 78 [Glycine soja]
Length=588

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V + D 
Sbjct  17   LNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVVRNKDP  76

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  77   EWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTGRAPKG  135

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  136  KRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLE  176



>ref|XP_002300524.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
 gb|EEE85329.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
Length=636

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+D+CK EPWDLP  S +++ D 
Sbjct  4    MDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKWEPWDLPGQSVIKTDDP  63

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGR  501
            EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SRK A     +GMKKTLV+Y GR
Sbjct  64   EWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRGR  123

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            AP+GKRT+W++HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  124  APKGKRTNWIMHEYRPTEEDLDGTGPGQVAFVLFRLFRKPE  164



>ref|XP_010533527.1| PREDICTED: uncharacterized protein LOC104809290 [Tarenaya hassleriana]
Length=644

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +1

Query  130  ERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDM  309
            ER  G   + SLP+G+RFRPTDEEL++HYL +KI G  ++V VI EVD+CK EPWDLP +
Sbjct  17   EREMGAMSMESLPLGFRFRPTDEELINHYLCLKINGRHSDVQVIPEVDVCKWEPWDLPSL  76

Query  310  SFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVY  489
            S +++ D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+
Sbjct  77   SVIKTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRTIKSKK-TLIGMKKTLVF  135

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            Y GRAP+G+RT+W++HEYR T+ + DG+  GQ+PFVLCRLF K E +++
Sbjct  136  YRGRAPKGERTNWIMHEYRPTQKELDGSAPGQSPFVLCRLFHKPEDRVN  184



>ref|XP_006596412.1| PREDICTED: NAC domain-containing protein 12-like [Glycine max]
Length=590

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  318
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GSTLIGMKKTLVFYTG  131

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+GKRT+WV+HEYR T  + +GT+ GQ P+VLCRLF+K +  L+
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELEGTNPGQNPYVLCRLFKKQDESLE  177



>gb|KHN40025.1| NAC domain-containing protein 78 [Glycine soja]
Length=590

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  318
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  13   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVV  72

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  73   RNKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  131

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+GKRT+WV+HEYR T  + +GT+ GQ P+VLCRLF+K +  L+
Sbjct  132  RAPKGKRTNWVMHEYRPTLKELEGTNPGQNPYVLCRLFKKQDESLE  177



>ref|XP_010503613.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=455

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WVIHEYR TEN   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELNL  169



>ref|XP_011004357.1| PREDICTED: uncharacterized protein LOC105110869 isoform X7 [Populus 
euphratica]
Length=647

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>gb|KJB39512.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
 gb|KJB39513.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=397

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT ++ DGT  GQ PFV+CRLF+K ++ ++
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIE  166



>ref|XP_011038026.1| PREDICTED: uncharacterized protein LOC105135051 [Populus euphratica]
Length=639

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  7    IDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKREPWDLPGLSVIKTDDP  66

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGR  501
            EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y GR
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRGR  126

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            AP+G+RT+W++HEYR TE   DGT  GQ  FVL RLFRK E
Sbjct  127  APKGERTNWIMHEYRPTEKDLDGTGPGQVAFVLFRLFRKPE  167



>ref|XP_010525539.1| PREDICTED: NAC domain-containing protein 67-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010525540.1| PREDICTED: NAC domain-containing protein 67-like isoform X2 [Tarenaya 
hassleriana]
Length=464

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV +YL++KI G + +V +IREVDICK EPWDLPD+S V++ D+
Sbjct  6    LDSLPVGLRFRPTDEELVRYYLRLKINGHDDDVRIIREVDICKWEPWDLPDLSVVKTKDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R+NRAT  GYWKATGKDR + S K + +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRNVKSVKNSIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
             RT WV+HEYR TE   DG   GQ+PFV+C+LF+K
Sbjct  126  TRTCWVMHEYRATEKDLDGMKPGQSPFVICKLFKK  160



>ref|XP_007141360.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
 gb|ESW13354.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
Length=569

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV  318
            T +  L++LP+G+RFRPTDEEL+D+YL+ KI G+  +V VIRE+D+CK EPWDLPD+S V
Sbjct  14   TAVLSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVV  73

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
             + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  74   RNKDPEWFFFCPQDRKYPNGHRLNRATSLGYWKATGKDRRIKS-GSTLIGMKKTLVFYTG  132

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+GKRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  133  RAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLE  178



>ref|XP_011004354.1| PREDICTED: uncharacterized protein LOC105110869 isoform X4 [Populus 
euphratica]
Length=674

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>gb|KJB18878.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=547

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT  GQ+ FVLCRLF K E K D
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGTAPGQSAFVLCRLFHKPEEKND  165



>ref|XP_010515305.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=453

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELVRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WVIHEYR TEN   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELHL  169



>gb|AES72662.2| M20/M25/M40 family peptidase [Medicago truncatula]
Length=312

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEEL+D+YL++KI G+  EV VIRE+D+CK EPWD+PD+S ++ +D 
Sbjct  105  LISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVIKDNDP  164

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DR+Y NG RLNR T  GYWKATGKDR I S     +GMKKTLV+Y+ RAP G
Sbjct  165  EWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIKSGT-ILIGMKKTLVFYISRAPNG  223

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +R++WV+HEYR T  + DGT+ GQ  +VLCRLF+K +  L+
Sbjct  224  RRSNWVMHEYRPTLEELDGTNPGQKAYVLCRLFKKNDESLE  264



>ref|XP_010426468.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=453

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I + K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGKTKIIGVKRTLVFHAGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WVIHEYR TEN   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVIHEYRATENDLSGTNPGQSPFVVCKLFKKQELNL  169



>ref|XP_011004355.1| PREDICTED: uncharacterized protein LOC105110869 isoform X5 [Populus 
euphratica]
Length=672

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>ref|XP_011004352.1| PREDICTED: uncharacterized protein LOC105110869 isoform X3 [Populus 
euphratica]
Length=674

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            P+ SLP+G+RFRPTDEEL+ HYL++KI G ++EV VI E+DICK EPWDLP +S +++ D
Sbjct  6    PVDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFFCP+DRKY NG R NRAT  GYWKATGKDRTI SRK A     +GMKKTLV+Y G
Sbjct  66   PEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAGNTTLIGMKKTLVFYRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G+RT+W++HEYR TE   +GT  GQ  FVL RLFRK E
Sbjct  126  RAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPE  167



>ref|XP_003602412.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72663.1| NAC transcription factor-like protein [Medicago truncatula]
Length=593

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  VLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWD  297
            V  V+    +  L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD
Sbjct  7    VPSVDDGMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWD  66

Query  298  LPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK  477
            +PD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKK
Sbjct  67   MPDLSVVRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKSGT-ILIGMKK  125

Query  478  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            TLV+Y GRAP+GKRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K
Sbjct  126  TLVFYSGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKK  172



>ref|XP_011081340.1| PREDICTED: uncharacterized protein LOC105164394 isoform X2 [Sesamum 
indicum]
Length=588

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LP G+RFRPTDEELV HYL++KI G  + V VI E+D+CK EPWDLP +S ++S D 
Sbjct  3    LEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSDDQ  62

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  489
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK           +GMKKTLV+
Sbjct  63   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTLVF  122

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            Y GRAP+G+RT+W++HEYR TE   DG+  GQ  +VLCRLF K + KLD
Sbjct  123  YKGRAPKGERTNWIMHEYRATEPDLDGSSPGQGDYVLCRLFHKADEKLD  171



>ref|XP_003602413.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72664.1| NAC transcription factor-like protein [Medicago truncatula]
Length=620

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +1

Query  118  VLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWD  297
            V  V+    +  L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD
Sbjct  7    VPSVDDGMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWD  66

Query  298  LPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK  477
            +PD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKK
Sbjct  67   MPDLSVVRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIKS-GTILIGMKK  125

Query  478  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            TLV+Y GRAP+GKRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K
Sbjct  126  TLVFYSGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKK  172



>ref|XP_011081339.1| PREDICTED: uncharacterized protein LOC105164394 isoform X1 [Sesamum 
indicum]
Length=593

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LP G+RFRPTDEELV HYL++KI G  + V VI E+D+CK EPWDLP +S ++S D 
Sbjct  3    LEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSDDQ  62

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  489
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK           +GMKKTLV+
Sbjct  63   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTLVF  122

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            Y GRAP+G+RT+W++HEYR TE   DG+  GQ  +VLCRLF K + KLD
Sbjct  123  YKGRAPKGERTNWIMHEYRATEPDLDGSSPGQGDYVLCRLFHKADEKLD  171



>ref|XP_004514021.1| PREDICTED: uncharacterized protein LOC101501154 [Cicer arietinum]
Length=610

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 10/176 (6%)
 Frame = +1

Query  109  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHE  288
            EMAVL          L+ LP+G+RFRPTDEEL+D YL++KI G+  EV VIRE+D+CK E
Sbjct  14   EMAVLS---------LNKLPLGFRFRPTDEELIDFYLRLKINGNGDEVWVIREIDVCKWE  64

Query  289  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVG  468
            PWDLPD+S V + D EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +G
Sbjct  65   PWDLPDLSVVRNKDPEWFFFCPQDRKYPNGSRLNRATNHGYWKATGKDRKIKSGP-TLIG  123

Query  469  MKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            MKKTLV++ GRAP+GKRT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  ++
Sbjct  124  MKKTLVFHAGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESIE  179



>ref|XP_007136363.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
 gb|ESW08357.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
Length=587

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEEL+D+YL+ KI G+ AEV VIRE+D+CK EPWD+PD+S V + D 
Sbjct  19   LDSLPLGFRFRPTDEELIDYYLRQKINGNGAEVWVIREIDVCKWEPWDMPDLSVVRNKDP  78

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRRIKSGM-MLIGMKKTLVFYTGRAPKG  137

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KRT+WV+HEYR T  + DGT+ GQ  +VLCRLF+K +  L+
Sbjct  138  KRTNWVMHEYRPTLKELDGTNPGQNAYVLCRLFKKHDESLE  178



>ref|XP_011070419.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
 ref|XP_011070420.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
Length=590

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 8/168 (5%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LP G+RFRPTDEELV+HYL++KI G  + V VI EVD+CK EPWDLP +S ++S D 
Sbjct  10   LEALPKGFRFRPTDEELVNHYLRLKINGRHSAVEVIPEVDVCKWEPWDLPALSVIKSDDR  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLVY  489
            EWFFFCP+D+KY NG R NRATE GYWKATGKDRTI SRK +         +GMKKTLV+
Sbjct  70   EWFFFCPRDKKYPNGHRSNRATEAGYWKATGKDRTIKSRKSSSSGWANPHLIGMKKTLVF  129

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            Y GRAP+G+RT+W++HEYR TE   DGT  GQ  +VLCRLF K + KL
Sbjct  130  YKGRAPKGERTNWIMHEYRATEQDLDGTAPGQGDYVLCRLFHKADEKL  177



>ref|XP_010519577.1| PREDICTED: NAC domain-containing protein 67-like [Tarenaya hassleriana]
Length=488

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV +YL+MKI G + +V +IREVDICK EPWDLPDMS V++ D+
Sbjct  6    LDSLPVGLRFRPTDEELVRYYLRMKINGHDDDVRIIREVDICKWEPWDLPDMSVVKTKDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R+NRAT  GYWKATGKDR I S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRKIKSVNKNIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
             RT WV+HEYR TE    GT+ GQ PFV+C+LF+K
Sbjct  126  ARTCWVMHEYRATEKDLAGTNPGQNPFVICKLFKK  160



>gb|KDO76787.1| hypothetical protein CISIN_1g009388mg [Citrus sinensis]
Length=536

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 14/180 (8%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAV+ +E         SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EP
Sbjct  1    MAVISME---------SLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AK  462
            WDLP +S +++ D EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A 
Sbjct  52   WDLPGLSVIKTEDPEWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNAC  111

Query  463  VGMKKTLVYYLGRAPEGKRTHWVIHEYRTT-ENKFD-GTHAGQAPFVLCRLFRKVELKLD  636
            +GMKKTLV+Y GRAP+G+RT+W++HEYR T E+  D  T   QA FVLCRLFRK E K+D
Sbjct  112  IGMKKTLVFYRGRAPKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVD  171



>ref|XP_002867065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+P+VLCRLF K++ +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKLDDRVN  165



>ref|XP_006306958.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39856.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=657

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT AGQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHK  163



>ref|XP_006306959.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39857.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=658

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT AGQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHK  163



>ref|XP_006306957.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39855.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=655

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT AGQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHK  163



>gb|KJB24042.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=455

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G+RFRPTDEEL+  YL+ KI G    EV VIRE+D+CK EPWDLP MS +++ D
Sbjct  6    LNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIQTRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT  + DGT  GQ PFV+CRLF+K +  ++
Sbjct  125  GKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDESIE  166



>ref|XP_010432258.1| PREDICTED: NAC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=522

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+PFVLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVN  165



>gb|KHF99264.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=635

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT  GQ+ FVLCRLF K E K D
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTKDLDGTAPGQSAFVLCRLFHKPEEKND  165



>ref|XP_006287681.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20579.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=414

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  130  TRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDI  167



>emb|CDY05939.1| BnaC08g21160D [Brassica napus]
Length=463

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV  YL+ KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVSFYLQRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKSSIIGLKRTLVFHSGRAPKG  132

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+W++HEYR TE+   GT+ GQ+PFV+C+LF+K EL L
Sbjct  133  TRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKPELGL  172



>gb|KJB18876.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=635

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         +LP+G+RFRPTDEEL++HYL++KI G  +EV VI E+D+CK EP
Sbjct  1    MAVLTME---------TLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLP +S ++S D EWFFFCP DRKY N  R NRAT++GYWKATGKDRTI S+K + +GM
Sbjct  52   WDLPGLSVIKSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKK-SLIGM  110

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+G+RT+W++HEYR T    DGT  GQ+ FVLCRLF K E K D
Sbjct  111  KKTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGTAPGQSAFVLCRLFHKPEEKND  165



>gb|KJB39511.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=525

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT ++ DGT  GQ PFV+CRLF+K ++ ++
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIE  166



>ref|XP_002317831.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
 gb|EEE96051.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
Length=608

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRP+DEELV++YL+ KI G + +V VIRE+D+CK EPWDLP +S +E+ D 
Sbjct  8    LNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVRVIREIDVCKWEPWDLPGLSIIENKDP  67

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  68   EWFFFCPLDRKYPNGSRQNRATNAGYWKATGKDRKIKS-GNRLIGMKKTLVFYTGRAPKG  126

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KRT+WV+HEYR TE + DGT  GQ+ FVLCRLF+K +  ++
Sbjct  127  KRTNWVVHEYRATEEELDGTKPGQSAFVLCRLFKKQDESIE  167



>ref|XP_006287682.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20580.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=466

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  130  TRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDI  167



>ref|XP_010432259.1| PREDICTED: NAC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=537

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+  + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+PFVLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVN  165



>gb|KJB24041.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=483

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G+RFRPTDEEL+  YL+ KI G    EV VIRE+D+CK EPWDLP MS +++ D
Sbjct  6    LNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIQTRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT  + DGT  GQ PFV+CRLF+K +  ++
Sbjct  125  GKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDESIE  166



>ref|XP_006286077.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
 gb|EOA18975.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
Length=526

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+PFVLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTAPGQSPFVLCRLFHKPDDRVN  165



>gb|KFK34231.1| hypothetical protein AALP_AA5G118000 [Arabis alpina]
Length=458

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV  YL  KI G + +V  IRE+DICK EPWDLPD+S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRFYLGRKINGHDDDVKAIREIDICKWEPWDLPDLSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY  G R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPTGSRQNRATIAGYWKATGKDRKIKSAKKNIIGVKRTLVFHSGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WV+HEYR TEN   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVMHEYRATENDLSGTNPGQSPFVICKLFKKQELNL  169



>ref|NP_567986.3| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86533.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=512

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+P+VLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVN  165



>ref|XP_010493709.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=466

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  126  TRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDI  163



>ref|XP_010437454.1| PREDICTED: uncharacterized protein LOC104721220 [Camelina sativa]
Length=526

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+PFVLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVN  165



>gb|KHN19577.1| NAC domain-containing protein 78 [Glycine soja]
Length=598

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEELV++YL+ KI G+  +V VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S K   +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKDL-IGMKKTLVFYTGRAPKG  137

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             RT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  138  NRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLE  178



>ref|XP_003526771.1| PREDICTED: uncharacterized protein LOC100808469 [Glycine max]
Length=598

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEELV++YL+ KI G+  +V VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S K   +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKDL-IGMKKTLVFYTGRAPKG  137

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             RT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  138  NRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLE  178



>ref|XP_010421284.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
 ref|XP_010421286.1| PREDICTED: NAC domain-containing protein 74-like isoform X3 [Camelina 
sativa]
Length=467

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  126  TRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDI  163



>gb|KHG07501.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=562

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP G+RFRPTDEEL+D YL+ KI G    EV VIRE+D+CK EPWDLP MS +E+ D
Sbjct  6    LNSLPTGFRFRPTDEELIDFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSAIETRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRAT+ GYWKATGKDR I S   + +GMKK+LV+Y GRAP 
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATKAGYWKATGKDRKIKS-GSSLIGMKKSLVFYTGRAPR  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT  + DGT  GQ PFV+CRLF+K +  ++
Sbjct  125  GKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDESIE  166



>ref|NP_001119122.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 emb|CAA20028.1| NAM / CUC2 -like protein [Arabidopsis thaliana]
 emb|CAB80274.1| NAM / CUC2-like protein [Arabidopsis thaliana]
 gb|AEE86534.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=534

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+P+VLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVN  165



>ref|XP_002874210.1| tip [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50469.1| tip [Arabidopsis lyrata subsp. lyrata]
Length=461

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D 
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDA  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  130  TRTCWIMHEYRATEKDLDGTKSGQNPFVVCKLFKKQDI  167



>ref|NP_001190927.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86535.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=533

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ+P+VLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVN  165



>ref|NP_197847.3| TCV-interacting protein [Arabidopsis thaliana]
 gb|AAF87300.1|AF281062_1 TIP [Arabidopsis thaliana]
 dbj|BAB11211.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAN72023.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAP81801.1| At5g24590 [Arabidopsis thaliana]
 gb|AED93330.1| TCV-interacting protein [Arabidopsis thaliana]
Length=451

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  10   LASLPVGFRFSPTDEELVRYYLRLKINGHDNDVRVIREIDICKWEPWDLPDFSVVKTTDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  130  TRTCWIMHEYRATEKDLDGTKSGQNPFVVCKLFKKQDI  167



>ref|XP_010529684.1| PREDICTED: NAC domain-containing protein 86 [Tarenaya hassleriana]
Length=637

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI EVD+CK EPWDLP +S +++ D 
Sbjct  8    VEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEVDVCKWEPWDLPGLSVIKTDDQ  67

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K A VGMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDTGYWKATGKDRTIKSKKMA-VGMKKTLVFYRGRAPRG  126

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+   DG   GQ P+VLCRLF K
Sbjct  127  ERTNWIMHEYRATDKDLDGNGPGQNPYVLCRLFHK  161



>ref|XP_006439176.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
 gb|ESR52416.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
Length=632

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVIKTEDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGRA  504
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A +GMKKTLV+Y GRA
Sbjct  66   EWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNACIGMKKTLVFYRGRA  125

Query  505  PEGKRTHWVIHEYRTT-ENKFD-GTHAGQAPFVLCRLFRKVELKLD  636
            P+G+RT+W++HEYR T E+  D  T   QA FVLCRLFRK E K+D
Sbjct  126  PKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVD  171



>ref|XP_010446907.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=522

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR  120

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            AP+G+RT+W++HEYR T    DGT  GQ PFVLCRLF K + +++
Sbjct  121  APKGERTNWIMHEYRPTLKDLDGTGPGQNPFVLCRLFHKPDDRVN  165



>ref|XP_010499853.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Camelina 
sativa]
Length=667

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  163



>ref|XP_010499852.1| PREDICTED: NAC domain-containing protein 86-like isoform X1 [Camelina 
sativa]
Length=668

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  163



>gb|KHG05224.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=533

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V++ D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKARD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GKRT+WV+HEYRTT ++ DGT  GQ PFV+CRLF+K
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKK  160



>ref|XP_006476249.1| PREDICTED: uncharacterized protein LOC102621962 [Citrus sinensis]
Length=632

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  6    MESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVIKTEDP  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGRA  504
            EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI SRK    A +GMKKTLV+Y GRA
Sbjct  66   EWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKAGTNACIGMKKTLVFYRGRA  125

Query  505  PEGKRTHWVIHEYRTT-ENKFD-GTHAGQAPFVLCRLFRKVELKLD  636
            P+G+RT+W++HEYR T E+  D  T   QA FVLCRLFRK E K+D
Sbjct  126  PKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVD  171



>ref|XP_002877683.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53942.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKSGKTNIIGVKRTLVFHAGRAPRG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WVIHEYR TE+   G + GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWVIHEYRATEDDLSGINPGQSPFVICKLFKKQELNL  169



>ref|XP_010499854.1| PREDICTED: NAC domain-containing protein 86-like isoform X3 [Camelina 
sativa]
Length=664

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  163



>emb|CDY08139.1| BnaA06g15870D [Brassica napus]
Length=464

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV  YL  KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNSIIGVKRTLVFHSGRAPKG  132

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL-------KLDXGAE  648
             RT+W++HEYR TE+   GT+ GQ+PFV+C+LF+K +L       KLD  AE
Sbjct  133  TRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKQDLSLADEDSKLDEAAE  184



>ref|XP_009151462.1| PREDICTED: uncharacterized protein LOC103874777 [Brassica rapa]
 emb|CDY26922.1| BnaA05g17900D [Brassica napus]
Length=636

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+   DGT  GQ+P+VLCRLF K
Sbjct  130  ERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHK  164



>ref|XP_004502779.1| PREDICTED: uncharacterized protein LOC101492664 [Cicer arietinum]
Length=612

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L+SLP+G+RFRPTDEEL+D+YL+ KI G+  EV VIRE+D+CK EPWD+PD+S + + D 
Sbjct  20   LNSLPLGFRFRPTDEELIDYYLRQKINGNGDEVWVIREIDVCKWEPWDMPDLSVIRNKDP  79

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  80   EWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRKIKSGT-ILIGMKKTLVFYSGRAPKG  138

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KRT+WV+HEYR T  + DGT+ GQ  +VLCRLF+K +  L+
Sbjct  139  KRTNWVMHEYRPTLKELDGTNPGQNAYVLCRLFKKNDESLE  179



>gb|AIU39715.1| NAC transcription factor 14 [Brassica napus]
Length=635

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+   DGT  GQ+P+VLCRLF K
Sbjct  130  ERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHK  164



>ref|XP_010456676.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=521

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  126  TRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDI  163



>gb|AAF31292.1|AC006424_21 CDS [Arabidopsis thaliana]
Length=577

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  6    ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  65

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  66   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  125  APRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHK  163



>emb|CDY66161.1| BnaCnng49700D [Brassica napus]
Length=635

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  11   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  70

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  71   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+   DGT  GQ+P+VLCRLF K
Sbjct  130  ERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHK  164



>gb|AHJ79190.1| NAC domain protein NAC49 [Gossypium hirsutum]
Length=628

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L+SLP+G RFRPTDEEL+D YL+ K+ G  + E+ VIREVD+CK EPWDLP +S V+  D
Sbjct  6    LNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSAVKGRD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE  510
             EWFFFCP DRKY NG RLNRATE GYWKATGKDR I S     +GMKKTLV+Y GRAP+
Sbjct  66   PEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIKS-GSCLIGMKKTLVFYTGRAPK  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            GKRT+WV+HEYRTT ++ DGT  GQ PFV+CRLF+K ++ ++
Sbjct  125  GKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIE  166



>ref|XP_002321956.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
 gb|EEF06083.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
Length=588

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 8/175 (5%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +         +SLP+G+RFRP+D+ELVD+YL++KI G +  V VIRE+D+CK EP
Sbjct  1    MAVLSMN-------FNSLPLGFRFRPSDKELVDYYLRLKINGDDDGVKVIREIDVCKWEP  53

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLPD+S +++ D EWFFFCP DRKY NG R NRAT  GYWKATG DR I S     +GM
Sbjct  54   WDLPDLSIIKNKDPEWFFFCPLDRKYPNGSRQNRATNAGYWKATGNDRKIKSGNNL-IGM  112

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+GKRT+WV+HEYR TE + DGT  GQ+ FVL RLF+K +  ++
Sbjct  113  KKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIE  167



>ref|XP_006394714.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32000.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=483

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  126  SRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDV  163



>gb|KFK45050.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=650

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  8    METLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDP  67

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  126

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+N  DGT  GQ P+VLCRLF K
Sbjct  127  ERTNWIMHEYRATDNDLDGTGPGQNPYVLCRLFHK  161



>gb|KFK45049.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=649

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  8    METLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDP  67

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  68   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  126

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+N  DGT  GQ P+VLCRLF K
Sbjct  127  ERTNWIMHEYRATDNDLDGTGPGQNPYVLCRLFHK  161



>ref|XP_009149732.1| PREDICTED: NAC transcription factor 29 [Brassica rapa]
Length=463

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV  YL  KI G + +V+ IRE+DICK EPWDLP  S ++++D+
Sbjct  13   LDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTNDS  72

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K + +G+K+TLV++ GRAP+G
Sbjct  73   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNSIIGVKRTLVFHSGRAPKG  132

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+W++HEYR TE+   GT+ GQ+PFV+C+LF+K +L L
Sbjct  133  TRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKQDLSL  172



>ref|XP_003602411.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=434

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEEL+D+YL++KI G+  EV VIRE+D+CK EPWD+PD+S ++ +D 
Sbjct  227  LISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVIKDNDP  286

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DR+Y NG RLNR T  GYWKATGKDR I S     +GMKKTLV+Y+ RAP G
Sbjct  287  EWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIKS-GTILIGMKKTLVFYISRAPNG  345

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +R++WV+HEYR T  + DGT+ GQ  +VLCRLF+K +  L+
Sbjct  346  RRSNWVMHEYRPTLEELDGTNPGQKAYVLCRLFKKNDESLE  386



>ref|XP_006394715.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32001.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=458

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL++KI G + +V VIREVDICK EPWDLPD S V++ D+
Sbjct  6    LASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++
Sbjct  126  SRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDV  163



>gb|ACU23644.1| unknown [Glycine max]
Length=603

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEELV++YL+ KI G+  EV VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIKSGT-ILIGMKKTLVFYTGRAPKG  137

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             RT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  138  NRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLE  178



>ref|NP_001276211.1| uncharacterized LOC100777071 [Glycine max]
 gb|AGO14649.1| NAC transcription factor [Glycine max]
Length=604

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP+G+RFRPTDEELV++YL+ KI G+  EV VIRE+D+CK EPWD+P +S V++ D 
Sbjct  19   LDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTKDP  78

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY NG RLNRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+G
Sbjct  79   EWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIKSGT-ILIGMKKTLVFYTGRAPKG  137

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
             RT+WV+HEYR T  + DGT+ GQ P+VLCRLF+K +  L+
Sbjct  138  NRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLE  178



>ref|XP_006404132.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
 gb|ESQ45585.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
Length=470

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTD+ELV  YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDQELVRFYLRRKINGHDNDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIRSDKDNIIGVKRTLVFHSGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+W+IHEYR TE    GT+ GQ+PFV+C+LF+K +L L
Sbjct  130  TRTNWIIHEYRATEKDLSGTNPGQSPFVICKLFKKQDLSL  169



>ref|XP_004309509.1| PREDICTED: uncharacterized protein LOC101295292 [Fragaria vesca 
subsp. vesca]
Length=713

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 134/182 (74%), Gaps = 16/182 (9%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         SLP+G+RFRPTDEEL++HYL++KI G  +EV VI ++D+CK EP
Sbjct  1    MAVLSME---------SLPLGFRFRPTDEELINHYLRLKINGRHSEVQVIPDIDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK------  453
            WDLP +S ++S D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI SR+      
Sbjct  52   WDLPKLSMIKSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRRFKSAAN  111

Query  454  -GAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
                VGMKKTLV+Y GRAP+G+RT W++HEYR T+ + DGT  GQ  +VLCRLF K E K
Sbjct  112  STGLVGMKKTLVFYKGRAPKGERTSWIMHEYRPTQKELDGTAPGQCAYVLCRLFHKPEEK  171

Query  631  LD  636
             +
Sbjct  172  AE  173



>gb|EYU35608.1| hypothetical protein MIMGU_mgv1a022295mg, partial [Erythranthe 
guttata]
Length=447

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 128/170 (75%), Gaps = 9/170 (5%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSV-IREVDICKHEPWDLPDMSFVESHD  330
            L SLP G+RFRPTDEELV+HYL++KI G  ++V V I EVD+CK EPWDLP +S ++S D
Sbjct  3    LESLPKGFRFRPTDEELVNHYLRLKINGRHSDVDVVIPEVDVCKWEPWDLPALSVIKSGD  62

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKKTLV  486
             EWFFFCP+DRKY NG R NRATE GYWKATGKDRTI S K +         +GMKKTLV
Sbjct  63   QEWFFFCPRDRKYPNGNRSNRATEAGYWKATGKDRTIKSHKSSSLGRSTSQLIGMKKTLV  122

Query  487  YYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            ++ GRAP+G+RT+W++HEYR T    DGT  GQ  +VLCRLF K + KLD
Sbjct  123  FHRGRAPKGERTNWIMHEYRATGPDLDGTGPGQGDYVLCRLFDKADEKLD  172



>ref|NP_174582.3| protein NAC 014 [Arabidopsis thaliana]
 gb|AEE31558.1| protein NAC 014 [Arabidopsis thaliana]
Length=648

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  135

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  136  APRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHK  174



>ref|NP_973954.1| protein NAC 014 [Arabidopsis thaliana]
 gb|ACI49788.1| At1g33060 [Arabidopsis thaliana]
 gb|AEE31559.1| protein NAC 014 [Arabidopsis thaliana]
Length=652

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGR  135

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  136  APRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHK  174



>ref|XP_010478725.1| PREDICTED: uncharacterized protein LOC104757674 isoform X1 [Camelina 
sativa]
Length=660

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
             RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  120  GRTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  154



>ref|XP_010478726.1| PREDICTED: uncharacterized protein LOC104757674 isoform X2 [Camelina 
sativa]
Length=659

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
             RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  120  GRTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  154



>ref|XP_006415127.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
 gb|ESQ33480.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
Length=654

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  12   MESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  71

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  72   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKMI-IGMKKTLVFYRGRAPRG  130

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT+W++HEYR T+   DGT  GQ P+VLCRLF K
Sbjct  131  ERTNWIMHEYRATDKDLDGTGPGQNPYVLCRLFHK  165



>gb|KJB37428.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=377

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CR+F+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKK  160



>ref|XP_002893753.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70012.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
             L  + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S ++
Sbjct  17   ALLSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  76

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR  501
            + D EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GR
Sbjct  77   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-LIIGMKKTLVFYRGR  135

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            AP G+RT+W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  136  APRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHK  174



>ref|NP_190522.1| transcription factor NTL6 [Arabidopsis thaliana]
 emb|CAB62457.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAL24091.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AAN41378.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AEE78553.1| NAC domain-containing protein 62 [Arabidopsis thaliana]
Length=469

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   MDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW +FCP DRKY +G R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP G
Sbjct  70   EWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGKTNIIGVKRTLVFHAGRAPRG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+W+IHEYR TE+   GT+ GQ+PFV+C+LF+K EL L
Sbjct  130  TRTNWIIHEYRATEDDLSGTNPGQSPFVICKLFKKEELVL  169



>ref|XP_011043746.1| PREDICTED: uncharacterized protein LOC105139114 [Populus euphratica]
Length=608

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAV+ +        L+SLP+G+RFRP+DEELV++YL+ KI G + +V VIR +D+CK EP
Sbjct  1    MAVMSLN-------LNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVKVIRGIDVCKWEP  53

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGM  471
            WDLP +S +++ D EWFFFCP DRKY NG R NRAT+ GYWKATGKDR I S     +GM
Sbjct  54   WDLPVLSIIKNKDPEWFFFCPLDRKYPNGSRQNRATDAGYWKATGKDRKIKS-GNRLIGM  112

Query  472  KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            KKTLV+Y GRAP+GKRT+WV+HEYR TE + DGT  GQ+ FVLCRLF+K +  ++
Sbjct  113  KKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGTKPGQSAFVLCRLFKKQDESIE  167



>gb|KHG14091.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=559

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTD+EL+D YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDQELIDFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRAT+ GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATDAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CRLF+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKK  160



>gb|AIS36139.1| NAC transcription factor 91-1 [Brassica napus]
Length=445

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++  +   E
Sbjct  126  TRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQDVVSEASPE  170



>ref|XP_009111638.1| PREDICTED: NAC domain-containing protein 74 isoform X1 [Brassica 
rapa]
Length=446

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++  +   E
Sbjct  126  TRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQDVVSEASPE  170



>ref|XP_009111639.1| PREDICTED: NAC domain-containing protein 2 isoform X2 [Brassica 
rapa]
 emb|CDY19828.1| BnaA09g04810D [Brassica napus]
Length=445

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VDICK+EPWDLPD+S V + D+
Sbjct  6    LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVVRTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  125

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDXGAE  648
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++  +   E
Sbjct  126  TRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQDVVSEASPE  170



>emb|CDX86970.1| BnaC03g52400D [Brassica napus]
Length=316

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY NG R NR+T  G+WKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFCPLDRKYPNGSRQNRSTIAGHWKATGKDRKIKSGKNNVIGLKRTLVFHSGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WV+HEYR TE    GT  GQ PFV+C+LF+K +  L
Sbjct  130  TRTNWVMHEYRATEQDLSGTSPGQNPFVICKLFKKQDPSL  169



>ref|XP_010542182.1| PREDICTED: uncharacterized protein LOC104815470 [Tarenaya hassleriana]
Length=668

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + SLP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+C+ EPWDLP +S +++ D 
Sbjct  18   IESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPGLSVIKTDDQ  77

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K A VGMKKTLV+Y GRAP  
Sbjct  78   EWFFFCPRDRKYPSGHRSNRATDSGYWKATGKDRTIRSKKTA-VGMKKTLVFYRGRAPRA  136

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT W++HEYR T+   DG   GQ P+VLCRLF K
Sbjct  137  ERTSWIMHEYRATDKDLDGYGPGQNPYVLCRLFHK  171



>gb|KJB37424.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=472

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CR+F+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKK  160



>gb|KJB37426.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=482

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CR+F+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKK  160



>gb|KJB37423.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=520

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CR+F+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKK  160



>ref|XP_010461128.1| PREDICTED: NAC domain-containing protein 86 [Camelina sativa]
Length=658

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            + +LP+G+RFRPTDEEL++HYL++KI G ++EV VI E+D+CK EPWDLP +S +++ D 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EWFFFCP+ RKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct  61   EWFFFCPRYRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-VIIGMKKTLVFYRGRAPRG  119

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            +RT W++HEYR T+ + DGT  GQ P+VLCRLF K
Sbjct  120  ERTDWIMHEYRATDKELDGTAPGQNPYVLCRLFHK  154



>gb|AHJ79172.1| NAC domain protein NAC31 [Gossypium hirsutum]
 gb|KJB37427.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=541

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFV  318
            G+  L+SLP+G+RFRPTDEEL+  YL+ KI G+   E+ +IRE+D+CK EPWDLPD+S +
Sbjct  2    GVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSAI  61

Query  319  ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLG  498
            ++ D EWFFFCP DRKY  G RLNRATE GYWKATGKDR I S     +GMKKTLV+Y G
Sbjct  62   KTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIKS-GSTLIGMKKTLVFYNG  120

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP GKRT+WV+HEYRTT ++ DGT  GQ  FV+CR+F+K
Sbjct  121  RAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKK  160



>ref|XP_011003273.1| PREDICTED: NAC domain-containing protein 45-like isoform X2 [Populus 
euphratica]
Length=588

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC  351
            G+RFRP+DEELVD+YL++KI G +  V VIRE+D+CK EPWDLPD+S +++ D EWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  352  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV  531
            P DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+GKRT+WV
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPKGKRTNWV  132

Query  532  IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +HEYR TE + DGT  GQ+ FVL RLF+K +  ++
Sbjct  133  MHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIE  167



>ref|XP_011003272.1| PREDICTED: NAC domain-containing protein 45-like isoform X1 [Populus 
euphratica]
Length=601

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = +1

Query  172  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC  351
            G+RFRP+DEELVD+YL++KI G +  V VIRE+D+CK EPWDLPD+S +++ D EWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  352  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV  531
            P DRKY NG R NRAT  GYWKATGKDR I S     +GMKKTLV+Y GRAP+GKRT+WV
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIKSGNNL-IGMKKTLVFYTGRAPKGKRTNWV  132

Query  532  IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            +HEYR TE + DGT  GQ+ FVL RLF+K +  ++
Sbjct  133  MHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIE  167



>gb|AIS36140.1| NAC transcription factor 91-2 [Brassica napus]
Length=456

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  125  TRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDV  162



>emb|CDX80455.1| BnaC07g29890D [Brassica napus]
Length=456

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  125  TRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDV  162



>ref|XP_009150983.1| PREDICTED: protein ATAF2-like isoform X2 [Brassica rapa]
Length=455

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  125  TRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDV  162



>ref|XP_009150982.1| PREDICTED: protein ATAF2-like isoform X1 [Brassica rapa]
Length=456

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D+
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDS  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  125  TRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDV  162



>emb|CAN73478.1| hypothetical protein VITISV_037597 [Vitis vinifera]
Length=181

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VIRE+D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-GAKVGMKKTLVYYLG  498
            + D EWFFFCP+DRKY NG+R NRAT+ GYWKATGKDRTI SRK  A +GMKKTLV+Y G
Sbjct  62   ADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSASIGMKKTLVFYKG  121

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHA  579
            RAP+G+RT+W+ HEYR  ++  D +  
Sbjct  122  RAPKGQRTNWIFHEYRVIDSASDSSQV  148



>emb|CDX88115.1| BnaA06g27060D [Brassica napus]
Length=443

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG+RF PTDEELV +YL+ KI G + EV VIREVDICK EPWDLP +S V++ D 
Sbjct  6    LDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVVKTTDA  65

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + + K   +G+K+TLV+Y GRAP+G
Sbjct  66   EWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKKI-IGVKRTLVFYKGRAPKG  124

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  125  TRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDV  162



>emb|CDP12257.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 128/173 (74%), Gaps = 8/173 (5%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G+    SLP+G+RFRPTDEEL++HYL++KI G   EV VI EVD+CK EPWDLP +S ++
Sbjct  2    GVVSTESLPLGFRFRPTDEELINHYLRLKINGRHDEVQVIPEVDVCKWEPWDLPQLSVIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--------VGMKK  477
            + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDRTI S + +         +GMKK
Sbjct  62   TDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSHRSSPSSNSSTHLIGMKK  121

Query  478  TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            TLV+Y GRAP+G+RT W++HEYR TE   DGT + QA +VLCRLF K +   D
Sbjct  122  TLVFYRGRAPKGERTSWIMHEYRATEPDLDGTASDQAAYVLCRLFHKPDETAD  174



>ref|XP_010660382.1| PREDICTED: uncharacterized protein LOC104877280 [Vitis vinifera]
 emb|CBI34627.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = +1

Query  142  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE  321
            G   + SLP+G+RFRPTDEEL++HYLK+KI G  +EV VIRE+D+CK EPWDLP +S ++
Sbjct  2    GAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMIK  61

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK-GAKVGMKKTLVYYLG  498
            + D EWFFFCP+DRKY NG+R NRAT+ GYWKATGKDRTI SRK  A +GMKKTLV+Y G
Sbjct  62   ADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSASIGMKKTLVFYKG  121

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+G+RT+W+ HEYR  ++  D   + Q  +VL RLF K   ++D
Sbjct  122  RAPKGQRTNWIFHEYRVIDSASD---SSQGAYVLFRLFYKPNERID  164



>emb|CDX87118.1| BnaC09g04330D [Brassica napus]
Length=832

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L +LPVG+RF PTDEELV +YL+ KI G + +V VIR VD+CK+EPWDLPD+S V + D+
Sbjct  383  LDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDMCKYEPWDLPDLSVVRTMDS  442

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR + S     +G+K+TLV+Y GRAP+G
Sbjct  443  EWLFFCPLDRKYPSGSRMNRATIAGYWKATGKDRKVKSGSTKIIGVKRTLVFYTGRAPKG  502

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
             RT W++HEYR TE   DGT  GQ PFV+C+LF+K ++
Sbjct  503  TRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQDV  540



>ref|XP_009150140.1| PREDICTED: NAC transcription factor 29-like [Brassica rapa]
 emb|CDY00208.1| BnaA06g21090D [Brassica napus]
Length=432

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLPVG RFRPTDEELV +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct  10   LDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTKDS  69

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG  513
            EW FF P DRKY  G R NR+T  G+WKATGKDR I S K   +G+K+TLV++ GRAP+G
Sbjct  70   EWLFFSPLDRKYPTGSRQNRSTIAGHWKATGKDRKIKSGKNNVIGLKRTLVFHSGRAPKG  129

Query  514  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
             RT+WV+HEYR TE+   GT+ GQ PFV+C+LF+K +  L
Sbjct  130  TRTNWVMHEYRATEHDLSGTNPGQNPFVICKLFKKQDPSL  169



>ref|XP_008783552.1| PREDICTED: uncharacterized protein LOC103702771 [Phoenix dactylifera]
Length=672

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 6/165 (4%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSF  315
            T LPP  SLP+G+RFRPTDEELV+HYLK KI G   +EV VI EVD+CK EPWDLPD S 
Sbjct  2    TVLPP-ESLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSL  60

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSR--KGAKVGMKKTLVY  489
            + S D EWFFF P+DRKY NG R NRATE GYWKATGKDR I ++    + +GMKKTLV+
Sbjct  61   IRSDDPEWFFFTPRDRKYPNGHRANRATEAGYWKATGKDRMIKTKPPSPSLIGMKKTLVF  120

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            Y GRAP G R++W++HEYRT+E++FD    G   FVLCRLF+K E
Sbjct  121  YRGRAPNGVRSNWIMHEYRTSESEFDSGEQGS--FVLCRLFKKPE  163



>ref|XP_004972796.1| PREDICTED: uncharacterized protein LOC101763561 [Setaria italica]
Length=671

 Score =   218 bits (554),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 106/164 (65%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L +LP+G+RF PTDEELV HYLK KITG   +EV VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQINSEVEVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISS----RKGAKVGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S    RK   +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGDKRKQHVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            RAP+G+RT W++HEYRTTE +FD     Q  +VL RLFRK E K
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFDSGE--QGGYVLYRLFRKQEEK  167



>ref|XP_009385839.1| PREDICTED: uncharacterized protein LOC103973093 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=717

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 102/168 (61%), Positives = 128/168 (76%), Gaps = 7/168 (4%)
 Frame = +1

Query  145  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVE  321
            L  L SLP+G+RF+PTDEELV++YLK KITG   +++ VI E+D+CK EPWDLPD S ++
Sbjct  3    LIALDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSVIK  62

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVY  489
            S D EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV+
Sbjct  63   SDDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAGKSTIIGMKKTLVF  122

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            + GRAP+G RTHW++HEYRTTE +F+     Q  +V+ RLFRK+E ++
Sbjct  123  HRGRAPKGARTHWIMHEYRTTEPEFES--GDQGGYVIYRLFRKLEQRI  168



>ref|XP_009385838.1| PREDICTED: uncharacterized protein LOC103973093 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   217 bits (553),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 102/168 (61%), Positives = 128/168 (76%), Gaps = 7/168 (4%)
 Frame = +1

Query  145  LPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVE  321
            L  L SLP+G+RF+PTDEELV++YLK KITG   +++ VI E+D+CK EPWDLPD S ++
Sbjct  3    LIALDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSVIK  62

Query  322  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVY  489
            S D EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV+
Sbjct  63   SDDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAGKSTIIGMKKTLVF  122

Query  490  YLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            + GRAP+G RTHW++HEYRTTE +F+     Q  +V+ RLFRK+E ++
Sbjct  123  HRGRAPKGARTHWIMHEYRTTEPEFES--GDQGGYVIYRLFRKLEQRI  168



>ref|XP_009389904.1| PREDICTED: uncharacterized protein LOC103976433 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=650

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 128/177 (72%), Gaps = 14/177 (8%)
 Frame = +1

Query  109  EMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKH  285
            EMAVL VE         S P+G+RFRPTD ELV+HYLK KITG  ++E  VI E+DICK 
Sbjct  5    EMAVLSVE---------SFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKC  55

Query  286  EPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS--SRKGA  459
            EPWDLPD+S ++S D+EWFFF PKDRKY NG R NRAT+ GYWKATGKDR I   SR   
Sbjct  56   EPWDLPDISLIKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRSISRVPT  115

Query  460  KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
             +G KKTLV+Y GRAP G RT WV+HEYRTTE +FD     Q  FVLCRLF+K E K
Sbjct  116  IIGTKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDS--GEQGGFVLCRLFKKPEEK  170



>ref|XP_010919012.1| PREDICTED: uncharacterized protein LOC105043241 isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 125/163 (77%), Gaps = 5/163 (3%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  327
            PL SLP+G+RF PTDEELV++YLK KI G   +EV VI EVD+CK EPW+LP  S + S 
Sbjct  5    PLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSVIRSD  64

Query  328  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  501
            D EWFFF P+DRKY NG R NRAT+ GYWKATG+DRTI +R      +GMKKTLV++LGR
Sbjct  65   DPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRPPGSTIIGMKKTLVFHLGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            AP+G RT+W++HEYRTTE++FD    G   FVLCRLF+K E K
Sbjct  125  APKGVRTYWIMHEYRTTESEFDSGEQGS--FVLCRLFKKPEEK  165



>ref|XP_002518952.1| transcription factor, putative [Ricinus communis]
 gb|EEF43485.1| transcription factor, putative [Ricinus communis]
Length=615

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 13/162 (8%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEP  291
            MAVL +E         SLP+G+RFRPTDEEL++HYL++KI G ++EV VI EVD+CK EP
Sbjct  1    MAVLHME---------SLPLGFRFRPTDEELINHYLRLKINGRDSEVDVISEVDVCKWEP  51

Query  292  WDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK---  462
            WDLP +S +++ D EWFFFCP+DRKY NGQR NRAT+ GYWKATGKDRTI +RK      
Sbjct  52   WDLPGLSVIKTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRARKSGSNPI  111

Query  463  -VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQ  585
             +GMKKTLV+Y GRAP+G+RT+W++HEYR T    DG+  GQ
Sbjct  112  CIGMKKTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGSAPGQ  153



>ref|XP_010919011.1| PREDICTED: uncharacterized protein LOC105043241 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 125/163 (77%), Gaps = 5/163 (3%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  327
            PL SLP+G+RF PTDEELV++YLK KI G   +EV VI EVD+CK EPW+LP  S + S 
Sbjct  5    PLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSVIRSD  64

Query  328  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  501
            D EWFFF P+DRKY NG R NRAT+ GYWKATG+DRTI +R      +GMKKTLV++LGR
Sbjct  65   DPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRPPGSTIIGMKKTLVFHLGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            AP+G RT+W++HEYRTTE++FD    G   FVLCRLF+K E K
Sbjct  125  APKGVRTYWIMHEYRTTESEFDSGEQGS--FVLCRLFKKPEEK  165



>ref|XP_008811393.1| PREDICTED: NAC domain-containing protein 74-like [Phoenix dactylifera]
Length=289

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 122/165 (74%), Gaps = 9/165 (5%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV+HYLK KI+G  ++E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LQLLPLGFRFHPTDEELVNHYLKRKISGRIKSEAEVIPEIDVCKCEPWDLPDKSIIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHQG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFD-GTHAGQAPFVLCRLFRKVELK  630
            RAP+G RT W++HEYRTTE +F+ G   G   +VL RLF+K E K
Sbjct  126  RAPKGIRTSWIMHEYRTTEPEFESGVQGG---YVLYRLFKKPEEK  167



>ref|XP_009389911.1| PREDICTED: uncharacterized protein LOC103976433 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 127/176 (72%), Gaps = 14/176 (8%)
 Frame = +1

Query  112  MAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHE  288
            MAVL VE         S P+G+RFRPTD ELV+HYLK KITG  ++E  VI E+DICK E
Sbjct  1    MAVLSVE---------SFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKCE  51

Query  289  PWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS--SRKGAK  462
            PWDLPD+S ++S D+EWFFF PKDRKY NG R NRAT+ GYWKATGKDR I   SR    
Sbjct  52   PWDLPDISLIKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRSISRVPTI  111

Query  463  VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            +G KKTLV+Y GRAP G RT WV+HEYRTTE +FD    G   FVLCRLF+K E K
Sbjct  112  IGTKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDSGEQGG--FVLCRLFKKPEEK  165



>ref|XP_009391053.1| PREDICTED: uncharacterized protein LOC103977297 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=721

 Score =   214 bits (545),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 7/165 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L SLP+G+RF PTDEELV+HYLK KITG  ++E+ VI E+D+CK EPWDLP+ S + S+D
Sbjct  6    LASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSLIRSND  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSAAKSTIIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            RAP G RT+W++HEYRTTE +F+     Q  +VL RLF+K E ++
Sbjct  126  RAPHGVRTNWIMHEYRTTELEFES--GDQGGYVLYRLFKKPEERI  168



>ref|XP_009391051.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391052.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=723

 Score =   214 bits (545),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 7/165 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L SLP+G+RF PTDEELV+HYLK KITG  ++E+ VI E+D+CK EPWDLP+ S + S+D
Sbjct  6    LASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSLIRSND  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSAAKSTIIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL  633
            RAP G RT+W++HEYRTTE +F+     Q  +VL RLF+K E ++
Sbjct  126  RAPHGVRTNWIMHEYRTTELEFES--GDQGGYVLYRLFKKPEERI  168



>ref|NP_001061034.1| Os08g0157900 [Oryza sativa Japonica Group]
 dbj|BAC99653.1| NAC2 protein-like [Oryza sativa Japonica Group]
 dbj|BAF22948.1| Os08g0157900 [Oryza sativa Japonica Group]
 gb|ACJ54898.1| NAC2 protein [Oryza sativa Japonica Group]
 gb|EEE68077.1| hypothetical protein OsJ_26109 [Oryza sativa Japonica Group]
Length=729

 Score =   214 bits (545),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 103/166 (62%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+G+RT W++HEYRTTE +F+     Q  +VL RLFRK E K++
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFRKQEEKIE  169



>ref|XP_002445085.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
 gb|EES14580.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
Length=663

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 125/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  139  TGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSF  315
            T +  L +LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S 
Sbjct  4    TAVMELRTLPLGFRFHPTDEELVTHYLKGKITGQINSEAEVIPEIDVCKCEPWDLPDKSI  63

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISS----RKGAKVGMKKTL  483
            ++S D EWFFF PKDRKY NG R NRATE GYWKATGKDR I S    RK   +GMKKTL
Sbjct  64   IQSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGDKRKQHTIGMKKTL  123

Query  484  VYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            V++ GRAP+G+RT W++HEYRTTE +FD    G   +VL RLFRK E K +
Sbjct  124  VFHRGRAPKGERTGWIMHEYRTTEPQFDSGEQGG--YVLYRLFRKQEEKTE  172



>ref|XP_010234378.1| PREDICTED: uncharacterized protein LOC100838012 [Brachypodium 
distachyon]
Length=800

 Score =   213 bits (541),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 102/160 (64%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L +LP+G+RF PTDEELV HYLK KITG   AEV VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKTLPLGFRFHPTDEELVRHYLKGKITGQINAEVEVIPEIDVCKCEPWDLPDKSLIRSED  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP+G+RT W++HEYRTTE +F+     Q  +VL RLF+K
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQK  163



>ref|XP_010934041.1| PREDICTED: uncharacterized protein LOC105054253 isoform X2 [Elaeis 
guineensis]
Length=684

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  336
            SLP+G+RFRPTDEELV+HYLK KI G   +EV VI +VD+CK EPWDLPD S + S D E
Sbjct  8    SLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSVIRSDDPE  67

Query  337  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPE  510
            WFFF P+DRKY  G R NRATE GYWKATG+DR I ++      +GMKKTLV+Y GRAP 
Sbjct  68   WFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKPPGAILIGMKKTLVFYRGRAPH  127

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            G RT+W++HEYRT+E++FD    G   FVLCRLF+K E K
Sbjct  128  GVRTNWIMHEYRTSESEFDSGEQGS--FVLCRLFKKPEDK  165



>ref|XP_010934040.1| PREDICTED: uncharacterized protein LOC105054253 isoform X1 [Elaeis 
guineensis]
Length=685

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  336
            SLP+G+RFRPTDEELV+HYLK KI G   +EV VI +VD+CK EPWDLPD S + S D E
Sbjct  8    SLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSVIRSDDPE  67

Query  337  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPE  510
            WFFF P+DRKY  G R NRATE GYWKATG+DR I ++      +GMKKTLV+Y GRAP 
Sbjct  68   WFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKPPGAILIGMKKTLVFYRGRAPH  127

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            G RT+W++HEYRT+E++FD    G   FVLCRLF+K E K
Sbjct  128  GVRTNWIMHEYRTSESEFDSGEQGS--FVLCRLFKKPEDK  165



>ref|XP_008808290.1| PREDICTED: uncharacterized protein LOC103720389 [Phoenix dactylifera]
Length=609

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 122/163 (75%), Gaps = 5/163 (3%)
 Frame = +1

Query  151  PLHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESH  327
            PL SLP G+RF PTDEELV+HYLK KI G   +EV VI EVD+CK EPWDLPD S + S 
Sbjct  5    PLESLPRGFRFHPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSVIRSD  64

Query  328  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR  501
            D EWFFF P+DRKY +G R NRAT+ GYWKATG+DR I ++      +GMKKTLV++ GR
Sbjct  65   DPEWFFFSPRDRKYPSGHRSNRATKAGYWKATGRDRMIKTKPPGSTIIGMKKTLVFHRGR  124

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            AP+G RT+W+IHEYRTTE +FD    G   FVLCRLF+K E K
Sbjct  125  APKGVRTNWIIHEYRTTEFEFDSGEQGS--FVLCRLFKKPEEK  165



>ref|XP_010941181.1| PREDICTED: uncharacterized protein LOC105059551 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV+HYLK KITG  +++V VI EVD+CK EPWDLPD S + S D
Sbjct  6    LELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   LEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            RAP+G RTHW++HEYRTTE +F+     Q  +VL RLF+K E K
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES--GVQGGYVLYRLFKKSEEK  167



>ref|XP_010941180.1| PREDICTED: uncharacterized protein LOC105059551 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV+HYLK KITG  +++V VI EVD+CK EPWDLPD S + S D
Sbjct  6    LELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  A     +GMKKTLV++ G
Sbjct  66   LEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHNVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            RAP+G RTHW++HEYRTTE +F+     Q  +VL RLF+K E K
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES--GVQGGYVLYRLFKKSEEK  167



>ref|XP_006659850.1| PREDICTED: uncharacterized protein LOC102700454 [Oryza brachyantha]
Length=698

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV HYLK KITG   AE  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRAEAEVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+G+RT W++HEYRTTE +F+    G   +VL RLFRK E K++
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGEQGG--YVLYRLFRKQEEKIE  169



>ref|XP_008788721.1| PREDICTED: uncharacterized protein LOC103706411 isoform X1 [Phoenix 
dactylifera]
Length=715

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L SLP+G+RF PTDEELV HYLK KI G  + EV VI EVD+CK EPWDLPD S + S D
Sbjct  6    LGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  +     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHSVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G RTHW++HEYRTTE +F+     Q  +VL RLF+K E
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES--GDQGGYVLYRLFKKPE  165



>ref|XP_008788722.1| PREDICTED: uncharacterized protein LOC103706411 isoform X2 [Phoenix 
dactylifera]
Length=707

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L SLP+G+RF PTDEELV HYLK KI G  + EV VI EVD+CK EPWDLPD S + S D
Sbjct  6    LGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSIIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+  +     +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHSVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RAP+G RTHW++HEYRTTE +F+     Q  +VL RLF+K E
Sbjct  126  RAPKGIRTHWIMHEYRTTEPEFES--GDQGGYVLYRLFKKPE  165



>gb|EEC82928.1| hypothetical protein OsI_27885 [Oryza sativa Indica Group]
Length=738

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L  LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S + S D
Sbjct  6    LKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSLIRSDD  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLD  636
            RAP+G+RT W++HEYRTTE +F+    G   +VL RLFRK E K++
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGEQGG--YVLYRLFRKQEEKIE  169



>ref|XP_006846446.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
 gb|ERN08121.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
Length=567

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN  333
            L SLP G+RFRP+DEELV +YL  KI G    V VI E+D+CK EPWDLP  S +++ D 
Sbjct  6    LESLPPGFRFRPSDEELVSYYLIRKINGGGG-VDVIPEIDMCKCEPWDLPGKSIIKTEDP  64

Query  334  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSR-KGAKVGMKKTLVYYLGRAPE  510
            EWFFFCP+DRKY NG+R NRATE GYWKATGKDRTI S+ + + +G KKTLV+Y GRAP 
Sbjct  65   EWFFFCPRDRKYPNGRRSNRATEAGYWKATGKDRTIKSKSRRSLIGTKKTLVFYEGRAPH  124

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GKRTHW++HEYR   N     +  Q  +VLCRLF+K
Sbjct  125  GKRTHWIMHEYRANGNALQDLNGSQDAYVLCRLFKK  160



>ref|XP_009397631.1| PREDICTED: uncharacterized protein LOC103982434 [Musa acuminata 
subsp. malaccensis]
Length=640

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 6/161 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLP-DMSFVESH  327
            + SLP+G+RFRPTD ELV+HYLK KITG  ++E+ VI E+D+CK EPWD+P D S ++S 
Sbjct  6    VESLPLGFRFRPTDAELVNHYLKGKITGRIKSEIEVIPEIDVCKCEPWDVPADKSLIKSI  65

Query  328  DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV--GMKKTLVYYLGR  501
            D EWFFF PKDRKY +G R NRATE GYWKATGKDRTI SR    +  GMKKTLV++ GR
Sbjct  66   DPEWFFFSPKDRKYPSGNRSNRATEAGYWKATGKDRTIKSRSPGSMILGMKKTLVFHRGR  125

Query  502  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            AP+G RT+W++HEYRTTE +++     Q  +VLCRLFRK E
Sbjct  126  APKGVRTNWIMHEYRTTEPEYES--GEQGGYVLCRLFRKPE  164



>ref|XP_009389125.1| PREDICTED: NAC domain-containing protein 19-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHDNE  336
            SLP+G+RFRPTD ELV+HYLK KI+G  ++EV VI E+D+CK+EP DLPD S  +S D+E
Sbjct  16   SLPLGFRFRPTDVELVNHYLKGKISGRIKSEVEVIPEIDVCKYEPCDLPDKSLTKSVDSE  75

Query  337  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG--AKVGMKKTLVYYLGRAPE  510
            WFFF PKD+KY N  R NRATE GYWK TGKDR I S     A +GMKKTLV++LGRAP+
Sbjct  76   WFFFAPKDKKYPNSNRSNRATEAGYWKPTGKDRMIKSGSACPAIIGMKKTLVFHLGRAPK  135

Query  511  GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK  630
            G RT+W++HEYRT E+  +     Q  FVLCRLFRK E K
Sbjct  136  GVRTNWIMHEYRTLES--ESVSGEQGGFVLCRLFRKPEEK  173



>ref|XP_009383033.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP+ SF+ S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPEKSFLPSKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT  GYWKATGKDR +SS++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATRAGYWKATGKDRRVSSQRRA-VGMKKTLVYYRGRAPHGSR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRKV  621
            T WV+HEYR  EN+ +   AG Q  + LCR+F+K 
Sbjct  124  TDWVMHEYRLDENECENASAGLQDAYALCRVFKKT  158



>ref|XP_009390804.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            +LP G+RF PTDEELV +YLK KI G   E+ +I EVD+ K EPW+LP+ SF+ S D EW
Sbjct  5    TLPPGFRFHPTDEELVGYYLKKKINGHNLELEIIPEVDLYKCEPWELPEKSFLPSKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR +SS++ A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATQSGYWKATGKDRRVSSQRRA-VGMKKTLVYYRGRAPHGSR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRK  618
            T WV+HEYR  EN+ + T +G Q  + LCR+F+K
Sbjct  124  TDWVMHEYRLDENECETTASGFQDSYALCRVFKK  157



>gb|AGL39704.1| NAC transcription factor 048 [Jatropha curcas]
 gb|KDP45802.1| hypothetical protein JCGZ_17409 [Jatropha curcas]
Length=237

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWELAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT+ GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATKAGYWKSTGKDRRVNSQNRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  + + D T A Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKESDDTSAIQDSYALCRVFKK  156



>dbj|BAJ97142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP+G+RT W++HEYRTTE +F+     Q  +VL RLF+K
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQK  163



>gb|EMT07892.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=694

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP+G+RT W++HEYRTTE +F+    G   +VL RLF+K
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGEQGG--YVLYRLFQK  163



>emb|CBI38740.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLPVG+RF PTDEELVDHYLK+KI G  + V +I EVD+CK EPWDLP +S ++++D EW
Sbjct  5    SLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTNDPEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK  516
            FFFCP D KY  G+R NRATE GYWK TGKDR I SR   + +G KKTLV+Y GRAP+  
Sbjct  65   FFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSRATKELLGTKKTLVFYRGRAPQSV  124

Query  517  RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE  624
            RT+WV+HEYR          A    +VLCRL RK +
Sbjct  125  RTNWVMHEYRAAIASLPANKA----YVLCRLKRKTD  156



>gb|EMS48745.1| NAC domain-containing protein 78 [Triticum urartu]
Length=722

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = +1

Query  154  LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD  330
            L +LP+G+RF PTDEELV HYLK KITG  + EV VI E+D+CK EPWDLPD + + S D
Sbjct  6    LKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKALIRSED  65

Query  331  NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG  498
             EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct  66   PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKGEKKKQHMIGMKKTLVFHRG  125

Query  499  RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            RAP+G+RT W++HEYRTTE +F+     Q  +VL RLF+K
Sbjct  126  RAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQK  163



>gb|EYU22270.1| hypothetical protein MIMGU_mgv1a022636mg, partial [Erythranthe 
guttata]
Length=213

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 7/164 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKIQGQEIELDIIPEVDLYKCEPWELAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVNSQNRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
            GRAP+G RT WV+HEYR  + +++ T   Q  + LCR+F+K  L
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKEWEDTSGIQDSYALCRVFKKNGL  159



>ref|XP_009145987.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
Length=245

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI+G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKISGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>emb|CDX92153.1| BnaA05g22540D [Brassica napus]
Length=226

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI+G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKISGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>ref|XP_009413063.1| PREDICTED: uncharacterized protein LOC103994453 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=396

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP+ SF+   D EW
Sbjct  5    SLPPGFRFHPTDEELVVYYLKRKINGRELELEIIPEVDLYKCEPWDLPEKSFLPGKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR +SS++ A VG KKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATQAGYWKATGKDRRVSSQRRA-VGTKKTLVYYRGRAPHGSR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRKV  621
            T WV+HEYR  E + +   AG Q  + LCR+F+K 
Sbjct  124  TDWVMHEYRLDEKECENAAAGLQDAYALCRVFKKT  158



>ref|XP_010505816.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=247

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>ref|XP_010465831.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=247

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>ref|XP_006298357.1| hypothetical protein CARUB_v10014426mg, partial [Capsella rubella]
 gb|EOA31255.1| hypothetical protein CARUB_v10014426mg, partial [Capsella rubella]
Length=261

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  19   PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  72

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  73   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYK  131

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  132  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  172



>ref|XP_004157040.1| PREDICTED: uncharacterized protein LOC101224912 [Cucumis sativus]
Length=654

 Score =   199 bits (507),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPGKSLLPSKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQSRA-VGMKKTLVYYRGRAPHGAR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRK  618
            T WV+HEYR  + + +   +G Q  + LCR+F+K
Sbjct  124  TDWVMHEYRLDDRECEVASSGLQDAYALCRVFKK  157



>ref|XP_004148915.1| PREDICTED: uncharacterized protein LOC101209310 [Cucumis sativus]
 gb|KGN50914.1| hypothetical protein Csa_5G324000 [Cucumis sativus]
Length=654

 Score =   199 bits (507),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPGKSLLPSKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQSRA-VGMKKTLVYYRGRAPHGAR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRK  618
            T WV+HEYR  + + +   +G Q  + LCR+F+K
Sbjct  124  TDWVMHEYRLDDRECEVASSGLQDAYALCRVFKK  157



>ref|XP_003600640.1| NAC domain protein [Medicago truncatula]
 gb|AES70891.1| NAC transcription factor-like protein [Medicago truncatula]
Length=672

 Score =   199 bits (507),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 92/154 (60%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G   E+ +I EVD+ K EPWDLP  S +   D EW
Sbjct  5    SLPPGFRFHPTDEELVSYYLKRKINGRRIELEIIPEVDLYKCEPWDLPGKSLLPGKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++++  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNAQTRA-VGMKKTLVYYRGRAPHGSR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRK  618
            T WV+HEYR  E + D   +G Q  + LCR+F+K
Sbjct  124  TGWVMHEYRLDERECDNPSSGLQDAYALCRIFKK  157



>ref|XP_008439242.1| PREDICTED: protein BEARSKIN1 [Cucumis melo]
Length=248

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI+G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKISGQEIELDIIPEVDLYKCEPWELSEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR +SS+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVSSQNRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   + +   Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCEDSSGIQDSYALCRVFKK  156



>ref|XP_003537430.2| PREDICTED: uncharacterized protein LOC100808596 [Glycine max]
Length=671

 Score =   199 bits (507),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 90/153 (59%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G + E+ +I EVD+ K EPWDLP  S +   D EW
Sbjct  7    SLPPGFRFHPTDEELVSYYLKRKINGRKIELEIIPEVDLYKCEPWDLPGKSLLPGKDLEW  66

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A +GMKKTLVYY GRAP G R
Sbjct  67   YFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNSQSRA-IGMKKTLVYYRGRAPHGCR  125

Query  520  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            T WV+HEYR  E + +     Q  + LCR+F+K
Sbjct  126  TGWVMHEYRLDETQCETNSGLQDAYALCRVFKK  158



>ref|XP_010487668.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=247

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>ref|XP_004137396.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
 gb|KGN63971.1| hypothetical protein Csa_1G032410 [Cucumis sativus]
Length=248

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI+G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKISGQEIELDIIPEVDLYKCEPWELSEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR +SS+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVSSQNRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   + +   Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCEDSSGIQDSYALCRVFKK  156



>ref|XP_006406699.1| hypothetical protein EUTSA_v10021408mg [Eutrema salsugineum]
 gb|ESQ48152.1| hypothetical protein EUTSA_v10021408mg [Eutrema salsugineum]
Length=244

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>ref|XP_011072043.1| PREDICTED: NAC domain-containing protein 86 [Sesamum indicum]
Length=243

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 116/164 (71%), Gaps = 7/164 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPW+L + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKIHGQEIELDIIPEVDLYKCEPWELAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTSQNRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL  627
            GRAP+G RT WV+HEYR  +   D T   Q  + LCR+F+K  L
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDSDDTSGIQDSYALCRVFKKNGL  159



>gb|KHN24171.1| NAC domain-containing protein 74 [Glycine soja]
Length=687

 Score =   199 bits (507),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 90/153 (59%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G + E+ +I EVD+ K EPWDLP  S +   D EW
Sbjct  7    SLPPGFRFHPTDEELVSYYLKRKINGRKIELEIIPEVDLYKCEPWDLPGKSLLPGKDLEW  66

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A +GMKKTLVYY GRAP G R
Sbjct  67   YFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNSQSRA-IGMKKTLVYYRGRAPHGCR  125

Query  520  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            T WV+HEYR  E + +     Q  + LCR+F+K
Sbjct  126  TGWVMHEYRLDETQCETNSGLQDAYALCRVFKK  158



>ref|XP_008463166.1| PREDICTED: uncharacterized protein LOC103501372 [Cucumis melo]
Length=655

 Score =   199 bits (506),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  160  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW  339
            SLP G+RF PTDEELV +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct  5    SLPPGFRFHPTDEELVAYYLKRKINGREIELEIIPEVDLYKCEPWDLPGKSLLPSKDLEW  64

Query  340  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR  519
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S+  A VGMKKTLVYY GRAP G R
Sbjct  65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQSRA-VGMKKTLVYYRGRAPHGAR  123

Query  520  THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRK  618
            T WV+HEYR  + + +   +G Q  + LCR+F+K
Sbjct  124  TDWVMHEYRLDDRECEVASSGLQDAYALCRVFKK  157



>ref|NP_188400.1| NAC domain containing protein 57 [Arabidopsis thaliana]
 dbj|BAB02867.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAY78743.1| no apical meristem family protein [Arabidopsis thaliana]
 gb|AEE76000.1| NAC domain containing protein 57 [Arabidopsis thaliana]
Length=246

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYK  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



>gb|AIU39717.1| NAC transcription factor 57 [Brassica napus]
Length=245

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  136  PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF  315
            P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct  3    PVGLPP------GFRFHPTDEELVNYYLKRKICGQEIELDIIPEVDLYKCEPWDLAEKSF  56

Query  316  VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL  495
            + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct  57   LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYR  115

Query  496  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK  618
            GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct  116  GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625