BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022J17

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008449685.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    287   3e-88   Cucumis melo [Oriental melon]
ref|XP_004140205.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    286   1e-87   
gb|KGN48112.1|  hypothetical protein Csa_6G434320                       287   5e-86   Cucumis sativus [cucumbers]
gb|AJB84628.1|  magnesium-chelatase subunit D                           277   3e-84   Camellia sinensis [black tea]
gb|KCW51128.1|  hypothetical protein EUGRSUZ_J00729                     271   3e-83   Eucalyptus grandis [rose gum]
ref|XP_004236627.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    275   3e-83   Solanum lycopersicum
ref|XP_010031752.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    271   5e-83   Eucalyptus grandis [rose gum]
ref|XP_010031751.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    271   1e-82   Eucalyptus grandis [rose gum]
ref|XP_010246236.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    273   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006350212.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    273   2e-82   Solanum tuberosum [potatoes]
ref|XP_002513534.1|  Magnesium-chelatase subunit chlD, chloroplas...    272   2e-82   Ricinus communis
gb|KCW51126.1|  hypothetical protein EUGRSUZ_J00729                     270   2e-82   Eucalyptus grandis [rose gum]
gb|EPS59030.1|  hypothetical protein M569_15780                         258   5e-82   Genlisea aurea
ref|XP_010031750.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    271   7e-82   Eucalyptus grandis [rose gum]
ref|XP_009802534.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    270   2e-81   Nicotiana sylvestris
ref|XP_011080379.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    270   2e-81   Sesamum indicum [beniseed]
ref|XP_008806572.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    268   7e-81   Phoenix dactylifera
ref|XP_009629316.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    268   8e-81   Nicotiana tomentosiformis
ref|XP_010651832.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    267   1e-80   Vitis vinifera
ref|XP_010922222.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    267   2e-80   Elaeis guineensis
ref|XP_009413527.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    267   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006573816.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    264   2e-80   Glycine max [soybeans]
ref|XP_009413526.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    267   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
sp|O24133.1|CHLD_TOBAC  RecName: Full=Magnesium-chelatase subunit...    267   2e-80   Nicotiana tabacum [American tobacco]
ref|XP_010105401.1|  Magnesium-chelatase subunit chlD                   267   3e-80   Morus notabilis
ref|XP_006379057.1|  hypothetical protein POPTR_0009s05400g             266   3e-80   
ref|XP_002314091.2|  Mg-chelatase subunit D family protein              266   5e-80   
ref|XP_007214542.1|  hypothetical protein PRUPE_ppa001804mg             266   7e-80   Prunus persica
ref|XP_011032080.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    266   8e-80   Populus euphratica
ref|XP_008227213.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    266   8e-80   Prunus mume [ume]
ref|XP_006470704.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    265   1e-79   Citrus sinensis [apfelsine]
ref|XP_003517516.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    263   4e-79   Glycine max [soybeans]
gb|KHN25632.1|  Magnesium-chelatase subunit chlD, chloroplastic         263   4e-79   Glycine soja [wild soybean]
ref|XP_010673713.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    263   5e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO50423.1|  hypothetical protein CISIN_1g004256mg                   260   5e-79   Citrus sinensis [apfelsine]
emb|CDP08502.1|  unnamed protein product                                263   1e-78   Coffea canephora [robusta coffee]
ref|XP_006590476.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    259   1e-78   Glycine max [soybeans]
gb|KDO50421.1|  hypothetical protein CISIN_1g004256mg                   259   2e-78   Citrus sinensis [apfelsine]
ref|XP_006369577.1|  hypothetical protein POPTR_0001s26140g             248   2e-78   
gb|EYU35928.1|  hypothetical protein MIMGU_mgv1a001714mg                261   3e-78   Erythranthe guttata [common monkey flower]
ref|XP_010557506.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    261   3e-78   Tarenaya hassleriana [spider flower]
gb|KDO50422.1|  hypothetical protein CISIN_1g004256mg                   259   4e-78   Citrus sinensis [apfelsine]
gb|KDO50420.1|  hypothetical protein CISIN_1g004256mg                   261   4e-78   Citrus sinensis [apfelsine]
ref|XP_006590475.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    258   5e-78   Glycine max [soybeans]
gb|KJB21818.1|  hypothetical protein B456_004G015600                    259   2e-77   Gossypium raimondii
ref|XP_009337032.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    259   2e-77   Pyrus x bretschneideri [bai li]
gb|KJB21817.1|  hypothetical protein B456_004G015600                    259   2e-77   Gossypium raimondii
ref|XP_003538089.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    259   2e-77   Glycine max [soybeans]
sp|O22437.1|CHLD_PEA  RecName: Full=Magnesium-chelatase subunit C...    258   5e-77   Pisum sativum [garden pea]
gb|KHG27451.1|  Magnesium-chelatase subunit chlD, chloroplastic         257   1e-76   Gossypium arboreum [tree cotton]
gb|KEH27405.1|  protoporphyrin IX magnesium chelatase subunit ChlD      254   1e-76   Medicago truncatula
gb|KDP22132.1|  hypothetical protein JCGZ_25963                         256   2e-76   Jatropha curcas
ref|XP_007158593.1|  hypothetical protein PHAVU_002G165600g             256   2e-76   Phaseolus vulgaris [French bean]
ref|XP_008363236.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    257   2e-76   
ref|XP_003610971.1|  Magnesium-chelatase subunit chlD                   255   4e-76   Medicago truncatula
ref|XP_004517295.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    254   5e-76   Cicer arietinum [garbanzo]
dbj|BAJ92350.1|  predicted protein                                      244   1e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011459478.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    254   1e-75   Fragaria vesca subsp. vesca
ref|XP_007015160.1|  Albina 1                                           254   2e-75   
ref|XP_004981316.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    253   3e-75   Setaria italica
gb|AAO00766.1|  Mg-chelatase, putative                                  246   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417679.1|  hypothetical protein EUTSA_v10006894mg             253   4e-75   Eutrema salsugineum [saltwater cress]
dbj|BAH19517.1|  AT1G08520                                              245   5e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AFW67236.1|  hypothetical protein ZEAMMB73_644992                    251   7e-75   
ref|XP_008644403.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    251   1e-74   Zea mays [maize]
ref|XP_002889699.1|  T27G7.20                                           252   1e-74   
ref|XP_002466225.1|  hypothetical protein SORBIDRAFT_01g003860          251   1e-74   Sorghum bicolor [broomcorn]
gb|KFK43171.1|  hypothetical protein AALP_AA1G089000                    249   1e-73   Arabis alpina [alpine rockcress]
ref|XP_003563940.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    248   4e-73   Brachypodium distachyon [annual false brome]
ref|XP_010475652.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    247   7e-73   Camelina sativa [gold-of-pleasure]
emb|CDX95054.1|  BnaC05g06170D                                          246   1e-72   
ref|NP_563821.2|  magnesium-chelatase subunit chlD                      246   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ32779.1|  chloroplast Mg-chelatase subunit XANTHA-G precursor     246   2e-72   Hordeum vulgare [barley]
gb|AAD52031.1|AF083555_1  magnesium-chelatase subunit CHLD precursor    245   3e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAF22895.1|AC006932_12  T27G7.20                                     246   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306844.1|  hypothetical protein CARUB_v10008387mg             245   4e-72   Capsella rubella
gb|AAP73850.1|  putative magnesium chelatase subunit chlD               244   1e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051668.1|  Os03g0811100                                       244   1e-71   
emb|CDX93557.1|  BnaA06g04910D                                          243   2e-71   
ref|XP_009148107.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    243   2e-71   Brassica rapa
ref|XP_010488958.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    240   2e-70   Camelina sativa [gold-of-pleasure]
gb|EMT09999.1|  Magnesium-chelatase subunit chlD, chloroplastic         238   3e-69   
ref|XP_001764245.1|  predicted protein                                  230   1e-66   
ref|XP_006651947.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    225   2e-65   
ref|XP_009338554.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium-ch...    224   4e-64   
ref|XP_002975141.1|  hypothetical protein SELMODRAFT_174616             217   4e-62   
ref|XP_002977545.1|  hypothetical protein SELMODRAFT_176264             216   1e-61   
ref|XP_010458091.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    199   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003079609.1|  Mg-chelatase subunit (ISS)                         198   5e-55   Ostreococcus tauri
ref|XP_001418124.1|  predicted protein                                  197   7e-55   Ostreococcus lucimarinus CCE9901
ref|XP_002508833.1|  predicted protein                                  193   2e-53   Micromonas commoda
ref|XP_007514351.1|  protoporphyrin IX magnesium chelatase subuni...    193   3e-53   Bathycoccus prasinos
ref|XP_003059510.1|  magnesium-chelatase subunit chlD chloroplast...    192   6e-53   Micromonas pusilla CCMP1545
gb|KIY96026.1|  magnesium chelatase subunit D                           184   1e-52   Monoraphidium neglectum
gb|KIE06603.1|  magnesium chelatase                                     189   8e-52   Tolypothrix bouteillei VB521301
ref|WP_015224439.1|  protoporphyrin IX magnesium-chelatase              187   4e-51   Halothece sp. PCC 7418
ref|WP_015230419.1|  Mg-chelatase subunit ChlI                          186   5e-51   Dactylococcopsis salina
ref|WP_026103229.1|  magnesium chelatase                                186   7e-51   Pseudanabaena sp. PCC 6802
ref|XP_001700902.1|  magnesium chelatase subunit D                      186   1e-50   Chlamydomonas reinhardtii
ref|WP_017716658.1|  magnesium-chelatase subunit ChlD                   185   1e-50   Oscillatoria sp. PCC 10802
ref|XP_002956151.1|  magnesium chelatase subunit D chloroplast pr...    182   2e-49   Volvox carteri f. nagariensis
ref|WP_027404926.1|  magnesium chelatase                                182   2e-49   Aphanizomenon flos-aquae
ref|XP_002956152.1|  hypothetical protein VOLCADRAFT_121490             182   2e-49   Volvox carteri f. nagariensis
ref|WP_015153650.1|  protoporphyrin IX magnesium-chelatase              181   3e-49   Chroococcidiopsis thermalis
ref|WP_015207701.1|  protoporphyrin IX magnesium-chelatase              181   4e-49   Cylindrospermum stagnale
ref|WP_035150399.1|  magnesium chelatase                                181   5e-49   Calothrix sp. 336/3
ref|WP_028089282.1|  magnesium chelatase                                181   5e-49   Dolichospermum circinale
ref|WP_015197436.1|  protoporphyrin IX magnesium-chelatase              181   6e-49   Calothrix parietina
ref|WP_028082200.1|  magnesium chelatase                                180   6e-49   Dolichospermum circinale
gb|KIJ82576.1|  magnesium chelatase                                     181   6e-49   Scytonema tolypothrichoides VB-61278
ref|WP_016860550.1|  magnesium-chelatase subunit ChlD                   180   1e-48   Fischerella muscicola
ref|WP_015204373.1|  protoporphyrin IX magnesium-chelatase              180   1e-48   Crinalium epipsammum
ref|WP_015080654.1|  magnesium chelatase ATPase subunit                 179   1e-48   Anabaena sp. 90
ref|WP_006277092.1|  magnesium-chelatase subunit ChlD                   179   2e-48   Cylindrospermopsis raciborskii
ref|WP_026721783.1|  magnesium chelatase                                179   2e-48   Fischerella sp. PCC 9431
ref|WP_015135326.1|  protoporphyrin IX magnesium-chelatase              179   3e-48   Leptolyngbya sp. PCC 7376
ref|WP_039200580.1|  magnesium chelatase                                178   4e-48   Aphanizomenon flos-aquae
ref|WP_040687697.1|  magnesium chelatase                                177   5e-48   
gb|ELS33326.1|  protoporphyrin IX magnesium-chelatase                   178   5e-48   Pseudanabaena biceps PCC 7429
ref|XP_005645047.1|  magnesium chelatase subunit D                      177   7e-48   Coccomyxa subellipsoidea C-169
ref|XP_010246237.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    177   8e-48   Nelumbo nucifera [Indian lotus]
ref|WP_017310168.1|  magnesium-chelatase subunit ChlD                   177   1e-47   Fischerella sp. PCC 9339
ref|WP_006196704.1|  magnesium-chelatase subunit ChlD                   176   1e-47   Nodularia spumigena
ref|WP_044450019.1|  magnesium chelatase                                176   2e-47   Mastigocladus laminosus
ref|WP_026104071.1|  magnesium chelatase                                176   2e-47   Anabaena sp. PCC 7108
ref|WP_039715972.1|  magnesium chelatase                                176   2e-47   
ref|WP_010994455.1|  magnesium-chelatase subunit ChlD                   176   3e-47   Nostocaceae
ref|WP_011319823.1|  magnesium-chelatase subunit ChlD                   176   3e-47   Trichormus variabilis
ref|WP_015137423.1|  magnesium chelatase ATPase subunit D               175   4e-47   Nostoc sp. PCC 7524
ref|WP_038297161.1|  magnesium chelatase, partial [                     172   5e-47   
ref|WP_015216626.1|  protoporphyrin IX magnesium-chelatase              175   5e-47   Anabaena cylindrica
ref|WP_019507353.1|  magnesium-chelatase subunit ChlD                   174   7e-47   Pleurocapsa sp. PCC 7319
ref|WP_019493900.1|  magnesium-chelatase subunit ChlD                   174   8e-47   Calothrix sp. PCC 7103
ref|WP_015956003.1|  magnesium-chelatase subunit ChlD                   174   8e-47   Cyanothece sp. PCC 7424
ref|WP_015148342.1|  protoporphyrin IX magnesium-chelatase              174   9e-47   Oscillatoria acuminata
gb|EFA73344.1|  Magnesium chelatase ATPase subunit D                    174   2e-46   Raphidiopsis brookii D9
ref|WP_026733423.1|  magnesium chelatase                                174   2e-46   Fischerella sp. PCC 9605
ref|WP_040553567.1|  magnesium chelatase                                173   2e-46   Raphidiopsis brookii
ref|WP_041041571.1|  magnesium chelatase                                172   4e-46   Tolypothrix campylonemoides
ref|WP_016873557.1|  magnesium-chelatase subunit ChlD                   172   4e-46   Chlorogloeopsis fritschii
ref|WP_017321794.1|  magnesium-chelatase subunit ChlD                   172   4e-46   cyanobacterium PCC 7702
ref|WP_015120155.1|  protoporphyrin IX magnesium-chelatase              172   5e-46   Rivularia sp. PCC 7116
ref|WP_016864776.1|  magnesium-chelatase subunit ChlD                   172   5e-46   Fischerella muscicola
ref|WP_015160910.1|  magnesium chelatase ATPase subunit D               172   6e-46   Chamaesiphon minutus
ref|WP_011614175.1|  magnesium-chelatase subunit ChlD                   172   6e-46   Trichodesmium erythraeum
ref|WP_009457764.1|  MULTISPECIES: magnesium-chelatase subunit ChlD     172   7e-46   Fischerella thermalis
ref|WP_015222191.1|  protoporphyrin IX magnesium-chelatase              171   9e-46   
ref|WP_015186804.1|  protoporphyrin IX magnesium-chelatase              171   1e-45   Gloeocapsa sp. PCC 7428
ref|WP_039739178.1|  magnesium chelatase                                171   1e-45   
ref|WP_012408069.1|  magnesium-chelatase subunit ChlD                   171   1e-45   Nostoc punctiforme
ref|WP_015167493.1|  magnesium chelatase ATPase subunit D               171   2e-45   Synechococcus sp. PCC 7502
ref|WP_015165944.1|  protoporphyrin IX magnesium-chelatase              171   2e-45   Pseudanabaena sp. PCC 7367
ref|WP_015172429.1|  protoporphyrin IX magnesium-chelatase              170   2e-45   Geitlerinema sp. PCC 7407
ref|WP_017651554.1|  magnesium-chelatase subunit ChlD                   170   3e-45   Fortiea contorta
ref|WP_042342578.1|  magnesium chelatase                                169   4e-45   Calothrix sp. PCC 7507
gb|AFY36234.1|  protoporphyrin IX magnesium-chelatase                   169   4e-45   Calothrix sp. PCC 7507
ref|WP_012306227.1|  magnesium-chelatase subunit ChlD                   169   5e-45   Synechococcus
ref|WP_017660572.1|  magnesium-chelatase subunit ChlD                   169   7e-45   Geitlerinema sp. PCC 7105
ref|WP_017741312.1|  magnesium-chelatase subunit ChlD                   169   9e-45   
ref|WP_015115743.1|  protoporphyrin IX magnesium-chelatase              168   1e-44   Nostoc sp. PCC 7107
ref|WP_030005855.1|  magnesium chelatase                                168   1e-44   Synechococcus sp. NKBG042902
ref|WP_040466875.1|  magnesium chelatase                                167   2e-44   Geminocystis herdmanii
ref|WP_027840190.1|  magnesium chelatase                                167   2e-44   Mastigocoleus testarum
ref|WP_040899190.1|  magnesium chelatase                                167   3e-44   
gb|ELS01041.1|  magnesium chelatase ATPase subunit D                    167   3e-44   Xenococcus sp. PCC 7305
ref|WP_015142056.1|  magnesium chelatase ATPase subunit D               167   3e-44   Pleurocapsa minor
ref|WP_015224247.1|  protoporphyrin IX magnesium-chelatase              167   4e-44   Halothece sp. PCC 7418
ref|WP_036476619.1|  magnesium chelatase                                166   5e-44   Myxosarcina sp. GI1
ref|WP_035985411.1|  magnesium chelatase                                166   5e-44   Leptolyngbya sp. KIOST-1
ref|WP_013321313.1|  magnesium-chelatase subunit ChlD                   166   6e-44   Cyanothece sp. PCC 7822
ref|WP_037221118.1|  magnesium chelatase                                166   7e-44   
ref|WP_006101723.1|  magnesium-chelatase subunit ChlD                   166   7e-44   Coleofasciculus chthonoplastes
gb|AFZ55087.1|  protoporphyrin IX magnesium-chelatase                   166   9e-44   Cyanobacterium aponinum PCC 10605
ref|WP_041236163.1|  magnesium chelatase                                166   1e-43   
gb|ACL43185.1|  magnesium chelatase ATPase subunit D                    165   1e-43   Cyanothece sp. PCC 7425
ref|WP_041922943.1|  magnesium chelatase                                166   1e-43   
ref|WP_040940037.1|  magnesium chelatase                                165   1e-43   
ref|WP_012161187.1|  magnesium-chelatase subunit ChlD                   165   1e-43   Acaryochloris marina
ref|WP_010871417.1|  magnesium-chelatase subunit ChlD                   165   1e-43   Synechocystis
emb|CAA65418.1|  magnesium chelatase                                    165   2e-43   Synechocystis sp. PCC 6803
ref|WP_010478137.1|  magnesium-chelatase subunit ChlD                   165   2e-43   Acaryochloris sp. CCMEE 5410
ref|WP_006456157.1|  magnesium-chelatase subunit ChlD                   164   3e-43   Synechococcus sp. PCC 7335
ref|WP_040945156.1|  magnesium chelatase                                164   3e-43   
ref|WP_013192842.1|  magnesium-chelatase subunit ChlD                   164   3e-43   Trichormus azollae
ref|WP_008232821.1|  Protoporphyrin IX Mg-chelatase subunit D           164   3e-43   Richelia intracellularis
ref|WP_017289571.1|  magnesium-chelatase subunit ChlD                   164   3e-43   Leptolyngbya boryana
ref|WP_017327748.1|  hypothetical protein                               164   4e-43   Synechococcus sp. PCC 7336
gb|AFZ18337.1|  protoporphyrin IX magnesium-chelatase                   164   6e-43   Microcoleus sp. PCC 7113
ref|WP_041780025.1|  magnesium chelatase                                163   6e-43   Microcoleus sp. PCC 7113
ref|WP_012596729.1|  magnesium-chelatase subunit ChlD                   163   9e-43   Cyanothece sp. PCC 8801
ref|WP_015784261.1|  magnesium-chelatase subunit ChlD                   163   9e-43   Cyanothece sp. PCC 8802
ref|WP_008227854.1|  Protoporphyrin IX Mg-chelatase subunit D           163   1e-42   Richelia intracellularis
ref|WP_008309117.1|  magnesium chelatase ATPase subunit D               163   1e-42   Leptolyngbya sp. PCC 6406
ref|WP_015194081.1|  protoporphyrin IX magnesium-chelatase              162   1e-42   Stanieria cyanosphaera
ref|WP_017297332.1|  hypothetical protein                               162   2e-42   Nodosilinea nodulosa
ref|WP_035984823.1|  magnesium chelatase                                162   2e-42   Leptolyngbya sp. KIOST-1
ref|WP_028947660.1|  magnesium chelatase                                161   4e-42   Synechocystis sp. PCC 6714
ref|WP_026099665.1|  magnesium chelatase                                159   2e-41   Prochlorothrix hollandica
ref|WP_006529845.1|  magnesium chelatase ATPase subunit D               159   2e-41   Gloeocapsa sp. PCC 73106
ref|WP_006517412.1|  protoporphyrin IX magnesium-chelatase              159   2e-41   Leptolyngbya sp. PCC 7375
ref|WP_008051164.1|  magnesium-chelatase subunit ChlD                   159   2e-41   Arthrospira sp. PCC 8005
ref|WP_006624555.1|  magnesium-chelatase subunit ChlD                   159   3e-41   Arthrospira platensis
ref|WP_014275943.1|  magnesium chelatase subunit D                      159   3e-41   Arthrospira platensis
gb|ABF61893.1|  magnesium chelatase D subunit                           158   3e-41   Arthrospira platensis
ref|WP_035735687.1|  magnesium chelatase                                159   3e-41   Arthrospira platensis
ref|WP_009555513.1|  Mg-chelatase subunit ChlI                          159   3e-41   Oscillatoriales cyanobacterium JSC-12
ref|XP_006446211.1|  hypothetical protein CICLE_v100143611mg            149   4e-41   
ref|WP_015124174.1|  protoporphyrin IX magnesium-chelatase              158   4e-41   Synechococcus sp. PCC 6312
ref|WP_009631867.1|  magnesium chelatase ATPase subunit D               156   2e-40   Synechocystis sp. PCC 7509
ref|WP_006670731.1|  magnesium-chelatase subunit ChlD                   156   2e-40   Arthrospira
ref|WP_004160664.1|  Magnesium-chelatase subunit ChlD                   156   3e-40   Microcystis aeruginosa
ref|WP_002768301.1|  magnesium-chelatase subunit ChlD                   155   4e-40   Microcystis aeruginosa
ref|WP_017315498.1|  magnesium-chelatase subunit ChlD                   155   5e-40   Mastigocladopsis repens
ref|WP_004161459.1|  magnesium-chelatase subunit ChlD                   155   5e-40   Microcystis aeruginosa
emb|CCQ67555.1|  Protoporphyrin IX Mg-chelatase subunit D               150   6e-40   Crocosphaera watsonii WH 0402
ref|WP_022609398.1|  magnesium chelatase ATPase subunit D               155   7e-40   Rubidibacter lacunae
ref|WP_024970736.1|  magnesium chelatase                                154   8e-40   Microcystis aeruginosa
ref|WP_023075338.1|  protoporphyrin ix magnesium-chelatase              154   2e-39   Leptolyngbya sp. Heron Island J
ref|WP_011057253.1|  magnesium-chelatase subunit ChlD                   153   2e-39   Thermosynechococcus elongatus
ref|WP_002761257.1|  magnesium-chelatase subunit ChlD                   152   4e-39   Microcystis aeruginosa
ref|WP_012267152.1|  magnesium-chelatase subunit ChlD                   152   5e-39   Microcystis
ref|WP_004162637.1|  magnesium-chelatase subunit ChlD                   152   5e-39   Microcystis aeruginosa
dbj|GAL95165.1|  protoporphyrin IX Mg-chelatase subunit D               152   5e-39   Microcystis aeruginosa NIES-44
ref|WP_002799821.1|  magnesium-chelatase subunit ChlD                   152   5e-39   Microcystis aeruginosa
ref|WP_002792527.1|  magnesium-chelatase subunit ChlD                   152   5e-39   Microcystis aeruginosa
ref|WP_021829762.1|  Protoporphyrin IX Mg-chelatase subunit D           152   6e-39   
ref|WP_002776007.1|  magnesium-chelatase subunit ChlD                   152   6e-39   Microcystis aeruginosa
ref|WP_016516746.1|  Magnesium-chelatase 38 kDa subunit                 152   7e-39   Microcystis aeruginosa
ref|WP_002744710.1|  magnesium chelatase ATPase subunit D               152   7e-39   Microcystis aeruginosa
ref|WP_021832353.1|  Protoporphyrin IX Mg-chelatase subunit D           151   8e-39   
ref|WP_002753131.1|  magnesium-chelatase subunit ChlD                   152   8e-39   Microcystis aeruginosa
ref|WP_008196613.1|  magnesium-chelatase subunit ChlD                   152   8e-39   Microcystis sp. T1-4
ref|WP_002736428.1|  magnesium chelatase ATPase subunit D               152   9e-39   Microcystis aeruginosa
ref|XP_002178119.1|  predicted protein                                  153   9e-39   Phaeodactylum tricornutum CCAP 1055/1
emb|CAO87035.1|  unnamed protein product                                152   9e-39   Microcystis aeruginosa PCC 7806
gb|ACJ13441.1|  ChlD                                                    145   1e-38   Karlodinium veneficum
emb|CCQ62029.1|  Protoporphyrin IX Mg-chelatase subunit D               151   1e-38   Crocosphaera watsonii WH 0401
ref|WP_042712310.1|  magnesium chelatase                                151   1e-38   Crocosphaera watsonii
gb|EHJ10536.1|  Protoporphyrin IX Mg-chelatase subunit D                151   1e-38   Crocosphaera watsonii WH 0003
ref|WP_035828596.1|  magnesium chelatase                                151   1e-38   Crocosphaera watsonii
gb|EAM48772.1|  Magnesium chelatase, ChlI subunit                       151   2e-38   Crocosphaera watsonii WH 8501
ref|WP_023074366.1|  protoporphyrin ix magnesium-chelatase              151   2e-38   Leptolyngbya sp. Heron Island J
gb|EGK88663.1|  LOW QUALITY PROTEIN: Magnesium chelatase                151   2e-38   Microcoleus vaginatus FGP-2
ref|XP_009032566.1|  hypothetical protein AURANDRAFT_58588              150   3e-38   Aureococcus anophagefferens
ref|WP_008278652.1|  magnesium-chelatase subunit ChlD                   150   4e-38   Cyanothece sp. CCY0110
gb|ACB50424.1|  magnesium chelatase, ATPase subunit D                   150   5e-38   Cyanothece sp. ATCC 51142
ref|WP_024750240.1|  MULTISPECIES: magnesium chelatase                  150   5e-38   Cyanothece
ref|WP_039782182.1|  magnesium chelatase                                149   5e-38   
ref|XP_006843427.1|  hypothetical protein AMTR_s00053p00151810          140   7e-38   
ref|WP_035996666.1|  magnesium chelatase                                149   8e-38   [Leptolyngbya] sp. JSC-1
ref|WP_038331170.1|  magnesium chelatase                                149   8e-38   
emb|CBI14773.3|  unnamed protein product                                148   1e-37   Vitis vinifera
dbj|BAA20346.1|  magnesium-chelatase subunit                            149   1e-37   Synechococcus elongatus PCC 7942
ref|WP_011244135.1|  MULTISPECIES: magnesium-chelatase subunit ChlD     149   1e-37   Synechococcus
dbj|BAH84861.1|  putative Mg-chelatase                                  144   1e-37   Cucumis sativus [cucumbers]
ref|WP_015176521.1|  protoporphyrin IX magnesium-chelatase              148   2e-37   Oscillatoria nigro-viridis
emb|CBJ27091.1|  Magnesium chelatase subunit D, putative chloropl...    148   2e-37   Ectocarpus siliculosus
ref|XP_005761791.1|  hypothetical protein EMIHUDRAFT_420555             148   3e-37   Emiliania huxleyi CCMP1516
ref|WP_039727978.1|  MULTISPECIES: magnesium chelatase                  147   4e-37   Lyngbya confervoides
ref|WP_009784151.1|  magnesium-chelatase subunit ChlD                   146   6e-37   Lyngbya sp. PCC 8106
ref|WP_008185168.1|  magnesium-chelatase subunit ChlD                   146   8e-37   Moorea producens
ref|WP_011429273.1|  magnesium-chelatase subunit ChlD                   146   8e-37   Synechococcus
ref|XP_002288014.1|  predicted protein                                  147   9e-37   Thalassiosira pseudonana CCMP1335
ref|XP_005820500.1|  Mg chelatase, subunitD                             147   1e-36   Guillardia theta CCMP2712
ref|WP_023065348.1|  magnesium chelatase ATPase subunit D               145   2e-36   Lyngbya aestuarii
ref|WP_026797831.1|  magnesium chelatase                                144   4e-36   Planktothrix
ref|WP_042152210.1|  magnesium chelatase                                144   4e-36   Planktothrix agardhii
ref|WP_026794098.1|  MULTISPECIES: magnesium chelatase                  144   4e-36   Planktothrix
ref|WP_027255545.1|  magnesium chelatase                                144   4e-36   Planktothrix agardhii
ref|WP_026786559.1|  magnesium chelatase                                144   4e-36   Planktothrix rubescens
ref|WP_017304357.1|  magnesium-chelatase subunit ChlD                   144   6e-36   Spirulina subsalsa
ref|WP_011140872.1|  magnesium-chelatase subunit ChlD                   143   9e-36   Gloeobacter violaceus
ref|WP_036891654.1|  MULTISPECIES: magnesium chelatase                  144   1e-35   
ref|WP_011124474.1|  magnesium-chelatase subunit ChlD                   144   1e-35   Prochlorococcus
ref|WP_011432356.1|  magnesium-chelatase subunit ChlD                   140   8e-35   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_023173042.1|  magnesium chelatase                                140   2e-34   Gloeobacter kilaueensis
ref|WP_040054553.1|  magnesium chelatase                                140   2e-34   
ref|WP_036916567.1|  MULTISPECIES: magnesium chelatase                  139   4e-34   Prochlorococcus
ref|WP_040650412.1|  magnesium chelatase                                137   4e-34   
emb|CAK22684.1|  Protoporphyrin IX Mg-chelatase subunit ChlD            139   4e-34   
ref|WP_039962896.1|  magnesium chelatase, partial [                     137   4e-34   
ref|WP_007100860.1|  magnesium-chelatase subunit ChlD                   139   5e-34   
ref|WP_041428738.1|  magnesium chelatase                                139   5e-34   
ref|XP_005707985.1|  magnesium chelatase subunit D                      139   6e-34   
ref|WP_012954455.1|  magnesium-chelatase subunit ChlD                   138   1e-33   
ref|WP_036901348.1|  magnesium chelatase                                137   2e-33   
ref|WP_012194870.1|  magnesium-chelatase subunit ChlD                   137   3e-33   
ref|WP_006170999.1|  magnesium-chelatase subunit ChlD                   136   4e-33   
gb|KGG26614.1|  Protoporphyrin IX Mg-chelatase subunit D                136   6e-33   
ref|WP_036913678.1|  MULTISPECIES: magnesium chelatase                  136   6e-33   
ref|WP_011823133.1|  magnesium-chelatase subunit ChlD                   135   8e-33   
gb|KGG13076.1|  Protoporphyrin IX Mg-chelatase subunit D                135   8e-33   
ref|WP_011294287.1|  magnesium-chelatase subunit ChlD                   135   1e-32   
ref|WP_038651205.1|  magnesium chelatase                                135   1e-32   
gb|KGG20309.1|  Protoporphyrin IX Mg-chelatase subunit D                135   1e-32   
ref|WP_036906244.1|  magnesium chelatase                                135   2e-32   
ref|WP_011827097.1|  magnesium-chelatase subunit ChlD                   133   5e-32   
gb|KGG16640.1|  Protoporphyrin IX Mg-chelatase subunit D                132   9e-32   
gb|AII47828.1|  magnesium-chelatase subunit ChlD                        132   1e-31   
ref|WP_038556681.1|  magnesium chelatase                                132   2e-31   
gb|AHF62617.1|  Magnesium chelatase ATPase subunit D                    132   2e-31   
ref|WP_011131253.1|  magnesium-chelatase subunit ChlD                   132   2e-31   
ref|WP_011127089.1|  magnesium-chelatase subunit ChlD                   131   2e-31   
ref|WP_011363240.1|  magnesium-chelatase subunit ChlD                   131   3e-31   
ref|WP_006910211.1|  magnesium-chelatase subunit ChlD                   131   4e-31   
ref|WP_028953453.1|  magnesium chelatase                                129   1e-30   
ref|WP_043694463.1|  magnesium chelatase                                128   3e-30   
ref|XP_005715829.1|  magnesium chelatase subunits I and D               127   4e-30   
ref|WP_019474229.1|  magnesium-chelatase subunit ChlD                   128   5e-30   
ref|WP_038542858.1|  magnesium chelatase                                127   7e-30   
ref|WP_010314405.1|  magnesium-chelatase subunit ChlD                   127   8e-30   
ref|WP_015109688.1|  magnesium chelatase ATPase subunit D               127   1e-29   
ref|WP_011359072.1|  magnesium-chelatase subunit ChlD                   126   1e-29   
ref|XP_004172067.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    124   3e-29   
ref|WP_041710546.1|  magnesium chelatase                                125   5e-29   
gb|ABM71530.1|  Protoporphyrin IX Magnesium chelatase, ChlD subunit     125   5e-29   
ref|WP_038024611.1|  magnesium chelatase                                124   1e-28   
gb|EAU72630.1|  Protoporphyrin IX Magnesium chelatase subunit ChlD      124   1e-28   
ref|WP_035832672.1|  magnesium chelatase                                123   2e-28   
ref|WP_010312198.1|  magnesium-chelatase subunit ChlD                   123   2e-28   
ref|WP_009788319.1|  magnesium-chelatase subunit ChlD                   123   2e-28   
ref|WP_036920198.1|  magnesium chelatase                                122   3e-28   
ref|WP_026032414.1|  magnesium chelatase                                122   4e-28   
ref|WP_019478148.1|  magnesium-chelatase subunit ChlD                   122   6e-28   
emb|CBI17197.3|  unnamed protein product                                120   9e-28   
ref|YP_007516996.1|  chlorophyll biosynthesis                           118   9e-28   
ref|WP_026380042.1|  magnesium chelatase                                117   2e-27   
ref|WP_004031442.1|  magnesium chelatase                                117   2e-27   
sp|Q9ZGE6.1|BCHD_HELMO  RecName: Full=Magnesium-chelatase 67 kDa ...    120   2e-27   
ref|WP_006173019.1|  magnesium-chelatase subunit ChlD                   120   3e-27   
ref|WP_031447814.1|  magnesium chelatase                                117   4e-27   
ref|WP_011618897.1|  magnesium chelatase                                116   5e-27   
ref|WP_012282387.1|  magnesium-chelatase subunit                        119   6e-27   
ref|WP_006042395.1|  magnesium-chelatase subunit ChlD                   119   6e-27   
ref|WP_019719321.1|  hypothetical protein                               114   9e-27   
ref|WP_025958767.1|  hypothetical protein                               113   1e-26   
ref|WP_011933501.1|  magnesium chelatase                                115   1e-26   
ref|WP_036920303.1|  magnesium chelatase                                115   1e-26   
ref|XP_005537136.1|  magnesium chelatase subunits I and D               118   1e-26   
ref|WP_036912582.1|  MULTISPECIES: magnesium chelatase                  115   1e-26   
gb|KGK98215.1|  magnesium chelatase                                     115   1e-26   
ref|WP_011825553.1|  magnesium chelatase                                115   1e-26   
ref|WP_006852251.1|  magnesium chelatase                                115   1e-26   
ref|WP_013503679.1|  magnesium chelatase                                115   2e-26   
emb|CDI27958.1|  magnesium-chelatase subunit chlI                       115   2e-26   
ref|WP_011499489.1|  magnesium chelatase                                114   2e-26   
ref|WP_022723303.1|  magnesium chelatase                                114   2e-26   
ref|XP_006573815.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    117   2e-26   
ref|NP_050837.1|  Mg-protoporyphyrin IX chelatase                       115   2e-26   
ref|YP_007317165.1|  Mg-protoporyphyrin IX chelatase                    114   2e-26   
ref|WP_004078651.1|  magnesium chelatase                                117   2e-26   
ref|YP_008965634.1|  magnesium chelatase subunit I                      114   2e-26   
ref|WP_024978863.1|  magnesium chelatase                                117   3e-26   
ref|WP_011471717.1|  magnesium chelatase                                114   3e-26   
ref|WP_025933088.1|  magnesium chelatase                                117   3e-26   
gb|KFK28521.1|  magnesium-chelatase subunit chli                        114   3e-26   
ref|XP_008806573.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    116   3e-26   
ref|WP_025929738.1|  hypothetical protein                               114   4e-26   
ref|WP_028827698.1|  magnesium chelatase                                114   4e-26   
gb|AFR24772.1|  Mg-protoporyphyrin IX chelatase                         114   4e-26   
gb|AEQ94253.1|  chlorophyll biosynthesis                                114   4e-26   
ref|WP_036896834.1|  magnesium chelatase                                114   4e-26   
ref|WP_025971722.1|  magnesium chelatase                                117   4e-26   
gb|AEW12943.2|  chlorophyll biosynthesis                                114   4e-26   
ref|WP_025937366.1|  magnesium chelatase                                117   4e-26   
ref|WP_006529681.1|  magnesium chelatase ATPase subunit I               114   4e-26   
ref|WP_009556093.1|  protoporphyrin IX magnesium-chelatase              114   5e-26   
ref|WP_015179225.1|  protoporphyrin IX magnesium-chelatase              114   5e-26   
ref|WP_011130507.1|  magnesium chelatase                                114   5e-26   
ref|WP_022853379.1|  magnesium chelatase                                113   5e-26   
ref|WP_025927317.1|  magnesium chelatase                                114   5e-26   
ref|WP_011127583.1|  magnesium chelatase                                114   5e-26   
ref|WP_025929152.1|  magnesium chelatase                                116   6e-26   
ref|WP_026299682.1|  magnesium chelatase                                113   6e-26   
gb|AIS32646.1|  cobaltochelatase subunit                                113   6e-26   
ref|WP_011504156.1|  magnesium chelatase                                113   6e-26   
ref|WP_028951552.1|  magnesium chelatase                                113   6e-26   
gb|AEW13007.1|  chlorophyll biosynthesis                                113   6e-26   
ref|WP_027843787.1|  magnesium chelatase                                113   7e-26   
ref|WP_006853735.1|  magnesium-chelatase subunit ChlD                   116   7e-26   
ref|WP_015141479.1|  magnesium chelatase ATPase subunit I               113   7e-26   
ref|YP_063709.1|  Mg-protoporyphyrin IX chelatase                       113   7e-26   
ref|WP_006632953.1|  magnesium chelatase                                113   8e-26   
ref|WP_025274460.1|  hypothetical protein                               115   8e-26   
ref|WP_025920589.1|  magnesium chelatase                                115   8e-26   
ref|YP_009057493.1|  magnesium chelatase subunit of protochloroph...    113   8e-26   
gb|AIQ94356.1|  Protoporphyrin IX Mg-chelatase subunit D                115   9e-26   
ref|WP_007098271.1|  magnesium chelatase                                113   9e-26   
ref|WP_042849785.1|  magnesium chelatase                                115   9e-26   
ref|WP_007100258.1|  magnesium chelatase                                113   9e-26   
ref|WP_036902617.1|  magnesium chelatase                                113   1e-25   
ref|WP_011862328.1|  magnesium-chelatase subunit ChlD                   115   1e-25   
emb|CCA87793.1|  putative magnesium chelatase subunit                   115   1e-25   
ref|WP_015142889.1|  magnesium chelatase ATPase subunit I               112   1e-25   
ref|WP_043736429.1|  magnesium chelatase                                115   1e-25   
ref|WP_006041775.1|  magnesium chelatase                                112   1e-25   
ref|XP_006398276.1|  hypothetical protein EUTSA_v10000878mg             113   1e-25   
ref|YP_002049144.1|  Magnesium chelatase ATPase subunit D               115   1e-25   
ref|WP_014631165.1|  putative magnesium chelatase subunit               115   1e-25   
emb|CAK27124.1|  Protoporphyrin IX Mg-chelatase subunit ChlD            115   1e-25   
ref|XP_011086016.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    113   1e-25   
ref|WP_011745462.1|  magnesium chelatase                                113   1e-25   
ref|WP_028854194.1|  magnesium chelatase                                115   1e-25   
ref|WP_032515663.1|  magnesium chelatase                                115   1e-25   
ref|WP_020830270.1|  ChlI component of cobalt chelatase involved ...    115   1e-25   
gb|ABB49351.1|  protoporphyrin IX magnesium-chelatase                   115   1e-25   
ref|WP_021155656.1|  chelatase protein                                  115   1e-25   
ref|WP_036924228.1|  magnesium chelatase                                115   1e-25   
ref|WP_028861570.1|  magnesium chelatase                                115   1e-25   
ref|WP_011003923.1|  magnesium chelatase                                115   1e-25   
ref|WP_025939889.1|  magnesium chelatase                                115   1e-25   
ref|YP_006234199.1|  Mg-protoporyphyrin IX chelatase                    112   1e-25   
gb|ABM69599.1|  Protoporphyrin IX Magnesium chelatase, ChlD subunit     115   1e-25   
ref|NP_848952.1|  Mg-protoporyphyrin IX chelatase                       112   1e-25   
ref|WP_025979552.1|  magnesium chelatase                                115   1e-25   
ref|WP_010303690.1|  magnesium chelatase                                112   2e-25   
ref|WP_041484507.1|  magnesium chelatase                                115   2e-25   
gb|KJB90229.1|  magnesium chelatase                                     112   2e-25   
ref|WP_025906191.1|  MULTISPECIES: magnesium chelatase                  115   2e-25   
ref|YP_636458.1|  Mg-protoporyphyrin IX chelatase                       112   2e-25   
ref|YP_009032717.1|  chlorophyll biosynthesis (chloroplast)             112   2e-25   
ref|YP_003002236.1|  magnesium chelatase subunit                        112   2e-25   
ref|WP_012593827.1|  MULTISPECIES: magnesium chelatase                  112   2e-25   
ref|WP_025972851.1|  magnesium chelatase                                115   2e-25   
ref|WP_025922876.1|  magnesium chelatase                                115   2e-25   
ref|WP_027279517.1|  magnesium chelatase                                112   2e-25   
ref|WP_025940129.1|  magnesium chelatase                                115   2e-25   
ref|WP_043771106.1|  magnesium chelatase                                112   2e-25   
ref|WP_025953404.1|  magnesium chelatase                                115   2e-25   
ref|WP_042709728.1|  magnesium chelatase                                115   2e-25   
ref|WP_025941290.1|  magnesium chelatase                                115   2e-25   
ref|WP_025974440.1|  magnesium chelatase                                114   2e-25   
ref|YP_009019716.1|  magnesium chelatase subunit                        112   2e-25   
ref|XP_010686345.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    112   2e-25   
ref|WP_025900308.1|  magnesium chelatase                                115   2e-25   
gb|AIT94137.1|  magnesium chelatase subunit of protochlorophyllid...    112   2e-25   
ref|WP_025880354.1|  magnesium chelatase                                115   2e-25   
ref|XP_010686344.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    112   2e-25   
ref|WP_025963528.1|  magnesium chelatase                                115   2e-25   
ref|WP_025980208.1|  magnesium chelatase                                115   2e-25   
ref|WP_025951811.1|  magnesium chelatase                                115   2e-25   
ref|WP_025957102.1|  MULTISPECIES: magnesium chelatase                  115   2e-25   
ref|YP_009106670.1|  magnesium chelatase subunit of protochloroph...    112   2e-25   
ref|WP_025958244.1|  magnesium chelatase                                114   2e-25   
ref|WP_025927960.1|  magnesium chelatase                                114   2e-25   
ref|WP_039727652.1|  MULTISPECIES: magnesium chelatase                  114   2e-25   
ref|YP_002601047.1|  magnesium chelatase subunit of protochloroph...    112   2e-25   
ref|WP_025970600.1|  magnesium chelatase                                114   2e-25   
ref|WP_025940420.1|  magnesium chelatase                                114   2e-25   
ref|WP_025890400.1|  MULTISPECIES: magnesium chelatase                  114   2e-25   
ref|WP_011157067.1|  magnesium chelatase                                112   2e-25   
ref|WP_011662744.1|  magnesium chelatase                                112   2e-25   
ref|WP_025959645.1|  magnesium chelatase                                114   2e-25   
ref|YP_009057860.1|  magnesium chelatase subunit of protochloroph...    112   2e-25   
ref|WP_010994329.1|  magnesium chelatase                                112   2e-25   
ref|WP_015187653.1|  magnesium chelatase ATPase subunit I               112   3e-25   
gb|ACQ90752.1|  magnesium chelatase subunit of protochlorophyllid...    111   3e-25   
ref|WP_011318336.1|  magnesium chelatase                                112   3e-25   
ref|NP_041888.1|  Mg-protoporyphyrin IX chelatase                       111   3e-25   
gb|EEE39311.1|  magnesium chelatase ATPase subunit D                    114   3e-25   
ref|YP_009057794.1|  magnesium chelatase subunit of protochloroph...    111   3e-25   
ref|WP_025922150.1|  magnesium chelatase                                114   3e-25   
ref|WP_033829909.1|  magnesium chelatase                                114   3e-25   
ref|WP_025893972.1|  MULTISPECIES: magnesium chelatase                  114   3e-25   
ref|WP_008512188.1|  Mg-chelatase subunit ChlI                          111   3e-25   
ref|WP_013209583.1|  magnesium chelatase                                114   3e-25   
ref|WP_035832887.1|  magnesium chelatase                                111   3e-25   
ref|WP_025975271.1|  magnesium chelatase                                114   3e-25   
gb|ABD00082.1|  magnesium chelatase, ATPase subunit I                   111   3e-25   
ref|WP_032524043.1|  magnesium chelatase                                114   3e-25   
ref|WP_012195688.1|  magnesium chelatase                                111   3e-25   
ref|WP_041438434.1|  magnesium chelatase                                111   3e-25   
ref|WP_015192452.1|  magnesium chelatase ATPase subunit I               111   4e-25   
gb|KDP21059.1|  hypothetical protein JCGZ_21530                         112   4e-25   
gb|AFC40062.1|  g-protoporyphyrin IX chelatase                          111   4e-25   
ref|WP_011125298.1|  MULTISPECIES: magnesium chelatase                  111   4e-25   
ref|WP_007353825.1|  MULTISPECIES: magnesium chelatase                  111   4e-25   
ref|WP_024544789.1|  magnesium chelatase                                111   4e-25   
gb|KGF94491.1|  Protoporphyrin IX Mg-chelatase subunit D                114   5e-25   
ref|WP_011294787.1|  magnesium chelatase                                110   5e-25   
emb|CEA12387.1|  Magnesium-chelatase subunit ChlI homolog               110   5e-25   
ref|WP_015222566.1|  protoporphyrin IX magnesium-chelatase              110   5e-25   
ref|WP_043844102.1|  magnesium chelatase                                110   5e-25   
ref|WP_030007326.1|  magnesium chelatase                                110   5e-25   
ref|WP_012007087.1|  magnesium-chelatase subunit ChlD                   113   6e-25   
ref|WP_032522801.1|  magnesium chelatase                                113   6e-25   
gb|KJB69599.1|  hypothetical protein B456_011G032900                    111   6e-25   
ref|XP_006283787.1|  hypothetical protein CARUB_v10004877mg             111   6e-25   
ref|WP_038653588.1|  magnesium chelatase                                110   6e-25   
ref|WP_042589241.1|  magnesium chelatase                                110   6e-25   
dbj|BAJ84973.1|  predicted protein                                      111   6e-25   
ref|WP_044276472.1|  magnesium chelatase                                110   6e-25   
gb|AIY30226.1|  photochlorophyllide reductase subunit I                 110   6e-25   
ref|WP_011618229.1|  magnesium-chelatase subunit ChlD                   113   6e-25   
sp|Q94FT3.1|CHLI_CHLRE  RecName: Full=Magnesium-chelatase subunit...    111   6e-25   
ref|YP_009105570.1|  magnesium chelatase subunit of protochloroph...    110   6e-25   
ref|WP_036906635.1|  magnesium chelatase                                110   6e-25   
ref|XP_001691232.1|  magnesium chelatase subunit I                      110   6e-25   
gb|KJB68386.1|  hypothetical protein B456_010G242400                    111   7e-25   
ref|XP_002947010.1|  hypothetical protein VOLCADRAFT_79418              110   7e-25   



>ref|XP_008449685.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Cucumis 
melo]
Length=748

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 169/205 (82%), Gaps = 13/205 (6%)
 Frame = +1

Query  76   SSTLPANPSHTAPFSTTLRFKFllptlstpslRPSGRRPH---RLRFRINASANGSVVAA  246
            S+++P   S   PFS   RF+     L   S  P   +PH   R+R  I AS+NG+V AA
Sbjct  9    STSIPHLRSSLLPFS---RFR----PLLIFSSPPFSSKPHLSRRIRHCIRASSNGAVAAA  61

Query  247  PQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGL  426
             Q    +TT+YGRQYFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGTAKTVMARGL
Sbjct  62   DQ---PETTSYGRQYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMARGL  118

Query  427  HAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTED  606
            HAVLPPIE+V GSISNADP+CPEEWEDGLADRVEYDSAGNIKT+I+K+PF+QIPLGVTED
Sbjct  119  HAVLPPIEVVVGSISNADPSCPEEWEDGLADRVEYDSAGNIKTQIVKTPFIQIPLGVTED  178

Query  607  RLIGSVDVEESVKSGTTVFQPGLLA  681
            RLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  179  RLIGSVDVEESVKTGTTVFQPGLLA  203



>ref|XP_004140205.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Cucumis sativus]
Length=748

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 155/172 (90%), Gaps = 6/172 (3%)
 Frame = +1

Query  175  PSGRRPH---RLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            P   +PH   R+R  I AS+NG+V AA Q    +TT+YGRQYFPLAAVVGQDAIKTALLL
Sbjct  35   PFSPKPHLSRRIRHCIRASSNGAVAAADQ---PETTSYGRQYFPLAAVVGQDAIKTALLL  91

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GAIDR IGGIAISGKRGTAKTVMARGLHAVLPPIE+V GSISNADP+CPEEWEDGLADRV
Sbjct  92   GAIDREIGGIAISGKRGTAKTVMARGLHAVLPPIEVVVGSISNADPSCPEEWEDGLADRV  151

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EYDSAGNIKT+I+K+PF+QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  152  EYDSAGNIKTQIVKTPFIQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  203



>gb|KGN48112.1| hypothetical protein Csa_6G434320 [Cucumis sativus]
Length=1091

 Score =   287 bits (734),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 155/172 (90%), Gaps = 6/172 (3%)
 Frame = +1

Query  175  PSGRRPH---RLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            P   +PH   R+R  I AS+NG+V AA Q    +TT+YGRQYFPLAAVVGQDAIKTALLL
Sbjct  35   PFSPKPHLSRRIRHCIRASSNGAVAAADQ---PETTSYGRQYFPLAAVVGQDAIKTALLL  91

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GAIDR IGGIAISGKRGTAKTVMARGLHAVLPPIE+V GSISNADP+CPEEWEDGLADRV
Sbjct  92   GAIDREIGGIAISGKRGTAKTVMARGLHAVLPPIEVVVGSISNADPSCPEEWEDGLADRV  151

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EYDSAGNIKT+I+K+PF+QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  152  EYDSAGNIKTQIVKTPFIQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  203



>gb|AJB84628.1| magnesium-chelatase subunit D [Camellia sinensis]
Length=758

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 5/169 (3%)
 Frame = +1

Query  184  RRPHRLRFRINA---SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAI  354
            R P+RLR R  A   S+NG+V  AP K   +TT+YGRQYFPLAAVVGQDAIKTALLLGAI
Sbjct  48   RLPNRLRVRATATLESSNGAVAVAPNKD--ETTSYGRQYFPLAAVVGQDAIKTALLLGAI  105

Query  355  DRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD  534
            DR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+N DP CPEEWEDGLA++VEYD
Sbjct  106  DREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSIANVDPACPEEWEDGLANKVEYD  165

Query  535  SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
             AGN+KT I++SPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  166  PAGNVKTMIVRSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  214



>gb|KCW51128.1| hypothetical protein EUGRSUZ_J00729 [Eucalyptus grandis]
Length=614

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+AA   P AD+++YGRQYFPLAAVVGQDAIKT+LLLGAIDR IGGIA+ GKRGT
Sbjct  66   SGNGAVLAAADGPEADSSSYGRQYFPLAAVVGQDAIKTSLLLGAIDREIGGIAVCGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARGLHA+LPPIE+V GSI+NADP+CPEEWED L+DR EYDSAGN++T+IIKSPFV
Sbjct  126  AKTIMARGLHAILPPIEVVVGSIANADPSCPEEWEDELSDRAEYDSAGNMRTKIIKSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  219



>ref|XP_004236627.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Solanum 
lycopersicum]
Length=766

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 150/173 (87%), Gaps = 7/173 (4%)
 Frame = +1

Query  184  RRPHRLRFRINASA-----NGSVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIKTALL  342
            R+  + RF INA+A     NG+VVA  ++P       ++GRQYFPLAAVVGQDAIKTALL
Sbjct  43   RKRLKFRFSINATATIDSPNGAVVAEAEEPEKKPQNNSFGRQYFPLAAVVGQDAIKTALL  102

Query  343  LGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADR  522
            LGAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP C EEWEDGLADR
Sbjct  103  LGAIDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSMANADPNCSEEWEDGLADR  162

Query  523  VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            VEYDS GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  163  VEYDSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  215



>ref|XP_010031752.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X3 [Eucalyptus grandis]
Length=613

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+AA   P AD+++YGRQYFPLAAVVGQDAIKT+LLLGAIDR IGGIA+ GKRGT
Sbjct  66   SGNGAVLAAADGPEADSSSYGRQYFPLAAVVGQDAIKTSLLLGAIDREIGGIAVCGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARGLHA+LPPIE+V GSI+NADP+CPEEWED L+DR EYDSAGN++T+IIKSPFV
Sbjct  126  AKTIMARGLHAILPPIEVVVGSIANADPSCPEEWEDELSDRAEYDSAGNMRTKIIKSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  219



>ref|XP_010031751.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=649

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+AA   P AD+++YGRQYFPLAAVVGQDAIKT+LLLGAIDR IGGIA+ GKRGT
Sbjct  66   SGNGAVLAAADGPEADSSSYGRQYFPLAAVVGQDAIKTSLLLGAIDREIGGIAVCGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARGLHA+LPPIE+V GSI+NADP+CPEEWED L+DR EYDSAGN++T+IIKSPFV
Sbjct  126  AKTIMARGLHAILPPIEVVVGSIANADPSCPEEWEDELSDRAEYDSAGNMRTKIIKSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  219



>ref|XP_010246236.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=754

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 3/152 (2%)
 Frame = +1

Query  226  NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAK  405
            NG+VVA P+KP  D T+YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGTAK
Sbjct  62   NGAVVA-PKKP--DGTSYGRRYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAK  118

Query  406  TVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQI  585
            TVMARGLHA+LPPIE+V GSISNADP CPEEWEDGL+DRVEYD+AGN+KT+I++SPFVQI
Sbjct  119  TVMARGLHAILPPIEVVVGSISNADPACPEEWEDGLSDRVEYDAAGNVKTQIVRSPFVQI  178

Query  586  PLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            PLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  179  PLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  210



>ref|XP_006350212.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Solanum tuberosum]
Length=765

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 149/173 (86%), Gaps = 7/173 (4%)
 Frame = +1

Query  184  RRPHRLRFRINASA-----NGSVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIKTALL  342
            R+  + RF INA+A     NG+VVA  ++P       ++GRQYFPLAAVVGQDAIKTALL
Sbjct  43   RKRLKFRFSINATATIDSPNGAVVAEAEEPEKKPQNNSFGRQYFPLAAVVGQDAIKTALL  102

Query  343  LGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADR  522
            LGAIDR IGGIAI GKRGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWE GLADR
Sbjct  103  LGAIDREIGGIAICGKRGTAKTVMARGLHAILPPIEVVVGSMANADPNCPEEWEGGLADR  162

Query  523  VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            VEYDS GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  163  VEYDSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  215



>ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48937.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative 
[Ricinus communis]
Length=760

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 145/154 (94%), Gaps = 2/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+VV+  Q P  D+++YGRQYFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct  68   STNGAVVSPSQNP--DSSSYGRQYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPI++V GSI+NADP+CPEEWEDGLA+RVEYDS GNIKTE+++SPFV
Sbjct  126  AKTVMARGLHAILPPIDVVVGSIANADPSCPEEWEDGLAERVEYDSDGNIKTEVVRSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  219



>gb|KCW51126.1| hypothetical protein EUGRSUZ_J00729 [Eucalyptus grandis]
 gb|KCW51127.1| hypothetical protein EUGRSUZ_J00729 [Eucalyptus grandis]
Length=671

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+AA   P AD+++YGRQYFPLAAVVGQDAIKT+LLLGAIDR IGGIA+ GKRGT
Sbjct  66   SGNGAVLAAADGPEADSSSYGRQYFPLAAVVGQDAIKTSLLLGAIDREIGGIAVCGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARGLHA+LPPIE+V GSI+NADP+CPEEWED L+DR EYDSAGN++T+IIKSPFV
Sbjct  126  AKTIMARGLHAILPPIEVVVGSIANADPSCPEEWEDELSDRAEYDSAGNMRTKIIKSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  219



>gb|EPS59030.1| hypothetical protein M569_15780, partial [Genlisea aurea]
Length=288

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +1

Query  220  SANGSVVA-APQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRG  396
            SANGS    A +  +A +  YGRQYFPLAAVVGQDAIKTALLLGA+DR IGGIAISG+RG
Sbjct  18   SANGSAAGVATEDESASSNQYGRQYFPLAAVVGQDAIKTALLLGAVDREIGGIAISGRRG  77

Query  397  TAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPF  576
            TAKTVMARGLHA+LPPIE+V GSI+NADP CPEEWEDGL+D + YDSAGN+KT I++SPF
Sbjct  78   TAKTVMARGLHAILPPIEVVAGSIANADPLCPEEWEDGLSDALHYDSAGNVKTRIVRSPF  137

Query  577  VQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            VQIPLGVTEDRL+GSV+VEESVKSGTTVFQPGLLA
Sbjct  138  VQIPLGVTEDRLLGSVNVEESVKSGTTVFQPGLLA  172



>ref|XP_010031750.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW51125.1| hypothetical protein EUGRSUZ_J00729 [Eucalyptus grandis]
Length=763

 Score =   271 bits (693),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+AA   P AD+++YGRQYFPLAAVVGQDAIKT+LLLGAIDR IGGIA+ GKRGT
Sbjct  66   SGNGAVLAAADGPEADSSSYGRQYFPLAAVVGQDAIKTSLLLGAIDREIGGIAVCGKRGT  125

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARGLHA+LPPIE+V GSI+NADP+CPEEWED L+DR EYDSAGN++T+IIKSPFV
Sbjct  126  AKTIMARGLHAILPPIEVVVGSIANADPSCPEEWEDELSDRAEYDSAGNMRTKIIKSPFV  185

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  186  QIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  219



>ref|XP_009802534.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Nicotiana 
sylvestris]
Length=758

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 146/172 (85%), Gaps = 7/172 (4%)
 Frame = +1

Query  187  RPHRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            RP RL+FR+  SA       NG+V     +   +  ++GRQYFPLAAV+GQDAIKTALLL
Sbjct  38   RPKRLKFRLRISATATIDSPNGAVAVVEPEKQPEKISFGRQYFPLAAVIGQDAIKTALLL  97

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP CP+EWEDGLADR 
Sbjct  98   GAIDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSMANADPNCPDEWEDGLADRA  157

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EY S GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  158  EYGSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  209



>ref|XP_011080379.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Sesamum 
indicum]
Length=757

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 7/167 (4%)
 Frame = +1

Query  202  RFRINASA-----NGSVVAAPQKP--AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDR  360
            R R+ A+A     NGSV  AP+K   +A  + YGRQ+FPLAAVVGQDAIKTALLLGA+DR
Sbjct  49   RLRVEATAILDSRNGSVGVAPEKEDESAPASPYGRQFFPLAAVVGQDAIKTALLLGAVDR  108

Query  361  NIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSA  540
             IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWEDGL+++VEYDSA
Sbjct  109  EIGGIAISGKRGTAKTVMARGLHAILPPIEVVDGSVANADPACPEEWEDGLSNKVEYDSA  168

Query  541  GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            GNIKT+I++SPFVQIPLGVTEDRL+GSVDVEESVKSGTTVFQPGLLA
Sbjct  169  GNIKTQIVRSPFVQIPLGVTEDRLVGSVDVEESVKSGTTVFQPGLLA  215



>ref|XP_008806572.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=753

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 151/185 (82%), Gaps = 17/185 (9%)
 Frame = +1

Query  175  PSGRRPHRLRFR----------INASA------NGSVVAAPQKPAADTTAYGRQYFPLAA  306
            PS ++P R R R          I ASA      NG+V A   KP+ + T YGRQYFPLAA
Sbjct  25   PSSKKPSRPRVRAARQPLFSRPILASAATIQSTNGAVSAPVGKPS-EATPYGRQYFPLAA  83

Query  307  VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPT  486
            VVGQDAIKTALLLGAID  IGGIAISGKRGTAKTVMARGLHA+LPPIE V GSI+NADP 
Sbjct  84   VVGQDAIKTALLLGAIDCKIGGIAISGKRGTAKTVMARGLHAMLPPIEAVAGSIANADPN  143

Query  487  CPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ  666
            CPEEWEDGLADRVEYD+AGN+K EI+K+PFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ
Sbjct  144  CPEEWEDGLADRVEYDAAGNVKIEIVKTPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ  203

Query  667  PGLLA  681
            PGLLA
Sbjct  204  PGLLA  208



>ref|XP_009629316.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Nicotiana 
tomentosiformis]
Length=759

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 147/172 (85%), Gaps = 7/172 (4%)
 Frame = +1

Query  187  RPHRLRFR--INASA-----NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            RP RL+FR  INA+A     NG+V     +   +  ++GRQYFPLAAV+GQDAIKTALLL
Sbjct  38   RPKRLKFRLRINATATIDSPNGAVAVVEPEKQPEKISFGRQYFPLAAVIGQDAIKTALLL  97

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP CP+EWEDGLADR 
Sbjct  98   GAIDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSMANADPNCPDEWEDGLADRA  157

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EY S GNI T+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  158  EYGSDGNINTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  209



>ref|XP_010651832.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Vitis 
vinifera]
Length=747

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 173/211 (82%), Gaps = 14/211 (7%)
 Frame = +1

Query  67   MVLSSTLPANPSHT-APFSTTLRFKFllptlstpslRPSGRRPHRLRFRINASA-----N  228
            M +SST P  P ++ +   ++L   F   +L + S +P  +R  R RF + ASA     N
Sbjct  1    MAVSSTAP--PCYSLSTLHSSLFPSFKSRSLLSFSSKP--KRAQR-RFVVQASATLESSN  55

Query  229  GSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKT  408
            G++VA   + + ++T+YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGTAKT
Sbjct  56   GAIVA---EESDNSTSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKT  112

Query  409  VMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIP  588
            VMARGLHA+LPPI++V GSI+NADPT PEEWEDGLA++VEYDSAGNIKT+I++SPFVQIP
Sbjct  113  VMARGLHAILPPIDVVVGSIANADPTRPEEWEDGLAEQVEYDSAGNIKTQIVRSPFVQIP  172

Query  589  LGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            LGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  173  LGVTEDRLVGSVDVEESVKTGTTVFQPGLLA  203



>ref|XP_010922222.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Elaeis 
guineensis]
Length=753

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 149/185 (81%), Gaps = 17/185 (9%)
 Frame = +1

Query  175  PSGRRPHRLRFRINA----------------SANGSVVAAPQKPAADTTAYGRQYFPLAA  306
            PS ++P R R R                   S NG+V A   KP  + T YGRQYFPLAA
Sbjct  25   PSSKKPSRPRNRAAGRPLFSRPILALAATIESTNGAVSAPVGKPL-EPTPYGRQYFPLAA  83

Query  307  VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPT  486
            VVGQDAIKTALLLGAID  IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADP 
Sbjct  84   VVGQDAIKTALLLGAIDCKIGGIAISGKRGTAKTVMARGLHAMLPPIEVVDGSIANADPN  143

Query  487  CPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ  666
            CPEEWEDGLADRVEYD+AGN+KTEI+K+PFVQ+PLGVTEDRLIGSVD+EESVKSGTTVFQ
Sbjct  144  CPEEWEDGLADRVEYDAAGNVKTEIVKTPFVQVPLGVTEDRLIGSVDIEESVKSGTTVFQ  203

Query  667  PGLLA  681
            PGLLA
Sbjct  204  PGLLA  208



>ref|XP_009413527.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=756

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 7/171 (4%)
 Frame = +1

Query  187  RPHRLRFRINA------SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
            RP   RF + +      S+NG+V A  QKP  D+  YGRQ+FPLAAVVGQDAIKTALLLG
Sbjct  43   RPSPRRFIVASAAATIDSSNGAVSATEQKPI-DSAEYGRQFFPLAAVVGQDAIKTALLLG  101

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSISNADP  PEEWEDGLA+RVE
Sbjct  102  AIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVAGSISNADPNRPEEWEDGLAERVE  161

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            YDSAGNIKT+I+++PF+QIPLGVTEDRLIGSVDVEES+KSGTT FQPGLLA
Sbjct  162  YDSAGNIKTQIVRTPFLQIPLGVTEDRLIGSVDVEESIKSGTTAFQPGLLA  212



>ref|XP_006573816.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X3 [Glycine max]
Length=610

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +1

Query  187  RPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAID  357
            RP R+R R   + A +    +   +KP    T YGRQYFPLAAVVGQDAIKTALLLGAID
Sbjct  42   RPKRIRKRSPIVGAQSENGALVTSEKPG---TNYGRQYFPLAAVVGQDAIKTALLLGAID  98

Query  358  RNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDS  537
              IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADPTCPEEWEDGL + +EYDS
Sbjct  99   PGIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPEEWEDGLTECLEYDS  158

Query  538  AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            AGNIKT IIKSPFVQIPLG+TEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  159  AGNIKTRIIKSPFVQIPLGITEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>ref|XP_009413526.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=759

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 7/171 (4%)
 Frame = +1

Query  187  RPHRLRFRINA------SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
            RP   RF + +      S+NG+V A  QKP  D+  YGRQ+FPLAAVVGQDAIKTALLLG
Sbjct  43   RPSPRRFIVASAAATIDSSNGAVSATEQKPI-DSAEYGRQFFPLAAVVGQDAIKTALLLG  101

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSISNADP  PEEWEDGLA+RVE
Sbjct  102  AIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVAGSISNADPNRPEEWEDGLAERVE  161

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            YDSAGNIKT+I+++PF+QIPLGVTEDRLIGSVDVEES+KSGTT FQPGLLA
Sbjct  162  YDSAGNIKTQIVRTPFLQIPLGVTEDRLIGSVDVEESIKSGTTAFQPGLLA  212



>sp|O24133.1|CHLD_TOBAC RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; Flags: Precursor [Nicotiana tabacum]
 emb|CAA71128.1| CHLD magnesium chelatase subunit [Nicotiana tabacum]
Length=758

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 145/172 (84%), Gaps = 7/172 (4%)
 Frame = +1

Query  187  RPHRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            RP RL+FR+  SA       NG+V     +   +  ++GRQYFPLAAV+GQDAIKTALLL
Sbjct  38   RPKRLKFRLRISATATIDSPNGAVAVVEPEKQPEKISFGRQYFPLAAVIGQDAIKTALLL  97

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GAIDR IGGIAI GKRGTAKT+MARGLHA+LPPIE+V GS++NADP CP+EWEDGLADR 
Sbjct  98   GAIDREIGGIAICGKRGTAKTLMARGLHAILPPIEVVVGSMANADPNCPDEWEDGLADRA  157

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EY S GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  158  EYGSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  209



>ref|XP_010105401.1| Magnesium-chelatase subunit chlD [Morus notabilis]
 gb|EXC04601.1| Magnesium-chelatase subunit chlD [Morus notabilis]
Length=760

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = +1

Query  172  RPSGRRPHRLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGA  351
            R  G R H     I  S NG+V+A P+K   D T YGRQ+FPLAAVVGQDAIKTALLLGA
Sbjct  48   RSHGVRVHASANAIADSGNGAVLA-PEKNL-DVTPYGRQFFPLAAVVGQDAIKTALLLGA  105

Query  352  IDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY  531
            IDR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GS+SNADP CPEEWEDGLA+R+EY
Sbjct  106  IDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSMSNADPACPEEWEDGLAERLEY  165

Query  532  DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            DS GNIKT+I++SPFVQIPLGVTEDRL+GSVDVEESVK+GTTVFQPGLLA
Sbjct  166  DSDGNIKTQIVRSPFVQIPLGVTEDRLLGSVDVEESVKTGTTVFQPGLLA  215



>ref|XP_006379057.1| hypothetical protein POPTR_0009s05400g [Populus trichocarpa]
 gb|ERP56854.1| hypothetical protein POPTR_0009s05400g [Populus trichocarpa]
Length=763

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 148/177 (84%), Gaps = 9/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINA------SANGSVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIK  330
            P  R  H  RFR+ A      S NG+V A P       D++ YGRQYFPLAAVVGQDAIK
Sbjct  46   PKKRLSHTRRFRVVAANVTLQSGNGAV-ATPNTATEKLDSSYYGRQYFPLAAVVGQDAIK  104

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGAIDR IGGIAISGKRGTAKTVMARGLH VLPPI++V GSI+NADP CPEEWEDG
Sbjct  105  TALLLGAIDREIGGIAISGKRGTAKTVMARGLHEVLPPIDVVMGSIANADPVCPEEWEDG  164

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            LA++VEYDS GNIKT++++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  165  LAEQVEYDSDGNIKTQVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>ref|XP_002314091.2| Mg-chelatase subunit D family protein [Populus trichocarpa]
 gb|EEE88046.2| Mg-chelatase subunit D family protein [Populus trichocarpa]
Length=786

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 148/177 (84%), Gaps = 9/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINA------SANGSVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIK  330
            P  R  H  RFR+ A      S NG+V A P       D++ YGRQYFPLAAVVGQDAIK
Sbjct  46   PKKRLSHTRRFRVVAANVTLQSGNGAV-ATPNTATEKLDSSYYGRQYFPLAAVVGQDAIK  104

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGAIDR IGGIAISGKRGTAKTVMARGLH VLPPI++V GSI+NADP CPEEWEDG
Sbjct  105  TALLLGAIDREIGGIAISGKRGTAKTVMARGLHEVLPPIDVVMGSIANADPVCPEEWEDG  164

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            LA++VEYDS GNIKT++++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  165  LAEQVEYDSDGNIKTQVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>ref|XP_007214542.1| hypothetical protein PRUPE_ppa001804mg [Prunus persica]
 gb|EMJ15741.1| hypothetical protein PRUPE_ppa001804mg [Prunus persica]
Length=763

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 9/170 (5%)
 Frame = +1

Query  193  HRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGA  351
             R+R R+ ASA       NG++V   Q+   D+ +YGRQYFPLAAVVGQDAIKTALLLGA
Sbjct  48   RRIRIRVTASATATIESGNGALVT--QEKNLDSISYGRQYFPLAAVVGQDAIKTALLLGA  105

Query  352  IDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY  531
            IDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWED L D +EY
Sbjct  106  IDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSMANADPACPEEWEDVLPDCMEY  165

Query  532  DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            DSAGNIKT+I++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  166  DSAGNIKTQIVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  215



>ref|XP_011032080.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Populus 
euphratica]
Length=801

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 148/179 (83%), Gaps = 10/179 (6%)
 Frame = +1

Query  175  PSGRRPHRLRFRINA------SANG--SVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDA  324
            P  R  H  RFR+ A      S NG  SV AAP       D++ YGRQYFPLAAVVGQDA
Sbjct  81   PKKRLSHTRRFRVVAANVTLQSGNGAVSVDAAPNTSTEKLDSSYYGRQYFPLAAVVGQDA  140

Query  325  IKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWE  504
            IKTALLLGAIDR IGGIAISG+RGTAKTVMARGLH VLPPI++V GSI+NADP CPEEWE
Sbjct  141  IKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHEVLPPIDVVMGSIANADPACPEEWE  200

Query  505  DGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            DGLA+RVEYDS GNIKT++++SPFVQIPLGVTEDRLIGSVDVEESVK+GT VFQPGLLA
Sbjct  201  DGLAERVEYDSNGNIKTQVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTAVFQPGLLA  259



>ref|XP_008227213.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Prunus 
mume]
Length=763

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 9/170 (5%)
 Frame = +1

Query  193  HRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGA  351
             R+R R+ ASA       NG++V   Q+   D+ +YGRQYFPLAAVVGQDAIKTALLLGA
Sbjct  48   RRIRIRVTASATATIESGNGALVT--QEKNLDSISYGRQYFPLAAVVGQDAIKTALLLGA  105

Query  352  IDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY  531
            IDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWED L D +EY
Sbjct  106  IDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSMANADPACPEEWEDVLPDCMEY  165

Query  532  DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            DSAGNIKT+I++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  166  DSAGNIKTQIVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  215



>ref|XP_006470704.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Citrus sinensis]
Length=765

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 4/154 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            SANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  72   SANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  127

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADPTCP+EWEDGLA++VEYD+AGN+KT+I +SPFV
Sbjct  128  AKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLAEKVEYDTAGNLKTQIARSPFV  187

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  188  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>ref|XP_003517516.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X1 [Glycine max]
Length=750

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +1

Query  187  RPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAID  357
            RP R+R R   + A +    +   +KP    T YGRQYFPLAAVVGQDAIKTALLLGAID
Sbjct  42   RPKRIRKRSPIVGAQSENGALVTSEKPG---TNYGRQYFPLAAVVGQDAIKTALLLGAID  98

Query  358  RNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDS  537
              IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADPTCPEEWEDGL + +EYDS
Sbjct  99   PGIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPEEWEDGLTECLEYDS  158

Query  538  AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            AGNIKT IIKSPFVQIPLG+TEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  159  AGNIKTRIIKSPFVQIPLGITEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>gb|KHN25632.1| Magnesium-chelatase subunit chlD, chloroplastic [Glycine soja]
Length=750

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +1

Query  187  RPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAID  357
            RP R+R R   + A +    +   +KP    T YGRQYFPLAAVVGQDAIKTALLLGAID
Sbjct  42   RPKRIRKRSPIVGAQSENGALVTSEKP---DTNYGRQYFPLAAVVGQDAIKTALLLGAID  98

Query  358  RNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDS  537
              IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADPTCPEEWEDGL + +EYDS
Sbjct  99   PGIGGIAISGKRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPEEWEDGLTECLEYDS  158

Query  538  AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            AGNIKT IIKSPFVQIPLG+TEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  159  AGNIKTRIIKSPFVQIPLGITEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>ref|XP_010673713.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=757

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 13/200 (7%)
 Frame = +1

Query  91   ANPSHTAPFSTTLRFKFllptlstpslRPSGRRPHRLRFRINA---SANGSVVAAPQKPA  261
            +N S +  ++T   FKF   +      R   R P   + R  A   S NG+V++  +KP 
Sbjct  21   SNKSFSLSYTT---FKFSKLSS-----RNFRRSPPSFKIRAAATLNSDNGAVISDSEKP-  71

Query  262  ADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLP  441
             +   YGR++FPLAAVVGQDAIKTALLLGA+DR IGGI ISGKRGTAKT+MARGLHAVLP
Sbjct  72   -NEANYGRKFFPLAAVVGQDAIKTALLLGAVDREIGGIGISGKRGTAKTIMARGLHAVLP  130

Query  442  PIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGS  621
            PI++V GSI+NADP+CPEEWED LADR+EYDS+GNIKT+++KSPFVQIPLGVTEDRLIGS
Sbjct  131  PIDVVVGSIANADPSCPEEWEDELADRLEYDSSGNIKTKVVKSPFVQIPLGVTEDRLIGS  190

Query  622  VDVEESVKSGTTVFQPGLLA  681
            VDVEESVK+GTTVFQPGLLA
Sbjct  191  VDVEESVKTGTTVFQPGLLA  210



>gb|KDO50423.1| hypothetical protein CISIN_1g004256mg [Citrus sinensis]
Length=603

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 4/154 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            SANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  72   SANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  127

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADPTCP+EWEDGL ++ EYD+AGN+KT+I +SPFV
Sbjct  128  AKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFV  187

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  188  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>emb|CDP08502.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 150/177 (85%), Gaps = 12/177 (7%)
 Frame = +1

Query  187  RPHRLRF--RINASA-----NGSVVAAP-----QKPAADTTAYGRQYFPLAAVVGQDAIK  330
            RP R ++  +INA+A     NG+V  A      Q+ + D  +YGR+YFPLAAVVGQDAIK
Sbjct  44   RPSRRKYFLKINATATLDSGNGAVSVAKDAPEQQQSSTDEDSYGRRYFPLAAVVGQDAIK  103

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGAIDR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GSI+NADP C EEWEDG
Sbjct  104  TALLLGAIDRGIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPACLEEWEDG  163

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
             +D+VEYD AGNIKT+II+SPFVQIPLGVTEDRL+GSVDVEES+KSGTTVFQPGLLA
Sbjct  164  FSDKVEYDPAGNIKTQIIRSPFVQIPLGVTEDRLVGSVDVEESMKSGTTVFQPGLLA  220



>ref|XP_006590476.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X3 [Glycine max]
Length=610

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +1

Query  178  SGRRPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
            S  RP R+  R   + A +    +   +KP    T YGRQYFPLAAVVGQD+IKTALLLG
Sbjct  39   STYRPKRILQRSPIVGAQSENGALVTSEKP---DTNYGRQYFPLAAVVGQDSIKTALLLG  95

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AID  +GGIAISGKRGTAKTVMARGLHA+LPPIE+V+GSI+NADPTCPEEWEDGL + +E
Sbjct  96   AIDPGVGGIAISGKRGTAKTVMARGLHAILPPIEVVEGSIANADPTCPEEWEDGLTECLE  155

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            YDS GNIKT IIKSPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  156  YDSTGNIKTRIIKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>gb|KDO50421.1| hypothetical protein CISIN_1g004256mg [Citrus sinensis]
Length=653

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 4/154 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            SANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  72   SANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  127

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADPTCP+EWEDGL ++ EYD+AGN+KT+I +SPFV
Sbjct  128  AKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFV  187

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  188  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>ref|XP_006369577.1| hypothetical protein POPTR_0001s26140g [Populus trichocarpa]
 gb|ERP66146.1| hypothetical protein POPTR_0001s26140g [Populus trichocarpa]
Length=251

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+VVA P     ++++YGRQYFPLAAVVGQ+AIKTAL  GAIDR IGGIA+SG+RGT
Sbjct  58   SGNGAVVATPTTEKLESSSYGRQYFPLAAVVGQNAIKTALCFGAIDRGIGGIALSGRRGT  117

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            A  +MARGLHAVLPPI++V GSI+NADP  PEEWEDGLA++VEY+S GNIKT++++SPFV
Sbjct  118  ATPLMARGLHAVLPPIDVVAGSIANADPAFPEEWEDGLAEQVEYNSDGNIKTQVVRSPFV  177

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVT+DRLIGSVDVEES+K+GTTVFQPGLLA
Sbjct  178  QIPLGVTKDRLIGSVDVEESMKTGTTVFQPGLLA  211



>gb|EYU35928.1| hypothetical protein MIMGU_mgv1a001714mg [Erythranthe guttata]
Length=769

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 7/173 (4%)
 Frame = +1

Query  184  RRPHRLRFRINA---SANGSV-VAAPQKPAADTTA---YGRQYFPLAAVVGQDAIKTALL  342
            R+  RLR    A   S NG+V VAAP+    ++T+   YGRQ+FPLAA+VGQDAIKTALL
Sbjct  45   RKIRRLRVEATATLDSPNGAVGVAAPENKERESTSATPYGRQFFPLAAIVGQDAIKTALL  104

Query  343  LGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADR  522
            LGAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V  SISNADP  P+EWEDGLADR
Sbjct  105  LGAIDREIGGIAISGKRGTAKTVMARGLHAILPPIEVVPASISNADPANPDEWEDGLADR  164

Query  523  VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            VEYDS G++KT+II+SPFVQIPLGVTEDRLIGSVDVEES+KSGTTVFQPGLLA
Sbjct  165  VEYDSDGSVKTKIIRSPFVQIPLGVTEDRLIGSVDVEESIKSGTTVFQPGLLA  217



>ref|XP_010557506.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557507.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=753

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = +1

Query  187  RPHRLRFRINASANGSVV----AAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAI  354
            R    RFRI ASAN +V     A       ++T+YGRQ+FPLAAVVGQDAIKTALLLGA 
Sbjct  39   RGASFRFRIRASANAAVESPNGAVTATSGDESTSYGRQFFPLAAVVGQDAIKTALLLGAT  98

Query  355  DRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD  534
            DR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V  SI+NA+P CPEEWEDGLA+ VEYD
Sbjct  99   DREIGGIAISGRRGTAKTVMARGLHAILPPIEVVASSIANANPACPEEWEDGLAEGVEYD  158

Query  535  SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            + GN+KT+I+KSPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  159  ADGNVKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  207



>gb|KDO50422.1| hypothetical protein CISIN_1g004256mg [Citrus sinensis]
Length=692

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 4/154 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            SANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  72   SANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  127

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADPTCP+EWEDGL ++ EYD+AGN+KT+I +SPFV
Sbjct  128  AKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFV  187

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  188  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>gb|KDO50420.1| hypothetical protein CISIN_1g004256mg [Citrus sinensis]
Length=765

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 4/154 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            SANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  72   SANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  127

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADPTCP+EWEDGL ++ EYD+AGN+KT+I +SPFV
Sbjct  128  AKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFV  187

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  188  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  221



>ref|XP_006590475.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X2 [Glycine max]
Length=626

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +1

Query  178  SGRRPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
            S  RP R+  R   + A +    +   +KP    T YGRQYFPLAAVVGQD+IKTALLLG
Sbjct  39   STYRPKRILQRSPIVGAQSENGALVTSEKP---DTNYGRQYFPLAAVVGQDSIKTALLLG  95

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AID  +GGIAISGKRGTAKTVMARGLHA+LPPIE+V+GSI+NADPTCPEEWEDGL + +E
Sbjct  96   AIDPGVGGIAISGKRGTAKTVMARGLHAILPPIEVVEGSIANADPTCPEEWEDGLTECLE  155

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            YDS GNIKT IIKSPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  156  YDSTGNIKTRIIKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>gb|KJB21818.1| hypothetical protein B456_004G015600 [Gossypium raimondii]
Length=755

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+  A   +    +++YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  59   SNNGAAAAIGSESEDPSSSYGRRYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  118

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHAVLPPI++V GS++NADPTCPEEWEDGLA R EYDS GN+KT++++SPFV
Sbjct  119  AKTVMARGLHAVLPPIDVVVGSMANADPTCPEEWEDGLAQRAEYDSNGNVKTQVVRSPFV  178

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  179  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  212



>ref|XP_009337032.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009337033.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009337034.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X3 [Pyrus x bretschneideri]
Length=771

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 149/171 (87%), Gaps = 10/171 (6%)
 Frame = +1

Query  193  HRLRFRINASA--------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
             R R R+ ASA        NG+++  P+K + D+ +YGRQ+FPLAAVVGQDAIKTALLLG
Sbjct  54   RRTRIRVTASAAAATIESGNGALLT-PEK-SFDSISYGRQFFPLAAVVGQDAIKTALLLG  111

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AIDR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWE+ LAD +E
Sbjct  112  AIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSVANADPACPEEWENTLADCME  171

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +DSAGNIKT+I++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  172  FDSAGNIKTQIVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  222



>gb|KJB21817.1| hypothetical protein B456_004G015600 [Gossypium raimondii]
Length=755

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+  A   +    +++YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  59   SNNGAAAAIGSESEDPSSSYGRRYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  118

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHAVLPPI++V GS++NADPTCPEEWEDGLA R EYDS GN+KT++++SPFV
Sbjct  119  AKTVMARGLHAVLPPIDVVVGSMANADPTCPEEWEDGLAQRAEYDSNGNVKTQVVRSPFV  178

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  179  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  212



>ref|XP_003538089.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN35088.1| Magnesium-chelatase subunit chlD, chloroplastic [Glycine soja]
Length=750

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +1

Query  178  SGRRPHRLRFR---INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
            S  RP R+  R   + A +    +   +KP    T YGRQYFPLAAVVGQD+IKTALLLG
Sbjct  39   STYRPKRILQRSPIVGAQSENGALVTSEKP---DTNYGRQYFPLAAVVGQDSIKTALLLG  95

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AID  +GGIAISGKRGTAKTVMARGLHA+LPPIE+V+GSI+NADPTCPEEWEDGL + +E
Sbjct  96   AIDPGVGGIAISGKRGTAKTVMARGLHAILPPIEVVEGSIANADPTCPEEWEDGLTECLE  155

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            YDS GNIKT IIKSPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  156  YDSTGNIKTRIIKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>sp|O22437.1|CHLD_PEA RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; Flags: Precursor [Pisum sativum]
 gb|AAB72194.1| Mg-chelatase subunit D [Pisum sativum]
Length=754

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V+ A ++   D + YGRQYFPLAAV+GQDAIKTALLLGA D  IGGIAISG+RGT
Sbjct  54   SENGAVLQASEEKL-DASNYGRQYFPLAAVIGQDAIKTALLLGATDPRIGGIAISGRRGT  112

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKT+MARG+HA+LPPIE+V+GSI+NADP+CPEEWEDGL  RVEYDS GN+KT IIKSPFV
Sbjct  113  AKTIMARGMHAILPPIEVVQGSIANADPSCPEEWEDGLYKRVEYDSDGNVKTHIIKSPFV  172

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  173  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  206



>gb|KHG27451.1| Magnesium-chelatase subunit chlD, chloroplastic [Gossypium arboreum]
Length=755

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+  A   +    +++YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  59   SNNGAAAAIGSESEDPSSSYGRRYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  118

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHAVLPPI++V GS++NADPTCPEEWEDGLA R E+DS GN+KT++++SPFV
Sbjct  119  AKTVMARGLHAVLPPIDVVVGSMANADPTCPEEWEDGLAQRAEFDSNGNVKTQVVRSPFV  178

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  179  QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  212



>gb|KEH27405.1| protoporphyrin IX magnesium chelatase subunit ChlD [Medicago 
truncatula]
Length=641

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAI  381
            + R  +    +V+ + ++   D + YGRQYFPLAAVVGQDAIKTALLLGA D  IGGIAI
Sbjct  45   KLRAQSENGAAVLTSEEEKKLDASNYGRQYFPLAAVVGQDAIKTALLLGATDPRIGGIAI  104

Query  382  SGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEI  561
            SG+RGTAKT+MARG+HA+LPPIE+V+GSI+N+DP+CPEEWED LA RVEYDS GNIKT I
Sbjct  105  SGRRGTAKTIMARGMHAILPPIEVVEGSIANSDPSCPEEWEDDLAQRVEYDSDGNIKTRI  164

Query  562  IKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KSPFVQIPLGVTEDRLIGSVDVEESVK+GTTV+QPGLLA
Sbjct  165  VKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVYQPGLLA  204



>gb|KDP22132.1| hypothetical protein JCGZ_25963 [Jatropha curcas]
Length=756

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 11/175 (6%)
 Frame = +1

Query  181  GRRPHRLRFRINASA--------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTA  336
             +RPH  RF + AS+        NG+VVA  +K   + ++YGRQ+FPLAAVVGQDAIKTA
Sbjct  43   AKRPHTRRFSVLASSANATLEPGNGAVVAPSEK--LELSSYGRQFFPLAAVVGQDAIKTA  100

Query  337  LLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLA  516
            LLLGAIDR IGGIAISG+RGTAKTVMARGLHA+LPPI++V GS++NADP+ PEEWEDGLA
Sbjct  101  LLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIDVVVGSVANADPSYPEEWEDGLA  160

Query  517  DRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +R  YDS GN+KT++++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  161  ERA-YDSDGNVKTQVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  214



>ref|XP_007158593.1| hypothetical protein PHAVU_002G165600g [Phaseolus vulgaris]
 gb|ESW30587.1| hypothetical protein PHAVU_002G165600g [Phaseolus vulgaris]
Length=746

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  187  RPHRLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            R  R+R R+      S   AP     + T YGRQYFPLAAVVGQDAIKTALLLGA D  I
Sbjct  40   RTKRIRKRLPIIRAESENGAPVTSEKNNTNYGRQYFPLAAVVGQDAIKTALLLGATDPGI  99

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISGKRGTAKTVMARGLHAVLPPIE+V GSI+NADP+CPEEWEDGL + +EYDSAG+
Sbjct  100  GGIAISGKRGTAKTVMARGLHAVLPPIEVVVGSIANADPSCPEEWEDGLTECLEYDSAGS  159

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            IKT I+KSPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  160  IKTRIVKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  204



>ref|XP_008363236.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Malus 
domestica]
Length=772

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 10/171 (6%)
 Frame = +1

Query  193  HRLRFRINASA--------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLG  348
             R R R+ ASA        NG+++  P+K + D+ +YGRQ+FPLAAVVGQDAIKTALLLG
Sbjct  51   RRTRIRVTASAAAATIESGNGALLT-PEK-SFDSISYGRQFFPLAAVVGQDAIKTALLLG  108

Query  349  AIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE  528
            AIDR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GS++NADP CPEEWE+ L D +E
Sbjct  109  AIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSMANADPACPEEWENTLPDCME  168

Query  529  YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +DSAGNIKT+I++SPFVQIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  169  FDSAGNIKTQIVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA  219



>ref|XP_003610971.1| Magnesium-chelatase subunit chlD [Medicago truncatula]
 gb|AES93929.1| protoporphyrin IX magnesium chelatase subunit ChlD [Medicago 
truncatula]
Length=754

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAI  381
            + R  +    +V+ + ++   D + YGRQYFPLAAVVGQDAIKTALLLGA D  IGGIAI
Sbjct  45   KLRAQSENGAAVLTSEEEKKLDASNYGRQYFPLAAVVGQDAIKTALLLGATDPRIGGIAI  104

Query  382  SGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEI  561
            SG+RGTAKT+MARG+HA+LPPIE+V+GSI+N+DP+CPEEWED LA RVEYDS GNIKT I
Sbjct  105  SGRRGTAKTIMARGMHAILPPIEVVEGSIANSDPSCPEEWEDDLAQRVEYDSDGNIKTRI  164

Query  562  IKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KSPFVQIPLGVTEDRLIGSVDVEESVK+GTTV+QPGLLA
Sbjct  165  VKSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVYQPGLLA  204



>ref|XP_004517295.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Cicer arietinum]
Length=707

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  265  DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPP  444
            D ++YGRQYFPLAAVVGQDAIKTALLLGA D  IGGIAISG+RGTAKT+MARG+HA+LPP
Sbjct  72   DASSYGRQYFPLAAVVGQDAIKTALLLGATDPRIGGIAISGRRGTAKTIMARGMHAILPP  131

Query  445  IEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSV  624
            IE+V+GSI+NADP+CPEEWEDGL+  +EYDSAGNIKT IIKSPFVQIPLGVTEDRLIGSV
Sbjct  132  IEVVQGSIANADPSCPEEWEDGLSKHLEYDSAGNIKTHIIKSPFVQIPLGVTEDRLIGSV  191

Query  625  DVEESVKSGTTVFQPGLLA  681
            DVEESVKSGTTV+QPGLLA
Sbjct  192  DVEESVKSGTTVYQPGLLA  210



>dbj|BAJ92350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=356

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+  A      +    YGR+YFPLAAVVGQDAIKT+LLLGAIDR +GGIAISGKRGT
Sbjct  56   STNGAAPAPTSPAPSGQQKYGREYFPLAAVVGQDAIKTSLLLGAIDREVGGIAISGKRGT  115

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWED LAD+V+YD+ GN+K EI+K+PFV
Sbjct  116  AKTVMARGLHAMLPPIEVVVGSIANADPNIPEEWEDHLADQVQYDADGNVKCEIVKAPFV  175

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVE+SV+SGTTVFQPGLLA
Sbjct  176  QIPLGVTEDRLIGSVDVEQSVRSGTTVFQPGLLA  209



>ref|XP_011459478.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=757

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = +1

Query  187  RPHRLRFRINASANGSVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDR  360
            R H  R RI+ASA   + ++    AA  D + YGRQ+FPLAAVVGQDAIKTALLLGAID 
Sbjct  39   RFHTRRPRISASATAVIESSNGAVAAKQDNSDYGRQFFPLAAVVGQDAIKTALLLGAIDC  98

Query  361  NIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSA  540
             IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GSI+NADP CPEEWED L +R+E+DS 
Sbjct  99   KIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPACPEEWEDVLPERMEFDST  158

Query  541  GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            GN+KT+I+KSPFVQIPLGVTEDRLIGSVDVEESV++GTTVFQPGLLA
Sbjct  159  GNVKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVRTGTTVFQPGLLA  205



>ref|XP_007015160.1| Albina 1 [Theobroma cacao]
 gb|EOY32779.1| Albina 1 [Theobroma cacao]
Length=761

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S+NG+V+++     + +++YGRQYFPLAAVVGQDAIKTALLLGAIDR IGGIAISG+RGT
Sbjct  66   SSNGAVISSED--PSASSSYGRQYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGT  123

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPI++V GSI+NADP CPEEWED LA + EYDS GN+KT++++SPFV
Sbjct  124  AKTVMARGLHAILPPIDVVVGSIANADPACPEEWEDDLAQQAEYDSDGNVKTQVVRSPFV  183

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct  184  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  217



>ref|XP_004981316.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Setaria italica]
Length=755

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 2/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG++  A +  AA    YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct  56   STNGAIPTASKSGAA--RGYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT  113

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP  P+EWEDGLADR++YD+ GN+KTEI+K+PFV
Sbjct  114  AKTVMARGLHAMLPPIEVVVGSIANADPNSPDEWEDGLADRLQYDADGNVKTEIVKTPFV  173

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVE SV+SGTTVFQPGLLA
Sbjct  174  QIPLGVTEDRLIGSVDVEASVRSGTTVFQPGLLA  207



>gb|AAO00766.1| Mg-chelatase, putative [Arabidopsis thaliana]
Length=430

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAADTTA--------YGRQYFPLAAVVGQDAIK  330
            P   R    RF + ASAN +V +    PA+ +          YGRQ+FPLAAVVGQ+ IK
Sbjct  38   PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK  97

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct  98   TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD  157

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  158  LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  214



>ref|XP_006417679.1| hypothetical protein EUTSA_v10006894mg [Eutrema salsugineum]
 gb|ESQ36032.1| hypothetical protein EUTSA_v10006894mg [Eutrema salsugineum]
Length=753

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 143/165 (87%), Gaps = 6/165 (4%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAADT-----TAYGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            RF + ASAN +V  +P   AA T     T+YGRQ+FPLAAVVGQ+ IKTALLLGA+DR I
Sbjct  42   RFTVRASANATV-ESPNGVAASTSETESTSYGRQFFPLAAVVGQEGIKTALLLGAVDREI  100

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISG+RGTAKT+MARGLHA+LPPIE+V GSISNADP CP+EWED LA++VEY++  +
Sbjct  101  GGIAISGRRGTAKTIMARGLHAILPPIEVVVGSISNADPACPDEWEDELAEKVEYNADKS  160

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  161  IKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  205



>dbj|BAH19517.1| AT1G08520 [Arabidopsis thaliana]
Length=441

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAADTTA--------YGRQYFPLAAVVGQDAIK  330
            P   R    RF + ASAN +V +    PA+ +          YGRQ+FPLAAVVGQ+ IK
Sbjct  36   PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK  95

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct  96   TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD  155

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  156  LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  212



>gb|AFW67236.1| hypothetical protein ZEAMMB73_644992 [Zea mays]
Length=692

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 13/180 (7%)
 Frame = +1

Query  175  PSGRRPHRLR-FRINASA----------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQD  321
            P   RP RLR  R+ A+A          NG+V  A +  A     YGR+YFPLAAVVGQD
Sbjct  31   PVTSRPARLRDSRLAAAATSASEVLESTNGAVPTAAKDGA--WRGYGREYFPLAAVVGQD  88

Query  322  AIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEW  501
            AIKTALLLGAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADP  P+EW
Sbjct  89   AIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVVGSIANADPNSPDEW  148

Query  502  EDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EDGLAD+++YDS GN+K+EI+K+PFVQIPLGVTEDRLIGSVDVE SV+SGTTVFQPGLLA
Sbjct  149  EDGLADQIQYDSDGNVKSEIVKTPFVQIPLGVTEDRLIGSVDVEASVRSGTTVFQPGLLA  208



>ref|XP_008644403.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Zea 
mays]
 gb|AFW67237.1| hypothetical protein ZEAMMB73_644992 [Zea mays]
Length=755

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 147/180 (82%), Gaps = 13/180 (7%)
 Frame = +1

Query  175  PSGRRPHRLR-FRINASA----------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQD  321
            P   RP RLR  R+ A+A          NG+V  A +  A     YGR+YFPLAAVVGQD
Sbjct  31   PVTSRPARLRDSRLAAAATSASEVLESTNGAVPTAAKDGA--WRGYGREYFPLAAVVGQD  88

Query  322  AIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEW  501
            AIKTALLLGAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSI+NADP  P+EW
Sbjct  89   AIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVVGSIANADPNSPDEW  148

Query  502  EDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EDGLAD+++YDS GN+K+EI+K+PFVQIPLGVTEDRLIGSVDVE SV+SGTTVFQPGLLA
Sbjct  149  EDGLADQIQYDSDGNVKSEIVKTPFVQIPLGVTEDRLIGSVDVEASVRSGTTVFQPGLLA  208



>ref|XP_002889699.1| T27G7.20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65958.1| T27G7.20 [Arabidopsis lyrata subsp. lyrata]
Length=772

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 4/173 (2%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAA----DTTAYGRQYFPLAAVVGQDAIKTALL  342
            P   R    RF + ASAN +V +    PA+    ++T+YGRQ+FPLAAVVGQ+ IKTALL
Sbjct  36   PKRNRSASCRFTVRASANATVESPNGVPASTPETESTSYGRQFFPLAAVVGQEGIKTALL  95

Query  343  LGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADR  522
            LGA+DR IGGIAISG+RGTAKTVMARGLH ++PPIE+V GSISNADP CP+EWED L +R
Sbjct  96   LGAVDREIGGIAISGRRGTAKTVMARGLHEIIPPIEVVVGSISNADPACPDEWEDDLDER  155

Query  523  VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  156  IEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  208



>ref|XP_002466225.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor]
 gb|EER93223.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor]
Length=755

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 138/154 (90%), Gaps = 2/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG++  A +  A     YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct  57   STNGAIPTAAKGGAG--RGYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT  114

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP+ P+EWEDGLAD+++YDS GN+KTEI+K+PFV
Sbjct  115  AKTVMARGLHAMLPPIEVVVGSIANADPSSPDEWEDGLADQIQYDSDGNVKTEIVKTPFV  174

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVE SV+SGTTVFQPGLLA
Sbjct  175  QIPLGVTEDRLIGSVDVEASVRSGTTVFQPGLLA  208



>gb|KFK43171.1| hypothetical protein AALP_AA1G089000 [Arabis alpina]
Length=753

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 6/165 (4%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAA-----DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            RF + ASA+ + V +P   AA     D+++YGRQ+FPLAAVVGQ+ IKTALLLGA+DR I
Sbjct  42   RFTVRASAS-TTVESPNGAAASTSEIDSSSYGRQFFPLAAVVGQEGIKTALLLGAVDREI  100

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISG+RGTAKT+MARGLHA+LPPIE+V GSISNADP CP+EWED L +R+EY++  +
Sbjct  101  GGIAISGRRGTAKTIMARGLHAILPPIEVVVGSISNADPACPDEWEDDLDERIEYNADKS  160

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  161  VKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  205



>ref|XP_003563940.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Brachypodium 
distachyon]
Length=758

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V  +P         YGR+YFPLAAVVGQDAIKTALLLGAIDR +GGIAISGKRGT
Sbjct  55   STNGAV-PSPSSGVDTGRQYGREYFPLAAVVGQDAIKTALLLGAIDREVGGIAISGKRGT  113

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSISNADP  PEEWED LAD+V+YD+ GN+K+EI+K+PFV
Sbjct  114  AKTVMARGLHAMLPPIEVVVGSISNADPNIPEEWEDDLADQVQYDADGNVKSEIVKAPFV  173

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVE SV+SGTTVFQPGLLA
Sbjct  174  QIPLGVTEDRLIGSVDVEASVRSGTTVFQPGLLA  207



>ref|XP_010475652.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Camelina 
sativa]
Length=759

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 143/168 (85%), Gaps = 8/168 (5%)
 Frame = +1

Query  202  RFRINASA-------NGSVVAAPQ-KPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAID  357
            RF + ASA       NG+V +  + +  ++ T+YGRQ+FPLAAVVGQ+ IKTALLLGA+D
Sbjct  45   RFTVRASASATVESPNGAVASTSEMETESENTSYGRQFFPLAAVVGQEGIKTALLLGAVD  104

Query  358  RNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDS  537
            R IGGIAISG+RGTAKT+MARGLH +LPPIE+V GSISNADP CP+EWED L++R+EY++
Sbjct  105  REIGGIAISGRRGTAKTIMARGLHEILPPIEVVVGSISNADPACPDEWEDDLSERIEYNA  164

Query  538  AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
              ++KTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  165  DKSVKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  212



>emb|CDX95054.1| BnaC05g06170D [Brassica napus]
Length=754

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 6/165 (4%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAADTTA-----YGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            RF + ASAN ++V +P   AA ++      YGR++FPLAAVVGQ+ IKTALLLGA+DR I
Sbjct  42   RFTVRASAN-AIVESPNGVAASSSDIDSSDYGRKFFPLAAVVGQEGIKTALLLGAVDREI  100

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISG+RGTAKT+MARGLHA+LPPIE+V GSISNADP CP+EWED LA++VEY++   
Sbjct  101  GGIAISGRRGTAKTIMARGLHAILPPIEVVVGSISNADPACPDEWEDELAEKVEYNADNT  160

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  161  VKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  205



>ref|NP_563821.2| magnesium-chelatase subunit chlD [Arabidopsis thaliana]
 sp|Q9SJE1.3|CHLD_ARATH RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein ALBINA 
1; AltName: Full=Protein PIGMENT DEFECTIVE EMBRYO 166; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL36177.1| putative Mg-chelatase [Arabidopsis thaliana]
 gb|AAM14341.1| putative Mg-chelatase [Arabidopsis thaliana]
 dbj|BAE98674.1| Mg-chelatase like protein [Arabidopsis thaliana]
 gb|AEE28301.1| magnesium-chelatase subunit chlD [Arabidopsis thaliana]
Length=760

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAADTTA--------YGRQYFPLAAVVGQDAIK  330
            P   R    RF + ASAN +V +    PA+ +          YGRQ+FPLAAVVGQ+ IK
Sbjct  36   PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK  95

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct  96   TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD  155

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  156  LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  212



>gb|AAZ32779.1| chloroplast Mg-chelatase subunit XANTHA-G precursor [Hordeum 
vulgare]
 dbj|BAJ86238.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=761

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+  A      +    YGR+YFPLAAVVGQDAIKT+LLLGAIDR +GGIAISGKRGT
Sbjct  56   STNGAAPAPTSPAPSGQQKYGREYFPLAAVVGQDAIKTSLLLGAIDREVGGIAISGKRGT  115

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWED LAD+V+YD+ GN+K EI+K+PFV
Sbjct  116  AKTVMARGLHAMLPPIEVVVGSIANADPNIPEEWEDHLADQVQYDADGNVKCEIVKAPFV  175

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLGVTEDRLIGSVDVE+SV+SGTTVFQPGLLA
Sbjct  176  QIPLGVTEDRLIGSVDVEQSVRSGTTVFQPGLLA  209



>gb|AAD52031.1|AF083555_1 magnesium-chelatase subunit CHLD precursor [Arabidopsis thaliana]
Length=726

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 139/177 (79%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAADTTA--------YGRQYFPLAAVVGQDAIK  330
            P   R    RF + ASAN +V +    PA+ +          YGRQ+FPLAAVVGQ+ IK
Sbjct  5    PKRNRIASCRFTVRASANATVESPNGVPASTSDTETETDTTSYGRQFFPLAAVVGQEGIK  64

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP EWED 
Sbjct  65   TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPNEWEDD  124

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  125  LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  181



>gb|AAF22895.1|AC006932_12 T27G7.20 [Arabidopsis thaliana]
Length=778

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = +1

Query  175  PSGRRPHRLRFRINASANGSVVAAPQKPAADTTA--------YGRQYFPLAAVVGQDAIK  330
            P   R    RF + ASAN +V +    PA+ +          YGRQ+FPLAAVVGQ+ IK
Sbjct  36   PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK  95

Query  331  TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG  510
            TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct  96   TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD  155

Query  511  LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  156  LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  212



>ref|XP_006306844.1| hypothetical protein CARUB_v10008387mg [Capsella rubella]
 gb|EOA39742.1| hypothetical protein CARUB_v10008387mg [Capsella rubella]
Length=758

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 140/172 (81%), Gaps = 7/172 (4%)
 Frame = +1

Query  187  RPHRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL  345
            R    RF + ASA       NG+V +  +    + T+YGRQ+FPLAAVVGQ+ IKTALLL
Sbjct  40   RAASCRFTVRASASATVESPNGAVASTLETETEENTSYGRQFFPLAAVVGQEGIKTALLL  99

Query  346  GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV  525
            GA+DR IGGIAISG+RGTAKT+MARGLH +LPPIE+V GSISNADP CP+EWED L +R+
Sbjct  100  GAVDREIGGIAISGRRGTAKTIMARGLHEILPPIEVVVGSISNADPACPDEWEDDLNERI  159

Query  526  EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  160  EYNADKTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  211



>gb|AAP73850.1| putative magnesium chelatase subunit chlD [Oryza sativa Japonica 
Group]
Length=745

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG++   P         YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct  58   STNGAI---PSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT  114

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWE+GLA++V+YD+ GN+KTEIIK+PFV
Sbjct  115  AKTVMARGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFV  174

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLG+TEDRLIGSVDVE SVKSGTTVFQPGLLA
Sbjct  175  QIPLGITEDRLIGSVDVEASVKSGTTVFQPGLLA  208



>ref|NP_001051668.1| Os03g0811100 [Oryza sativa Japonica Group]
 sp|Q6ATS0.1|CHLD_ORYSJ RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 
1; Flags: Precursor [Oryza sativa Japonica Group]
 sp|B8AMB8.1|CHLD_ORYSI RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 
1; Flags: Precursor [Oryza sativa Indica Group]
 gb|AAT77900.1| putative magnesium chelatase [Oryza sativa Japonica Group]
 gb|ABF99490.1| magnesium chelatase ATPase subunit D family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13582.1| Os03g0811100 [Oryza sativa Japonica Group]
 gb|ABK58606.1| magnesium chelatase subunit D [Oryza sativa Japonica Group]
 gb|ABK58607.1| magnesium chelatase subunit D [Oryza sativa Japonica Group]
 dbj|BAG92983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76389.1| hypothetical protein OsI_14020 [Oryza sativa Indica Group]
 gb|EEE60156.1| hypothetical protein OsJ_13066 [Oryza sativa Japonica Group]
Length=754

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG++   P         YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct  58   STNGAI---PSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT  114

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWE+GLA++V+YD+ GN+KTEIIK+PFV
Sbjct  115  AKTVMARGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFV  174

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            QIPLG+TEDRLIGSVDVE SVKSGTTVFQPGLLA
Sbjct  175  QIPLGITEDRLIGSVDVEASVKSGTTVFQPGLLA  208



>emb|CDX93557.1| BnaA06g04910D [Brassica napus]
Length=756

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 6/165 (4%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQ-----KPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            RF + ASAN ++V +P          D++ YGR++FPLAAVVGQ+ IKTALLLGA+DR I
Sbjct  43   RFTVRASAN-AIVESPNGAAASSSDIDSSDYGRKFFPLAAVVGQEGIKTALLLGAVDREI  101

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISG+RGTAKT+MARGLHA+LPPIE+V GSISNADP CP+EWED LA++VEY++   
Sbjct  102  GGIAISGRRGTAKTIMARGLHAILPPIEVVVGSISNADPACPDEWEDELAEKVEYNADNT  161

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  162  VKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  206



>ref|XP_009148107.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Brassica 
rapa]
Length=756

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 6/165 (4%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQ-----KPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNI  366
            RF + ASAN ++V +P          D++ YGR++FPLAAVVGQ+ IKTALLLGA+DR I
Sbjct  43   RFTVRASAN-AIVESPNGAAASSSDIDSSDYGRKFFPLAAVVGQEGIKTALLLGAVDREI  101

Query  367  GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGN  546
            GGIAISG+RGTAKT+MARGLHA+LPPIE+V GSISNADP CP+EWED LA++VEY++   
Sbjct  102  GGIAISGRRGTAKTIMARGLHAILPPIEVVVGSISNADPACPDEWEDELAEKVEYNADNT  161

Query  547  IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +KTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  162  VKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  206



>ref|XP_010488958.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Camelina sativa]
Length=759

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 8/168 (5%)
 Frame = +1

Query  202  RFRINASA-------NGSVVAAPQKPAADTTA-YGRQYFPLAAVVGQDAIKTALLLGAID  357
            RF + ASA       NG+V +  +         YGRQ+FPLAAVVGQ+ IKTALLLGA+D
Sbjct  45   RFTVRASACATVESPNGAVASTSETETESENTSYGRQFFPLAAVVGQEGIKTALLLGAVD  104

Query  358  RNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDS  537
            R IGGIAISG+RGTAKT+MARGLH +LPPIE+V GSISNADP CP+EWED L++R+EY++
Sbjct  105  REIGGIAISGRRGTAKTIMARGLHEILPPIEVVVGSISNADPACPDEWEDDLSERIEYNA  164

Query  538  AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
              +IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct  165  DKSIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA  212



>gb|EMT09999.1| Magnesium-chelatase subunit chlD, chloroplastic [Aegilops tauschii]
Length=815

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 136/159 (86%), Gaps = 5/159 (3%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG+V A      +    YGR+YFPLAAVVGQDAIKT+LLLGAIDR +GGIAISGKRGT
Sbjct  114  STNGAVPAPASPAPSGQQQYGREYFPLAAVVGQDAIKTSLLLGAIDREVGGIAISGKRGT  173

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEE-----WEDGLADRVEYDSAGNIKTEII  564
            AKTVMARGLHA+LPPIE+V GSI+NADP  PE+     WED LAD+V+YD+ GN+K+EI+
Sbjct  174  AKTVMARGLHAMLPPIEVVVGSIANADPNIPEDSSYGRWEDHLADQVQYDADGNVKSEIV  233

Query  565  KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            K+PFVQIPLGVTEDRLIGSVDVE+SV+SGTTVFQPGLLA
Sbjct  234  KAPFVQIPLGVTEDRLIGSVDVEQSVRSGTTVFQPGLLA  272



>ref|XP_001764245.1| predicted protein [Physcomitrella patens]
 gb|EDQ71086.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  223  ANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTA  402
            +NG+      +   +   YGRQ+FPLA+VVG DAIK+ALLLGA+D+ IGGIAI+G+RGTA
Sbjct  78   SNGTARMDSGEEKKEEKLYGRQFFPLASVVGHDAIKSALLLGAVDQCIGGIAIAGRRGTA  137

Query  403  KTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQ  582
            KTVMARGLHA+LPPIE+V GS+ NADP  PEEWE GLA+R++Y+  G+IKTE++K+PF+Q
Sbjct  138  KTVMARGLHAILPPIEVVAGSMCNADPNKPEEWEQGLAERLQYNDDGSIKTEVVKAPFIQ  197

Query  583  IPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            IPLGVTEDRLIGSVDVEESV++GTTV+QPGLLA
Sbjct  198  IPLGVTEDRLIGSVDVEESVRTGTTVYQPGLLA  230



>ref|XP_006651947.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Oryza brachyantha]
Length=670

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  310  VGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTC  489
            +  DAIKTALLLGAIDR IGGIAISGKRGTAKTVMARGLHA+LPPIE+V GSISNA+P C
Sbjct  1    MATDAIKTALLLGAIDREIGGIAISGKRGTAKTVMARGLHAMLPPIEVVAGSISNANPNC  60

Query  490  PEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQP  669
            PEEWEDGLA+RV+YD+ GN+KTEI+K+PFVQIPLG+TEDRLIGSVDVE SVKSGTTVFQP
Sbjct  61   PEEWEDGLAERVQYDADGNLKTEIVKTPFVQIPLGITEDRLIGSVDVEASVKSGTTVFQP  120

Query  670  GLLA  681
            GLLA
Sbjct  121  GLLA  124



>ref|XP_009338554.1| PREDICTED: LOW QUALITY PROTEIN: magnesium-chelatase subunit ChlD, 
chloroplastic-like [Pyrus x bretschneideri]
Length=816

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 133/151 (88%), Gaps = 3/151 (2%)
 Frame = +1

Query  220  SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT  399
            S NG++++ P+K +  + +YGR +FPLAAVVGQDAIKTALLLG+ID  IGGIAISG+RGT
Sbjct  105  SGNGALLS-PEK-SFHSISYGRHFFPLAAVVGQDAIKTALLLGSIDCEIGGIAISGRRGT  162

Query  400  AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV  579
            AKTVMA GLHA+LPPIE+V GS++NADP CPEEWE  L D +E+DSAGNIKT+I++S FV
Sbjct  163  AKTVMASGLHAILPPIEVVVGSMANADPACPEEWESTLPDCMEFDSAGNIKTQIVRSLFV  222

Query  580  QIPLGVTEDRLIGSVDVEESVKSGTTVFQPG  672
            Q PLGVTEDRLIGSV+VEESVK+GTTVFQPG
Sbjct  223  Q-PLGVTEDRLIGSVEVEESVKTGTTVFQPG  252



>ref|XP_002975141.1| hypothetical protein SELMODRAFT_174616 [Selaginella moellendorffii]
 gb|EFJ23926.1| hypothetical protein SELMODRAFT_174616 [Selaginella moellendorffii]
Length=720

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  274  AYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEI  453
            +YGRQYFPLAAVVGQ+AIK ALLLGA+D  IGGIA++G+RGTAKTV+ARGLHA+LPPIEI
Sbjct  37   SYGRQYFPLAAVVGQEAIKAALLLGAVDNGIGGIAVAGRRGTAKTVLARGLHALLPPIEI  96

Query  454  VKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            V GSI+NADP+  EEWEDGL +++   S G    E++K+PFVQ+PLGVTEDRL+GSVDVE
Sbjct  97   VAGSIANADPSHSEEWEDGLEEKIALGSDGKPVVEVVKAPFVQVPLGVTEDRLLGSVDVE  156

Query  634  ESVKSGTTVFQPGLLA  681
            ES+K GTTVFQPGLLA
Sbjct  157  ESIKQGTTVFQPGLLA  172



>ref|XP_002977545.1| hypothetical protein SELMODRAFT_176264 [Selaginella moellendorffii]
 gb|EFJ21549.1| hypothetical protein SELMODRAFT_176264 [Selaginella moellendorffii]
Length=720

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  274  AYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEI  453
            +YGRQYFPLAAVVGQ+AIK ALLLGA+D  IGGIA++G+RGTAKTV+ARGLHA+LPPIEI
Sbjct  37   SYGRQYFPLAAVVGQEAIKAALLLGAVDNGIGGIAVAGRRGTAKTVLARGLHALLPPIEI  96

Query  454  VKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            V GSI+NADP+  EEWEDGL +++   S G    +++K+PFVQ+PLGVTEDRL+GSVDVE
Sbjct  97   VAGSIANADPSHSEEWEDGLEEKIALGSDGKPVVDVVKAPFVQVPLGVTEDRLLGSVDVE  156

Query  634  ESVKSGTTVFQPGLLA  681
            ES+K GTTVFQPGLLA
Sbjct  157  ESIKQGTTVFQPGLLA  172



>ref|XP_010458091.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Camelina sativa]
Length=746

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 128/169 (76%), Gaps = 19/169 (11%)
 Frame = +1

Query  202  RFRINASANGSVVAAPQKPAADTTA---------YGRQYFPLAAVVGQDAIKTALLLGAI  354
            RF + ASA+ +V  +P    A T+          YGRQ+FPLAAVVGQ+ IKTALLLGA+
Sbjct  45   RFTVRASASATV-ESPNGAVASTSETETESENTSYGRQFFPLAAVVGQEGIKTALLLGAV  103

Query  355  DRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD  534
            DR IGGIAISG+RGTAKT+MARGLH +LPPIE+V GSISNADP CP+EWED L++R+EY+
Sbjct  104  DREIGGIAISGRRGTAKTIMARGLHEILPPIEVVVGSISNADPACPDEWEDDLSERIEYN  163

Query  535  SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            +  +IKTEI+KSPF+Q+        ++G+    ESVK GTTVFQPGLLA
Sbjct  164  ADKSIKTEIVKSPFIQV------HSVLGAF---ESVKRGTTVFQPGLLA  203



>ref|XP_003079609.1| Mg-chelatase subunit (ISS) [Ostreococcus tauri]
 emb|CAL54267.1| von Willebrand factor, type A [Ostreococcus tauri]
Length=756

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            RQ FPLAAV+GQ+ IK+ALLLG ID  +GGIAISG+RGTAK++MARGLHA+LPPIE VK 
Sbjct  75   RQTFPLAAVIGQEKIKSALLLGGIDPTLGGIAISGRRGTAKSIMARGLHALLPPIECVKS  134

Query  463  SISNADPTCPEEWEDGLA-DRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            S  NADPT P+EWEDGL  +++  D  GNI+T I  +PFVQ+PLGVTEDRLIG+VD+EES
Sbjct  135  SYCNADPTKPDEWEDGLTEEKLNRDENGNIETIIRDAPFVQLPLGVTEDRLIGTVDIEES  194

Query  640  VKSGTTVFQPGLLA  681
            +K G TVFQPGLLA
Sbjct  195  MKQGKTVFQPGLLA  208



>ref|XP_001418124.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96417.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=683

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            RQ FPLAAV+GQ+ IK+ALLLG ID  +GGIAISG+RGTAK++MARGLHA+LPPIE VK 
Sbjct  2    RQTFPLAAVIGQEKIKSALLLGGIDPTLGGIAISGRRGTAKSIMARGLHALLPPIECVKD  61

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            S  NADP+ P+EWE+GL+++V  ++ GN++T I  +PFVQ+PLGVTEDRLIG+VD+EES+
Sbjct  62   SYCNADPSKPDEWEEGLSEKVTRNADGNVETIIRDAPFVQLPLGVTEDRLIGTVDIEESM  121

Query  643  KSGTTVFQPGLLA  681
            K G T+FQPGLLA
Sbjct  122  KQGKTIFQPGLLA  134



>ref|XP_002508833.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70091.1| predicted protein [Micromonas sp. RCC299]
Length=759

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            RQ FPLAAV+GQ+ IK+ALLLGAID  +GGIAISG+RGTAK++MARGLHA+LPPIEIV G
Sbjct  75   RQAFPLAAVIGQENIKSALLLGAIDPALGGIAISGRRGTAKSIMARGLHALLPPIEIVDG  134

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            +I N+DP  P  WEDGL +++  D+ G + T I ++PFVQ+PLGVTEDRL+G+VD+E S+
Sbjct  135  TICNSDPEDPNSWEDGLREKLSRDANGELVTRIREAPFVQVPLGVTEDRLVGTVDIEASM  194

Query  643  KSGTTVFQPGLLA  681
            K G TVFQPGLLA
Sbjct  195  KEGKTVFQPGLLA  207



>ref|XP_007514351.1| protoporphyrin IX magnesium chelatase subunit ChlD [Bathycoccus 
prasinos]
 emb|CCO15788.1| protoporphyrin IX magnesium chelatase subunit ChlD [Bathycoccus 
prasinos]
Length=766

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            RQ FPL+ V+GQ+ IK+ALLLG +D  +GGIAISGKRGTAK++MARGLHA+LPPIE+VKG
Sbjct  86   RQAFPLSMVIGQEKIKSALLLGGVDGALGGIAISGKRGTAKSIMARGLHALLPPIEVVKG  145

Query  463  SISNADPTCPEEWEDGLADRVEYDS-AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            S +N+DP  P EWE GLA+ V+ +   GNI+T I ++PFVQ+PLGVTEDRL+G+VD+EES
Sbjct  146  SYANSDPENPREWETGLANIVQKNQKTGNIETFIKEAPFVQVPLGVTEDRLVGTVDIEES  205

Query  640  VKSGTTVFQPGLLA  681
            +K G TVFQPGLLA
Sbjct  206  MKQGKTVFQPGLLA  219



>ref|XP_003059510.1| magnesium-chelatase subunit chlD chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH56642.1| magnesium-chelatase subunit chlD chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=694

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            RQ FPLAAV+GQ+ IK+ALLLGAID  +GGIAISG+RGTAK+VMARGLHA+LPPIE V G
Sbjct  10   RQTFPLAAVIGQENIKSALLLGAIDPALGGIAISGRRGTAKSVMARGLHALLPPIETVDG  69

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            +I N+ P  P  WEDGL DRV     G++KT I ++PFVQ+PLGVTEDRL+G+VD+E S+
Sbjct  70   TICNSSPEEPGTWEDGLIDRVTRKENGDVKTTIREAPFVQVPLGVTEDRLVGTVDIEASM  129

Query  643  KSGTTVFQPGLLA  681
            K G TVFQPGLLA
Sbjct  130  KEGKTVFQPGLLA  142



>gb|KIY96026.1| magnesium chelatase subunit D [Monoraphidium neglectum]
Length=338

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 3/133 (2%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            ++ +PLAAVVGQDAIK ALLLGA+D  +GGIAI+G+RGTAK++MARGLHA+LPPIE+V+G
Sbjct  58   QRSYPLAAVVGQDAIKEALLLGAVDTALGGIAIAGRRGTAKSIMARGLHALLPPIEVVEG  117

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            SI NADP  P  WEDGLA+++    +  + T I ++PFVQIPLGVTEDRL+G+VD+E S+
Sbjct  118  SICNADPEDPRSWEDGLAEKL---GSRELPTRIREAPFVQIPLGVTEDRLVGTVDIEASM  174

Query  643  KSGTTVFQPGLLA  681
            K G TVFQPGLLA
Sbjct  175  KEGKTVFQPGLLA  187



>gb|KIE06603.1| magnesium chelatase [Tolypothrix bouteillei VB521301]
Length=698

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYD--SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            N DP  PEEW+D + + +E     +  ++TEII +PFVQIPLGVTEDRL+GSVDVEESVK
Sbjct  73   NCDPNHPEEWDDKILEHLEAQDTQSTTVETEIIPAPFVQIPLGVTEDRLLGSVDVEESVK  132

Query  646  SGTTVFQPGLLA  681
             G TVFQPGLLA
Sbjct  133  QGDTVFQPGLLA  144



>ref|WP_015224439.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
 gb|AFZ42561.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
Length=691

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            TT+     FPL AVVGQ+AIK ALLL A+D  +GGIAISGKRGTAK+VMAR +H++LPP 
Sbjct  5    TTSLSNPTFPLTAVVGQEAIKLALLLSAVDPKLGGIAISGKRGTAKSVMARAIHSLLPPF  64

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            EIV+GS+SN DP  PEEW+D      +Y    +I TE+I++PFVQIPLGVTEDRL+GSVD
Sbjct  65   EIVQGSMSNCDPQNPEEWDD--ETFAQYGDTTDIPTEVIRAPFVQIPLGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VE+SVK G TVFQPGLLA
Sbjct  123  VEKSVKEGKTVFQPGLLA  140



>ref|WP_015230419.1| Mg-chelatase subunit ChlI [Dactylococcopsis salina]
 gb|AFZ51439.1| Mg-chelatase subunit ChlI [Dactylococcopsis salina PCC 8305]
Length=692

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            TT+     FPL AVVGQ+AIK ALLLGA+D  +GGIAISGKRGTAK+VMAR +H++LPPI
Sbjct  5    TTSPTNLNFPLTAVVGQEAIKLALLLGAVDPKLGGIAISGKRGTAKSVMARAIHSLLPPI  64

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            EIV+ SI+N DP  PEEW+D      EY    +I T++I++PFVQIPLGVTEDRL+GSVD
Sbjct  65   EIVQDSIANCDPKNPEEWDD--ETFTEYGDTTDIPTQVIRAPFVQIPLGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VE+SVK G TVFQPGLLA
Sbjct  123  VEKSVKEGKTVFQPGLLA  140



>ref|WP_026103229.1| magnesium chelatase [Pseudanabaena sp. PCC 6802]
Length=666

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL A+D  +GG+AI+G+RGTAK+V+ARGLHA+LPPIE+V GS S
Sbjct  11   FPLAAVVGQEAIKTALLLAAVDPGLGGVAIAGRRGTAKSVLARGLHALLPPIEVVVGSFS  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DPT PE WED L+DR+      +++T++I +PFVQIPLGVTEDRL+GSVDV +SV+ G
Sbjct  71   NCDPTKPETWEDNLSDRL---GDRDMETKVIPAPFVQIPLGVTEDRLLGSVDVSKSVQQG  127

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  128  ETVFQPGLLA  137



>ref|XP_001700902.1| magnesium chelatase subunit D [Chlamydomonas reinhardtii]
 gb|EDP07156.1| magnesium chelatase subunit D [Chlamydomonas reinhardtii]
Length=767

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = +1

Query  262  ADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLP  441
            AD +    + +PLAAVVGQD IK ALLLGA+D  +GGIAI+G+RGTAK++MARGLHA+LP
Sbjct  76   ADVSTRLARSYPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLP  135

Query  442  PIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGS  621
            PIE+V+GSI NADP  P  WE GLA++    + G +KT++  +PFVQIPLGVTEDRL+G+
Sbjct  136  PIEVVEGSICNADPEDPRSWEAGLAEKY---AGGPVKTKMRSAPFVQIPLGVTEDRLVGT  192

Query  622  VDVEESVKSGTTVFQPGLLA  681
            VD+E S+K G TVFQPGLLA
Sbjct  193  VDIEASMKEGKTVFQPGLLA  212



>ref|WP_017716658.1| magnesium-chelatase subunit ChlD [Oscillatoria sp. PCC 10802]
Length=695

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 11/151 (7%)
 Frame = +1

Query  247  PQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGL  426
            P   +A TTA     FPL AVVGQ+AIK ALLL A+D  +GG+AISG+RGTAK+VMAR +
Sbjct  2    PAPVSASTTA-----FPLIAVVGQEAIKQALLLSAVDPGLGGVAISGRRGTAKSVMARAV  56

Query  427  HAVLPPIEIVKGSISNADPTCPEEWEDGLA------DRVEYDSAGNIKTEIIKSPFVQIP  588
            HA+LPPIEIVKGS+SN DP  PEEW+D         ++ E  +AG + TE+I +PFVQIP
Sbjct  57   HALLPPIEIVKGSVSNCDPNKPEEWDDYTRALYCPDEKSEVPTAGEVPTEVIPAPFVQIP  116

Query  589  LGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            LGVTEDRL+GSVDVE+SV+ G T+FQPGLLA
Sbjct  117  LGVTEDRLLGSVDVEQSVRRGETIFQPGLLA  147



>ref|XP_002956151.1| magnesium chelatase subunit D chloroplast precursor [Volvox carteri 
f. nagariensis]
 gb|EFJ42690.1| magnesium chelatase subunit D chloroplast precursor [Volvox carteri 
f. nagariensis]
Length=702

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 110/138 (80%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            +T   R Y PLAAVVGQD IK ALLLGA+D  +GGIAI+G+RGTAK++MARGLHA+LPPI
Sbjct  16   STRLSRSY-PLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPPI  74

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            E+V+GS  NADP  P  WE GLA ++    AG +K ++  +PFVQIPLGVTEDRL+G+VD
Sbjct  75   EVVEGSFCNADPEDPRSWEAGLAGKI---GAGPVKAKLRSAPFVQIPLGVTEDRLVGTVD  131

Query  628  VEESVKSGTTVFQPGLLA  681
            +E S+K G TVFQPGLLA
Sbjct  132  IEASMKEGRTVFQPGLLA  149



>ref|WP_027404926.1| magnesium chelatase [Aphanizomenon flos-aquae]
Length=673

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKGSVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      D    I+TEII +PF+QIPLG+TEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLLAEERQD----IETEIIPAPFLQIPLGITEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  129  DTIFQPGLLA  138



>ref|XP_002956152.1| hypothetical protein VOLCADRAFT_121490 [Volvox carteri f. nagariensis]
 gb|EFJ42691.1| hypothetical protein VOLCADRAFT_121490 [Volvox carteri f. nagariensis]
Length=736

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            +PLAAVVGQD IK ALLLGA+D  +GGIAI+G+RGTAK++MARGLHA+LPPIE+V+GS  
Sbjct  42   YPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSFC  101

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            NADP  P  WE GLA ++    AG +K ++  +PFVQIPLGVTEDRL+G+VD+E S+K G
Sbjct  102  NADPEDPRSWEAGLAGKI---GAGPVKAKLRSAPFVQIPLGVTEDRLVGTVDIEASMKEG  158

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  159  RTVFQPGLLA  168



>ref|WP_015153650.1| protoporphyrin IX magnesium-chelatase [Chroococcidiopsis thermalis]
 gb|AFY87102.1| protoporphyrin IX magnesium-chelatase [Chroococcidiopsis thermalis 
PCC 7203]
Length=751

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 8/138 (6%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +H +LPPIE+VKGS  
Sbjct  12   FPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHTLLPPIEVVKGSFC  71

Query  472  NADPTCPEEWEDGLADRVEYD--------SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            N DP  PEEW+D L+  V  +        + GN+ TE+I +PF+QIPLGVTEDRL+GSVD
Sbjct  72   NCDPNRPEEWDDELSRDVTCNVSTEGNVSTEGNVPTEVIPAPFIQIPLGVTEDRLLGSVD  131

Query  628  VEESVKSGTTVFQPGLLA  681
            VE+SVK G TVFQPGLLA
Sbjct  132  VEQSVKQGETVFQPGLLA  149



>ref|WP_015207701.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale]
 gb|AFZ24447.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale 
PCC 7417]
Length=678

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLTAVDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE+W+D L+         +I TEII +PF+QIPLG+TEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEDWDDLLSAEFADKDIQDIPTEIIPAPFLQIPLGITEDRLLGSVDVEKSVKQG  132

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  133  DTVFQPGLLA  142



>ref|WP_035150399.1| magnesium chelatase [Calothrix sp. 336/3]
 gb|KFB82235.1| magnesium chelatase [Calothrix sp. 336/3]
Length=676

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 5/130 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VK SIS
Sbjct  13   FPLAAVVGQEAIKTALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKDSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE W+D L        +  I+T +I SPFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNQPETWDDWL-----LAQSTPIETAVIPSPFVQIPLGVTEDRLLGSVDVEQSVKQG  127

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  128  KTVFQPGLLA  137



>ref|WP_028089282.1| magnesium chelatase [Dolichospermum circinale]
Length=674

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VK S+S
Sbjct  13   FPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKASVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      +    I+TEII +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLL----AEQRQEIETEIIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  129  DTVFQPGLLA  138



>ref|WP_015197436.1| protoporphyrin IX magnesium-chelatase [Calothrix parietina]
 gb|AFZ00789.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 6303]
Length=675

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE++KGSIS
Sbjct  12   FPLAAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVMKGSIS  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE+W+D L +    +  GN  TEII +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  72   NCDPNHPEDWDDLLLEDTP-NVEGN--TEIIPAPFIQIPLGVTEDRLLGSVDVEKSVKEG  128

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  129  DTVFQPGLLA  138



>ref|WP_028082200.1| magnesium chelatase [Dolichospermum circinale]
Length=674

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VK S+S
Sbjct  13   FPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKASVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      +    I+TEII +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLL----AEQRQEIETEIIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  129  DTIFQPGLLA  138



>gb|KIJ82576.1| magnesium chelatase [Scytonema tolypothrichoides VB-61278]
Length=705

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 109/136 (80%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK+ALLL A+D  +GG+AI+G+RGTAK+VMAR +H++LPPIE+V GSIS
Sbjct  13   FPLTAVVGQEAIKSALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHSLLPPIEVVSGSIS  72

Query  472  NADPTCPEEWEDG-LADR-----VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            N DP  PEEW+D  LAD         D +  +KTEII + FVQIPLGVTEDRL+GSVDVE
Sbjct  73   NCDPNRPEEWDDQLLADSSLTLPTSEDGSSELKTEIIPATFVQIPLGVTEDRLLGSVDVE  132

Query  634  ESVKSGTTVFQPGLLA  681
            +SVK G T+FQPGLLA
Sbjct  133  QSVKLGETIFQPGLLA  148



>ref|WP_016860550.1| magnesium-chelatase subunit ChlD [Fischerella muscicola]
Length=677

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYD-SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DP  PEEW+D L     Y+ S  N+ TE+I +PF+QIPLGVTEDRLIGSVDVE+SVK 
Sbjct  73   NCDPNHPEEWDDKLYGDATYNVSTENVPTEVIPAPFIQIPLGVTEDRLIGSVDVEQSVKQ  132

Query  649  GTTVFQPGLLA  681
            G T+FQPGLLA
Sbjct  133  GQTIFQPGLLA  143



>ref|WP_015204373.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum]
 gb|AFZ14268.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum PCC 
9333]
Length=683

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LH++LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARALHSLLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADR------VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            N DP  P EW+D L  +      +  D+  ++ TE+I +PFVQIPLG TEDRLIGSVDVE
Sbjct  73   NCDPNNPSEWDDDLLSQAHNSPSINGDNEVDLPTEVIPAPFVQIPLGTTEDRLIGSVDVE  132

Query  634  ESVKSGTTVFQPGLLA  681
            +SVK G TVFQPGLLA
Sbjct  133  KSVKLGETVFQPGLLA  148



>ref|WP_015080654.1| magnesium chelatase ATPase subunit [Anabaena sp. 90]
 gb|AFW95500.1| magnesium chelatase ATPase subunit [Anabaena sp. 90]
Length=674

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 8/132 (6%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKGSVS  72

Query  472  NADPTCPEEWEDGL--ADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            N DP  PEEW+D L    R E      I+TEII +PF+QIPLG+TEDRL+GSVDVE+SVK
Sbjct  73   NCDPNHPEEWDDKLLAGQRQE------IETEIIPAPFLQIPLGITEDRLLGSVDVEQSVK  126

Query  646  SGTTVFQPGLLA  681
             G T+FQPGLLA
Sbjct  127  QGDTIFQPGLLA  138



>ref|WP_006277092.1| magnesium-chelatase subunit ChlD [Cylindrospermopsis raciborskii]
 gb|EFA69910.1| Mg chelatase subunit [Cylindrospermopsis raciborskii CS-505]
Length=671

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL A+D  +GG+ I+G+RGTAK+VMARG+HA+LP IE+VK S+S
Sbjct  13   FPLAAVVGQEAIKTALLLAAVDPGLGGVVIAGRRGTAKSVMARGIHALLPGIEVVKDSMS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE W+D L  +    ++  I TEII  PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPEQPESWDDQLVAQ----TSEEIVTEIIPVPFVQIPLGVTEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  129  KTVFQPGLLA  138



>ref|WP_026721783.1| magnesium chelatase [Fischerella sp. PCC 9431]
Length=696

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L   VE    G  +TE+I +PF+QIPLGVTEDRLIGSVDVE+SVK G
Sbjct  73   NCDPDHPEEWDDKLLSFVE--EGGQTETEVIPAPFIQIPLGVTEDRLIGSVDVEQSVKQG  130

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  131  QTIFQPGLLA  140



>ref|WP_015135326.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7376]
 gb|AFY39583.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7376]
Length=683

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            T    R  FPL AVVGQD IKTALLLGA+D  +GG+AI+GKRGTAK+VMARG+H++LPPI
Sbjct  3    TLTTSRTSFPLTAVVGQDVIKTALLLGAVDPALGGVAIAGKRGTAKSVMARGIHSLLPPI  62

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            EI+K +  N DPT P +W+D  A      +  NI TE+I +PFVQIPLGVTEDRL+GSVD
Sbjct  63   EIIKDNPYNCDPTNPSDWDDLTALEFNGTNPENIPTEVIAAPFVQIPLGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VE SV+ G  VFQPGLLA
Sbjct  123  VEASVRQGEPVFQPGLLA  140



>ref|WP_039200580.1| magnesium chelatase [Aphanizomenon flos-aquae]
 gb|KHG42395.1| magnesium chelatase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=673

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKGSVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      +    I+TEII +PF+QIPLG+TEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLL----AEQRQEIETEIIPAPFLQIPLGITEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             T+ QPGLLA
Sbjct  129  DTIIQPGLLA  138



>ref|WP_040687697.1| magnesium chelatase [Pseudanabaena biceps]
Length=667

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL AID  IGGIA++G+RGTAK+V+ARG+HA+LPPIE+   S+S
Sbjct  5    FPLAAVVGQEAIKTALLLAAIDPGIGGIALAGRRGTAKSVLARGIHALLPPIEVAVDSLS  64

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DPT P+ W+D L   ++      I T++I +PF+QIPLG+TEDRLIGSVDV  SV+ G
Sbjct  65   NCDPTKPDTWDDALVKAMKDKDKSEIATKVIPAPFIQIPLGITEDRLIGSVDVSRSVREG  124

Query  652  TTVFQPGLLA  681
             TVFQPG+LA
Sbjct  125  QTVFQPGILA  134



>gb|ELS33326.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena biceps PCC 
7429]
Length=681

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL AID  IGGIA++G+RGTAK+V+ARG+HA+LPPIE+   S+S
Sbjct  19   FPLAAVVGQEAIKTALLLAAIDPGIGGIALAGRRGTAKSVLARGIHALLPPIEVAVDSLS  78

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DPT P+ W+D L   ++      I T++I +PF+QIPLG+TEDRLIGSVDV  SV+ G
Sbjct  79   NCDPTKPDTWDDALVKAMKDKDKSEIATKVIPAPFIQIPLGITEDRLIGSVDVSRSVREG  138

Query  652  TTVFQPGLLA  681
             TVFQPG+LA
Sbjct  139  QTVFQPGILA  148



>ref|XP_005645047.1| magnesium chelatase subunit D [Coccomyxa subellipsoidea C-169]
 gb|EIE20503.1| magnesium chelatase subunit D [Coccomyxa subellipsoidea C-169]
Length=725

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            ++ FPL AV+GQD IK ALLLGA D  +GG+ I+GKRGT K+V+ARGLHA+LPPIE+VKG
Sbjct  44   QRSFPLTAVIGQDHIKQALLLGACDTGLGGVCIAGKRGTCKSVLARGLHALLPPIEVVKG  103

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            S  NA+P  P EWEDGL  ++     G +  EI  +PFVQIPLGVTEDRL+G+VD+E S+
Sbjct  104  SYCNANPENPREWEDGLRAKL---GQGEVPREIKDAPFVQIPLGVTEDRLVGTVDIEASM  160

Query  643  KSGTTVFQPGLLA  681
            K G TVFQPGLLA
Sbjct  161  KDGKTVFQPGLLA  173



>ref|XP_010246237.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246238.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246239.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246240.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=634

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +1

Query  412  MARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPL  591
            MARGLHA+LPPIE+V GSISNADP CPEEWEDGL+DRVEYD+AGN+KT+I++SPFVQIPL
Sbjct  1    MARGLHAILPPIEVVVGSISNADPACPEEWEDGLSDRVEYDAAGNVKTQIVRSPFVQIPL  60

Query  592  GVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            GVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct  61   GVTEDRLIGSVDVEESVKTGTTVFQPGLLA  90



>ref|WP_017310168.1| magnesium-chelatase subunit ChlD [Fischerella sp. PCC 9339]
Length=677

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYD-SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DP  PEEW+D L     +  S  N+ TE+I +PF+QIPLGVTEDRLIGSVDVE+SVK 
Sbjct  73   NCDPNHPEEWDDELCRDAPWRVSTENVPTEVIPAPFIQIPLGVTEDRLIGSVDVEQSVKQ  132

Query  649  GTTVFQPGLLA  681
            G T+FQPGLLA
Sbjct  133  GQTIFQPGLLA  143



>ref|WP_006196704.1| magnesium-chelatase subunit ChlD [Nodularia spumigena]
 gb|EAW45151.1| Mg chelatase subunit [Nodularia spumigena CCY9414]
 gb|AHJ28910.1| Protoporphyrin IX Mg-chelatase subunit D [Nodularia spumigena 
CCY9414]
Length=680

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+V+GSIS
Sbjct  13   FPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVQGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N +P  PE+W+D L          ++ T+II +PF+QIPLGVTEDRL+GSVDVE+SV+ G
Sbjct  73   NCEPNHPEDWDDYLFAEYGDKDIQDVPTQIIPAPFIQIPLGVTEDRLLGSVDVEKSVQQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_044450019.1| magnesium chelatase [Mastigocladus laminosus]
 gb|KIY12987.1| magnesium chelatase [Mastigocladus laminosus UU774]
Length=677

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYD-SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DP  PEEW+D L     +  S  N+ TE+I +PF+QIPLGVTEDRLIGSVDVE+SVK 
Sbjct  73   NCDPNHPEEWDDELCRDAPWRVSTENVPTEVIPAPFIQIPLGVTEDRLIGSVDVEQSVKQ  132

Query  649  GTTVFQPGLLA  681
            G T+FQPGLLA
Sbjct  133  GQTIFQPGLLA  143



>ref|WP_026104071.1| magnesium chelatase [Anabaena sp. PCC 7108]
Length=674

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VK S+S
Sbjct  13   FPLTAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHALLPPIEVVKDSVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      +    I+TEII +PF+QIPLG+TEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLL----AEQRQEIETEIIPAPFLQIPLGITEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  129  DTIFQPGLLA  138



>ref|WP_039715972.1| magnesium chelatase [Scytonema millei]
 gb|KIF18449.1| magnesium chelatase [Scytonema millei VB511283]
Length=720

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL AID  +GG+AI+G+RGTAK+VMAR +H +LPPIE+VKGS  
Sbjct  12   FPLTAVVGQEAIKIALLLAAIDPGLGGVAIAGRRGTAKSVMARAIHTLLPPIEVVKGSFC  71

Query  472  NADPTCPEEWEDGLADRVEY---DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            N DP  PEEW+D L+   +         + TE+I +PFVQIPLGVTEDRL+GSVDVE+SV
Sbjct  72   NCDPNRPEEWDDELSRGAQLCAPTEQLRVPTEVIPAPFVQIPLGVTEDRLLGSVDVEQSV  131

Query  643  KSGTTVFQPGLLA  681
            K G TVFQPGLLA
Sbjct  132  KQGETVFQPGLLA  144



>ref|WP_010994455.1| magnesium-chelatase subunit ChlD [Nostoc sp. PCC 7120]
 dbj|BAB77802.1| Mg chelatase subunit [Nostoc sp. PCC 7120]
Length=678

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L       +  ++ TEII SPFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDYLLAEYADKNIQDVPTEIIPSPFVQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_011319823.1| magnesium-chelatase subunit ChlD [Anabaena variabilis]
 gb|ABA22693.1| protoporphyrin IX magnesium-chelatase [Anabaena variabilis ATCC 
29413]
Length=678

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L       +  ++ TEII SPFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDYLLAEYADKNLQDVPTEIIPSPFVQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_015137423.1| magnesium chelatase ATPase subunit D [Nostoc sp. PCC 7524]
 gb|AFY46967.1| magnesium chelatase ATPase subunit D [Nostoc sp. PCC 7524]
Length=679

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+V GSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVTGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D LA         ++ T+II SPFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDYLAAEYADKQMQDVPTQIIPSPFVQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  133  DTVFQPGLLA  142



>ref|WP_038297161.1| magnesium chelatase, partial [[Scytonema hofmanni] UTEX B 1581]
Length=444

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL+AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA++PPIE+VKG +S
Sbjct  9    FPLSAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIHAIIPPIEVVKGGLS  68

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L   V       I+TE+I +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  69   NCDPNRPEEWDDKLIAEV----GETIETEVIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  124

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  125  ETVFQPGLLA  134



>ref|WP_015216626.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica]
 gb|AFZ60010.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica PCC 
7122]
Length=673

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VK S+ 
Sbjct  13   FPLTAVVGQEAIKIALLLTAVDPALGGVVIAGRRGTAKSVMARAIHALLPPIEVVKDSLC  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      +    I+TEII +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLL----AEERQEIETEIIPAPFLQIPLGVTEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  129  DTIFQPGLLA  138



>ref|WP_019507353.1| magnesium-chelatase subunit ChlD [Pleurocapsa sp. PCC 7319]
Length=676

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            +A TTA     FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR ++ +L
Sbjct  2    SAVTTAPKNFNFPLTAVVGQEAIKLALLLSAVDPELGGVAIAGRRGTAKSVMARAIYNLL  61

Query  439  PPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            PPIEI+KGS+ N DPT P+ W+D    +    +  +I T+II +PFVQIPLGVTEDRL+G
Sbjct  62   PPIEIIKGSLYNCDPTQPQNWDDDTVAKYGGTAIEDIPTQIIPAPFVQIPLGVTEDRLLG  121

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVEESVK G  +FQPGLLA
Sbjct  122  SVDVEESVKQGEPIFQPGLLA  142



>ref|WP_019493900.1| magnesium-chelatase subunit ChlD [Calothrix sp. PCC 7103]
Length=681

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKG IS
Sbjct  12   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGGIS  71

Query  472  NADPTCPEEWEDGLADRVEYDSAG---NIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            N DP  PEEW+D L +    D+      I+TEII +PFVQIPLG TEDRL+GSVDVEESV
Sbjct  72   NCDPNRPEEWDDILVEIDRQDACSTRETIETEIIPAPFVQIPLGTTEDRLLGSVDVEESV  131

Query  643  KSGTTVFQPGLLA  681
            K G T+FQPGLLA
Sbjct  132  KQGATIFQPGLLA  144



>ref|WP_015956003.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 7424]
 gb|ACK72418.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7424]
Length=671

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            T++  +  FPL+AVVGQDAIK ALLL ++D  +GG+AI+G+RGTAK+VMAR +HA+LPPI
Sbjct  5    TSSRAKMNFPLSAVVGQDAIKLALLLTSVDPGLGGVAIAGRRGTAKSVMARAIHALLPPI  64

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            E++K +  N DPT  EEW+D      +Y +  +I TEII +PF+QIP+GVTEDRL+GSVD
Sbjct  65   EVIKDNPFNCDPTNREEWDDQTLQ--QYSNTIDIPTEIIPAPFIQIPIGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VEESVK G  VFQPGLLA
Sbjct  123  VEESVKRGEAVFQPGLLA  140



>ref|WP_015148342.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata]
 gb|AFY81698.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata 
PCC 6304]
Length=681

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 108/137 (79%), Gaps = 9/137 (7%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VK SI+
Sbjct  12   FPLTAVVGQEAIKLALLLTAVDPGLGGLAIAGRRGTAKSVMARAIHALLPPIEVVKDSIA  71

Query  472  NADPTCPEEWEDGLADRVEYDSAG-------NIKTEIIKSPFVQIPLGVTEDRLIGSVDV  630
            N +PT P+EW+D    R  Y + G        + T+II +PFVQIPLGVTEDRL+GSVDV
Sbjct  72   NCNPTNPDEWDD--LTRETYPTQGTNSTTPDEVPTQIIPAPFVQIPLGVTEDRLLGSVDV  129

Query  631  EESVKSGTTVFQPGLLA  681
            E+SVK G TVFQPGLLA
Sbjct  130  EQSVKQGDTVFQPGLLA  146



>gb|EFA73344.1| Magnesium chelatase ATPase subunit D [Raphidiopsis brookii D9]
Length=669

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 7/131 (5%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIKTALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIEI+K S+S
Sbjct  16   FPLNAVVGQEAIKTALLLAAVDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEIIKDSLS  75

Query  472  NADPTCPEEWEDG-LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N  P  PE W+D  LA  +E      ++TEII  PFVQIPLGVTEDRL+GSVDVE+SVK 
Sbjct  76   NCSPDQPETWDDQLLAQTLE------LETEIIPVPFVQIPLGVTEDRLLGSVDVEQSVKQ  129

Query  649  GTTVFQPGLLA  681
            G TVFQPGLLA
Sbjct  130  GKTVFQPGLLA  140



>ref|WP_026733423.1| magnesium chelatase [Fischerella sp. PCC 9605]
Length=676

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGN----IKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            N DP  PEEW+D L   +  +   +    I+TE+I +PFVQIPLGVTEDRLIGSVDVE+S
Sbjct  73   NCDPNHPEEWDDKLLLTLPQEGGQDVHPTIETEVIPAPFVQIPLGVTEDRLIGSVDVEQS  132

Query  640  VKSGTTVFQPGLLA  681
            VK G TVFQPGLLA
Sbjct  133  VKQGQTVFQPGLLA  146



>ref|WP_040553567.1| magnesium chelatase [Raphidiopsis brookii]
Length=667

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 7/131 (5%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIKTALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIEI+K S+S
Sbjct  14   FPLNAVVGQEAIKTALLLAAVDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEIIKDSLS  73

Query  472  NADPTCPEEWEDG-LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N  P  PE W+D  LA  +E      ++TEII  PFVQIPLGVTEDRL+GSVDVE+SVK 
Sbjct  74   NCSPDQPETWDDQLLAQTLE------LETEIIPVPFVQIPLGVTEDRLLGSVDVEQSVKQ  127

Query  649  GTTVFQPGLLA  681
            G TVFQPGLLA
Sbjct  128  GKTVFQPGLLA  138



>ref|WP_041041571.1| magnesium chelatase [Tolypothrix campylonemoides]
 gb|KIJ74206.1| magnesium chelatase [Tolypothrix campylonemoides VB511288]
Length=714

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 110/141 (78%), Gaps = 11/141 (8%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRV-----------EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            N DP  P+EW+D L   V           E D+   I+TEII +PFVQIPLGVTEDRL+G
Sbjct  73   NCDPNRPQEWDDKLLALVGQTSCLPLEEGEPDTHPTIETEIIPTPFVQIPLGVTEDRLLG  132

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVE+SVK G T+FQPGLLA
Sbjct  133  SVDVEQSVKQGETIFQPGLLA  153



>ref|WP_016873557.1| magnesium-chelatase subunit ChlD [Chlorogloeopsis fritschii]
Length=675

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L   +       + TE+I +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDKLLCELGDKDPQELPTEVIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_017321794.1| magnesium-chelatase subunit ChlD [cyanobacterium PCC 7702]
Length=672

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 110/134 (82%), Gaps = 6/134 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRVEY----DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            N DP  PEEW+D L   +E+    D    ++T+I+ +PFVQIPLGVTEDRL+GS+DVE+S
Sbjct  73   NCDPQHPEEWDDKLL--LEFAAKEDKQREVETQIVPAPFVQIPLGVTEDRLLGSIDVEQS  130

Query  640  VKSGTTVFQPGLLA  681
            +K G TVFQPGLLA
Sbjct  131  LKKGETVFQPGLLA  144



>ref|WP_015120155.1| protoporphyrin IX magnesium-chelatase [Rivularia sp. PCC 7116]
 gb|AFY56593.1| protoporphyrin IX magnesium-chelatase [Rivularia sp. PCC 7116]
Length=678

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            AA T       FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+L
Sbjct  2    AASTVNSSFTTFPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIHALL  61

Query  439  PPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            PPIE+VK SISN +P  PEEW+D L  R    S  +++TEII +PF+QIPLGVTEDRL+G
Sbjct  62   PPIEVVKDSISNCNPDNPEEWDDDLLSR-GVKSTEDVETEIIPAPFLQIPLGVTEDRLLG  120

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVE+SVK G TVFQPGLLA
Sbjct  121  SVDVEKSVKQGDTVFQPGLLA  141



>ref|WP_016864776.1| magnesium-chelatase subunit ChlD [Fischerella muscicola]
Length=677

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 108/132 (82%), Gaps = 6/132 (5%)
 Frame = +1

Query  298  LAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNA  477
            LAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSISN 
Sbjct  15   LAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSISNC  74

Query  478  DPTCPEEWEDGLADRVEYDS----AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            DP  PEEW+D L    EY S       I+TE+I +PFVQIPLGVTEDRLIGSVDVE+SVK
Sbjct  75   DPNHPEEWDDKLL--AEYPSLTLPVDGIETEVIPAPFVQIPLGVTEDRLIGSVDVEQSVK  132

Query  646  SGTTVFQPGLLA  681
             G TVFQPGLLA
Sbjct  133  QGQTVFQPGLLA  144



>ref|WP_015160910.1| magnesium chelatase ATPase subunit D [Chamaesiphon minutus]
 gb|AFY94790.1| magnesium chelatase ATPase subunit D [Chamaesiphon minutus PCC 
6605]
Length=677

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL+AVVGQ+AIK ALLL A+D  +GG+AI+G RGTAK+VMAR +H++LPPIEI  G IS
Sbjct  13   FPLSAVVGQEAIKIALLLAAVDPTLGGVAIAGGRGTAKSVMARAIHSLLPPIEIAVGGIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P EW+D L+     D    ++T+I+ +PFVQIPLGVTEDRL+GSVD+++SV++G
Sbjct  73   NCDPQAPSEWDDSLSAMRASDPNLELQTKIVPTPFVQIPLGVTEDRLLGSVDLDKSVQAG  132

Query  652  TTVFQPGLLA  681
             +VFQPGLLA
Sbjct  133  ASVFQPGLLA  142



>ref|WP_011614175.1| magnesium-chelatase subunit ChlD [Trichodesmium erythraeum]
 gb|ABG53881.1| protoporphyrin IX magnesium-chelatase [Trichodesmium erythraeum 
IMS101]
Length=672

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +H++LPPIEIVKGSIS
Sbjct  12   FPLAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHSLLPPIEIVKGSIS  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N +P  PEEW++ +       +   I TE+I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  72   NCNPNYPEEWDEQVLQESPNATGEEISTEVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG  131

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  132  ETVFQPGLLA  141



>ref|WP_009457764.1| MULTISPECIES: magnesium-chelatase subunit ChlD [Fischerella]
 gb|EHC12289.1| magnesium chelatase ATPase subunit D [Fischerella sp. JSC-11]
Length=678

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 108/132 (82%), Gaps = 6/132 (5%)
 Frame = +1

Query  298  LAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNA  477
            LAAVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSISN 
Sbjct  15   LAAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSISNC  74

Query  478  DPTCPEEWEDGLADRVEYDS----AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            DP  PEEW+D L    EY S       I+TE+I +PFVQIPLGVTEDRLIGSVDVE+SVK
Sbjct  75   DPNHPEEWDDKLL--AEYPSLTLPVDGIETEVIPAPFVQIPLGVTEDRLIGSVDVEQSVK  132

Query  646  SGTTVFQPGLLA  681
             G TVFQPGLLA
Sbjct  133  KGETVFQPGLLA  144



>ref|WP_015222191.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium stanieri]
 gb|AFZ46873.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium stanieri 
PCC 7202]
Length=679

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ AIKTALLL A+D  +GG+AI+GKRGTAK+VMARG+HA+LPPIE++KGS  
Sbjct  11   FPLTAVIGQQAIKTALLLAAVDPTLGGVAIAGKRGTAKSVMARGVHALLPPIEVIKGSRF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   EEW++   ++        I TE+I +PFVQIPL  TEDRL+GSVDVEESVK G
Sbjct  71   NCDPDNREEWDNETLEKYGDTPREEIPTEVIAAPFVQIPLNATEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  131  EPVFQPGLLA  140



>ref|WP_015186804.1| protoporphyrin IX magnesium-chelatase [Gloeocapsa sp. PCC 7428]
 gb|AFZ28927.1| protoporphyrin IX magnesium-chelatase [Gloeocapsa sp. PCC 7428]
Length=670

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LHA+LPPIEIVK S+ 
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHALLPPIEIVKSSMC  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L D  +      ++TE+I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNRPEEWDDQLRDICDRT---QMETEVIPAPFIQIPLGVTEDRLLGSVDVEQSVKQG  129

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  130  ETVFQPGLLA  139



>ref|WP_039739178.1| magnesium chelatase [Hassallia byssoidea]
Length=710

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA++PPIEIVKG +S
Sbjct  9    FPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIHALIPPIEIVKGGLS  68

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L      ++   I+TEII +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  69   NCDPNRPEEWDDKLI----AEAGETIETEIIPAPFVQIPLGVTEDRLLGSVDVEQSVKLG  124

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  125  ETVFQPGLLA  134



>ref|WP_012408069.1| magnesium-chelatase subunit ChlD [Nostoc punctiforme]
 gb|ACC80048.1| magnesium chelatase ATPase subunit D [Nostoc punctiforme PCC 
73102]
Length=676

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D L          ++  EII +PF+QIPLG+TEDRL+GSVDVE+SVK G
Sbjct  73   NCDPNHPEEWDDQLLAEYADKDIQDVPVEIIPAPFLQIPLGITEDRLLGSVDVEKSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_015167493.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7502]
 gb|AFY72834.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7502]
Length=659

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 107/133 (80%), Gaps = 13/133 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FP++AVVGQ+AIKTALLL +ID  +GG+AI+G+RGTAK+V+ARG+HA+LPPIEIV  SIS
Sbjct  7    FPISAVVGQEAIKTALLLASIDPMLGGVAIAGRRGTAKSVLARGVHALLPPIEIVANSIS  66

Query  472  NADPTCPEEWEDGLADRVEYDSAGN---IKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            N DPT PE W          DSA N   ++T++I +PF+QIPLG+TEDRLIGSVDV +SV
Sbjct  67   NCDPTKPETW----------DSATNPDIVETKVIPAPFIQIPLGITEDRLIGSVDVAKSV  116

Query  643  KSGTTVFQPGLLA  681
            + G T+FQPGLLA
Sbjct  117  QQGKTIFQPGLLA  129



>ref|WP_015165944.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena sp. PCC 
7367]
 gb|AFY70988.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena sp. PCC 
7367]
Length=683

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 10/140 (7%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIKTALLL AID  +GG+AI+G+RGTAK+V+ARG+HA+LPPIE+  GSIS
Sbjct  15   FPLAAVVGQEAIKTALLLAAIDPGLGGVAIAGRRGTAKSVLARGVHALLPPIEVAVGSIS  74

Query  472  NADPTCPEEWEDGLADRV-------EYDSAG---NIKTEIIKSPFVQIPLGVTEDRLIGS  621
            N DP  PE W+D L  ++       E + +G   +I+  +I +PFVQIPL +TEDRL+GS
Sbjct  75   NCDPDQPEIWDDALLKQLNAHNSTSESNGSGSLPSIERRVIPAPFVQIPLSITEDRLLGS  134

Query  622  VDVEESVKSGTTVFQPGLLA  681
            VDV +SV+ G TVFQPGLLA
Sbjct  135  VDVSKSVQQGQTVFQPGLLA  154



>ref|WP_015172429.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
 gb|AFY66864.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
Length=680

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GGI ISG+RGTAK+VMAR +HA+LPPIEIV+GS+ 
Sbjct  12   FPLAAVVGQEAIKVALLLSAVDPGLGGIIISGRRGTAKSVMARAIHALLPPIEIVQGSL-  70

Query  472  NADPTCPEEWEDGLADRVEY-DSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DP  P EW+D  A   EY D      T+++ +PFVQ+PLGVTEDRL+GSVDV +S+K 
Sbjct  71   NCDPNLPSEWDDQTA--AEYGDRPTEAPTQVVPAPFVQVPLGVTEDRLLGSVDVAQSIKR  128

Query  649  GTTVFQPGLLA  681
            G TVFQPGLLA
Sbjct  129  GETVFQPGLLA  139



>ref|WP_017651554.1| magnesium-chelatase subunit ChlD [Microchaete sp. PCC 7126]
Length=673

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR ++A+LPPIE+V+GSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIYALLPPIEVVEGSIS  72

Query  472  NADPTCPEEWEDGL-ADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DP+ PE+W+D L AD  E D   ++ T II +PFVQIPLGVTEDRL+GSVDVE+SVK 
Sbjct  73   NCDPSHPEDWDDQLLADYAEQD-IQDVPTAIIPAPFVQIPLGVTEDRLLGSVDVEQSVKQ  131

Query  649  GTTVFQPGLLA  681
            G T+FQPGLLA
Sbjct  132  GDTIFQPGLLA  142



>ref|WP_042342578.1| magnesium chelatase [Calothrix sp. PCC 7507]
Length=676

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR ++A+LPPIE+V+GSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIYALLPPIEVVQGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP+ PE W+D L          ++ TEII +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPSHPETWDDRLLAEYADQDIQDVPTEIIPAPFIQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>gb|AFY36234.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 7507]
Length=679

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR ++A+LPPIE+V+GSIS
Sbjct  16   FPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIYALLPPIEVVQGSIS  75

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP+ PE W+D L          ++ TEII +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  76   NCDPSHPETWDDRLLAEYADQDIQDVPTEIIPAPFIQIPLGVTEDRLLGSVDVEQSVKQG  135

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  136  DTIFQPGLLA  145



>ref|WP_012306227.1| magnesium-chelatase subunit ChlD [Synechococcus sp. PCC 7002]
 gb|ACA98603.1| magnesium chelatase ATPase subunit D (Mg-protoporphyrin IX chelatase 
subunit D) [Synechococcus sp. PCC 7002]
Length=682

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            T    R  FPL AVVGQD IKTALLLGA+D  +GG+AI+GKRGTAK+VMARG+H++LPPI
Sbjct  3    TLTTSRTTFPLTAVVGQDVIKTALLLGAVDPALGGVAIAGKRGTAKSVMARGIHSLLPPI  62

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            E++K +  N D     +W+D  A      ++ NI TE+I +PFVQIPLGVTEDRL+GSVD
Sbjct  63   EVIKDNPFNCDVQNRSDWDDLTAATYGETASENIPTEVIAAPFVQIPLGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VE SV+ G  VFQPGLLA
Sbjct  123  VEASVRQGEPVFQPGLLA  140



>ref|WP_017660572.1| magnesium-chelatase subunit ChlD [Geitlerinema sp. PCC 7105]
Length=686

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 103/136 (76%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL A+VGQ+AIK ALLL AID  +GG+A+SG+RGTAK+VMAR LHA+LPPIE+V  S+S
Sbjct  13   FPLTAIVGQEAIKLALLLSAIDPGLGGVAVSGRRGTAKSVMARALHALLPPIEVVADSLS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGN------IKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            N DP  PEEW+D   +     + G+      + T +I +PFVQIPL VTEDRL+GSVDVE
Sbjct  73   NCDPNKPEEWDDRAIELYGNQTNGSSAEMPEVPTRVIPTPFVQIPLNVTEDRLLGSVDVE  132

Query  634  ESVKSGTTVFQPGLLA  681
            +SVK G  VFQPGLLA
Sbjct  133  QSVKQGQPVFQPGLLA  148



>ref|WP_017741312.1| magnesium-chelatase subunit ChlD [Scytonema hofmanni]
Length=740

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 112/183 (61%), Gaps = 53/183 (29%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSIS  72

Query  472  NADPTCPEEWEDGLAD--------------------RVEYDS------------------  537
            N DP  PEEW+D + +                     +E D+                  
Sbjct  73   NCDPNHPEEWDDKILETLVGQASCLSVEEGRQDAHPTIEEDAHPTIEEDAHPTIEEDAHP  132

Query  538  ---------------AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPG  672
                           +  ++TEII +PF+QIPLGVTEDRL+GSVDVEESVK G TVFQPG
Sbjct  133  TIEEDAHPTIEEDAQSATVETEIISAPFIQIPLGVTEDRLLGSVDVEESVKQGDTVFQPG  192

Query  673  LLA  681
            LLA
Sbjct  193  LLA  195



>ref|WP_015115743.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
 gb|AFY45555.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
Length=679

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA++PPIE+V GSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALIPPIEVVPGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DPT P+EW++ L          ++ T+II +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPTRPDEWDNLLLAEYAEKDIQDVPTQIIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  132

Query  652  TTVFQPGLLA  681
             T+FQPGLLA
Sbjct  133  DTIFQPGLLA  142



>ref|WP_030005855.1| magnesium chelatase [Synechococcus sp. NKBG042902]
Length=682

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +1

Query  268  TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI  447
            T    R  FPL AVVGQD IKTALLLGA+D  +GG+AI+GKRGTAK+VMARG+H++LPPI
Sbjct  3    TLTTSRTTFPLTAVVGQDVIKTALLLGAVDPALGGVAIAGKRGTAKSVMARGIHSLLPPI  62

Query  448  EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            E+++ +  N D     +W+D  A      ++ NI TE+I +PFVQIPLGVTEDRL+GSVD
Sbjct  63   EVIQDNPFNCDVQNRSDWDDLTAATYGETASENIPTEVIAAPFVQIPLGVTEDRLLGSVD  122

Query  628  VEESVKSGTTVFQPGLLA  681
            VE SV+ G  VFQPGLLA
Sbjct  123  VEASVRQGEPVFQPGLLA  140



>ref|WP_040466875.1| magnesium chelatase [Geminocystis herdmanii]
Length=687

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ AIKTALLL A+D  +GG+AI+GKRGTAK+VMARG+HA+LPPIE++K +  
Sbjct  20   FPLTAVIGQQAIKTALLLAAVDPRLGGVAIAGKRGTAKSVMARGIHALLPPIEVIKDNRF  79

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N +P   E+W+     +    +   I TE+IK+PFVQIPLGVTEDRL+GSVDVE+SV+ G
Sbjct  80   NCEPQNSEDWDTDTWQQYADTAPDRIPTEVIKAPFVQIPLGVTEDRLLGSVDVEQSVQRG  139

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  140  EPIFQPGLLA  149



>ref|WP_027840190.1| magnesium chelatase [Mastigocoleus testarum]
Length=703

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 107/153 (70%), Gaps = 23/153 (15%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GGIAI+G+RGTAK++MAR +HA+LPPIE+V GSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGIAIAGRRGTAKSIMARAIHALLPPIEVVAGSIS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGN-----------------------IKTEIIKSPFVQ  582
            N DP  PEEW+D L        AG                        +KTEII SPFVQ
Sbjct  73   NCDPQHPEEWDDELLKNTSSLGAGQEGVNPATTQEAVSPETVNENTDGVKTEIIPSPFVQ  132

Query  583  IPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            IPLGVTEDRL+GSVDVE+SV+ G TVFQPGLLA
Sbjct  133  IPLGVTEDRLLGSVDVEKSVQQGQTVFQPGLLA  165



>ref|WP_040899190.1| magnesium chelatase [Xenococcus sp. PCC 7305]
Length=684

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ++IK ALLL AID  +GG+AI+G+RGTAK+VMARG+  +LPPIEI+K S+ 
Sbjct  23   FPLTAVVGQESIKLALLLAAIDPQLGGVAIAGRRGTAKSVMARGIDDILPPIEIIKNSLY  82

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P  W+D    +       +I T+II SPFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  83   NCDPDQPGFWDDETLVKYGNTKLEDIPTQIIPSPFVQIPLGVTEDRLLGSVDVEESVKRG  142

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  143  EPVFQPGLLA  152



>gb|ELS01041.1| magnesium chelatase ATPase subunit D [Xenococcus sp. PCC 7305]
Length=674

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ++IK ALLL AID  +GG+AI+G+RGTAK+VMARG+  +LPPIEI+K S+ 
Sbjct  13   FPLTAVVGQESIKLALLLAAIDPQLGGVAIAGRRGTAKSVMARGIDDILPPIEIIKNSLY  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P  W+D    +       +I T+II SPFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  73   NCDPDQPGFWDDETLVKYGNTKLEDIPTQIIPSPFVQIPLGVTEDRLLGSVDVEESVKRG  132

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  133  EPVFQPGLLA  142



>ref|WP_015142056.1| magnesium chelatase ATPase subunit D [Pleurocapsa minor]
 gb|AFY75748.1| magnesium chelatase ATPase subunit D [Pleurocapsa sp. PCC 7327]
Length=668

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +1

Query  262  ADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLP  441
            A TT+     FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+V+ARG+HA+LP
Sbjct  3    ALTTSRTSLSFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVLARGIHALLP  62

Query  442  PIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGS  621
            PIE++KGS  N DP  P+EW+D       Y +A  I TE+I +PFVQIPLGVTEDRL+GS
Sbjct  63   PIEVIKGSPFNCDPANPDEWDDKTQQL--YGNAAEIPTEVIPAPFVQIPLGVTEDRLLGS  120

Query  622  VDVEESVKSGTTVFQPGLLA  681
            VDVEESVK G  +FQPGLLA
Sbjct  121  VDVEESVKRGEPIFQPGLLA  140



>ref|WP_015224247.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
 gb|AFZ42369.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
Length=669

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 7/132 (5%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVV QD IK  LLL A+D N+GGIAI+G+RGTAKTV+ARGLHA+LPPIE+VKGS  
Sbjct  16   FPLPAVVNQDLIKLGLLLVAVDPNLGGIAIAGRRGTAKTVLARGLHALLPPIEVVKGSCC  75

Query  472  NADPTCPEEWEDGLADRVEYDSAGNI--KTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            N DP  PEEW+D     +  ++  N+  K E+  +PF+Q+PLGVTEDRL+GSVDV  S++
Sbjct  76   NCDPQHPEEWDD-----LTREANPNLIPKVEVRPTPFIQVPLGVTEDRLLGSVDVVRSIE  130

Query  646  SGTTVFQPGLLA  681
             G T+FQPGLLA
Sbjct  131  KGETIFQPGLLA  142



>ref|WP_036476619.1| magnesium chelatase [Myxosarcina sp. GI1]
Length=672

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            +A TT   +  FPL A+VGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR ++ +L
Sbjct  2    SAVTTVSKQFNFPLTAIVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIYQLL  61

Query  439  PPIEIVKGSISNADPTCPEEWED-GLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLI  615
            PPIEI+KGS+ N DPT P EW+D  +A   ++D+  +I T+I+ +PFVQIPLGVTEDRL+
Sbjct  62   PPIEIIKGSVYNCDPTKPAEWDDETIATYSQFDTE-DISTQIVPAPFVQIPLGVTEDRLL  120

Query  616  GSVDVEESVKSGTTVFQPGLLA  681
            GSVDVEESVK G  VFQPGLLA
Sbjct  121  GSVDVEESVKQGEPVFQPGLLA  142



>ref|WP_035985411.1| magnesium chelatase [Leptolyngbya sp. KIOST-1]
Length=680

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVV Q AIK ALLL A+D ++GG+AI+G+RGTAK+VMAR LH +LPPIE+V+GS  
Sbjct  13   FPLAAVVEQGAIKMALLLAAVDPSLGGVAIAGRRGTAKSVMARALHQLLPPIEVVEGSCC  72

Query  472  NADPTCPEEWEDGLADRVEYDSA-GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            NADP  P+ W+D   DR     A  ++ T ++ +PFVQIPLG+TEDRL+GSVDV  S+++
Sbjct  73   NADPMSPQLWDDQTRDRFGTSPAPADLPTRVVPAPFVQIPLGITEDRLLGSVDVARSIQA  132

Query  649  GTTVFQPGLLA  681
            G +VFQPGLLA
Sbjct  133  GESVFQPGLLA  143



>ref|WP_013321313.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 7822]
 gb|ADN13206.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7822]
Length=672

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL  +D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+K +  
Sbjct  13   FPLTAVVGQEAIKLALLLTGVDPGLGGVVIAGRRGTAKSVMARAIHSLLPPIEIIKDNPF  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DPT P+EW+D   ++        +  EII +PF+QIP+GVTEDRL+GSVDVEESVK G
Sbjct  73   NCDPTKPDEWDDHTQEQYSNTDIPELPKEIIAAPFIQIPIGVTEDRLLGSVDVEESVKRG  132

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  133  EAVFQPGLLA  142



>ref|WP_037221118.1| magnesium chelatase [Richelia intracellularis]
 emb|CDN14055.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
Length=676

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA++PPIE++ GS S
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIHALIPPIEVIPGSFS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P+EW+D L  R  Y+   ++ TE+  +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDPHNPKEWDDELLSR--YEPTADVPTEVTPAPFVQIPLGVTEDRLLGSVDVEKSVKQG  130

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  131  EPVFQPGLLA  140



>ref|WP_006101723.1| magnesium-chelatase subunit ChlD [Coleofasciculus chthonoplastes]
 gb|EDX74903.1| magnesium chelatase ATPase subunit D [Coleofasciculus chthonoplastes 
PCC 7420]
Length=676

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LH +LPPIE+VKGSIS
Sbjct  12   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHVLLPPIEVVKGSIS  71

Query  472  NADPTCPEEWEDG-LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N  P  P+EW+D  LA  VE D+   ++TEII +PFVQIPLG TEDRL+GSVDVE+SV+ 
Sbjct  72   NCHPRYPQEWDDQLLAQGVEPDT---VETEIIPAPFVQIPLGTTEDRLLGSVDVEKSVQQ  128

Query  649  GTTVFQPGLLA  681
            G  VFQPGLLA
Sbjct  129  GEPVFQPGLLA  139



>gb|AFZ55087.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium aponinum 
PCC 10605]
Length=681

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ AIKTALLL A+D  +GG+AI+GKRGTAK+VMARG+HA+LPPIE++K S  
Sbjct  11   FPLTAVIGQQAIKTALLLAAVDPQLGGVAIAGKRGTAKSVMARGIHALLPPIEVIKDSRF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   ++W+    +         I TE+I +PFVQIPLG TEDRL+GSVDVEESVK G
Sbjct  71   NCDPDNRQDWDSETLEIYGNTPREEIPTEVIPAPFVQIPLGTTEDRLLGSVDVEESVKRG  130

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  131  EPVFQPGLLA  140



>ref|WP_041236163.1| magnesium chelatase [Cyanothece sp. PCC 7425]
Length=667

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 12/139 (9%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LH +LPPIE+VKGS  
Sbjct  7    FPLTAVIGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHTLLPPIEVVKGSFC  66

Query  472  NADPTCPEEWEDGLADRVEYDSAGNI---------KTEIIKSPFVQIPLGVTEDRLIGSV  624
            NADPT P +W+D L D+++   AG I         +TEII +PF+QIPLGVTEDRL+G+V
Sbjct  67   NADPTRPSDWDDVLLDKLQ---AGEIPILEGQPQPETEIIPAPFIQIPLGVTEDRLLGAV  123

Query  625  DVEESVKSGTTVFQPGLLA  681
            DV +SVK G +VFQPGLLA
Sbjct  124  DVSQSVKRGESVFQPGLLA  142



>gb|ACL43185.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7425]
Length=664

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 12/139 (9%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LH +LPPIE+VKGS  
Sbjct  4    FPLTAVIGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHTLLPPIEVVKGSFC  63

Query  472  NADPTCPEEWEDGLADRVEYDSAGNI---------KTEIIKSPFVQIPLGVTEDRLIGSV  624
            NADPT P +W+D L D+++   AG I         +TEII +PF+QIPLGVTEDRL+G+V
Sbjct  64   NADPTRPSDWDDVLLDKLQ---AGEIPILEGQPQPETEIIPAPFIQIPLGVTEDRLLGAV  120

Query  625  DVEESVKSGTTVFQPGLLA  681
            DV +SVK G +VFQPGLLA
Sbjct  121  DVSQSVKRGESVFQPGLLA  139



>ref|WP_041922943.1| magnesium chelatase [Cyanobacterium aponinum]
Length=690

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AV+GQ AIKTALLL A+D  +GG+AI+GKRGTAK+VMARG+HA+LPPIE++K S  
Sbjct  20   FPLTAVIGQQAIKTALLLAAVDPQLGGVAIAGKRGTAKSVMARGIHALLPPIEVIKDSRF  79

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   ++W+    +         I TE+I +PFVQIPLG TEDRL+GSVDVEESVK G
Sbjct  80   NCDPDNRQDWDSETLEIYGNTPREEIPTEVIPAPFVQIPLGTTEDRLLGSVDVEESVKRG  139

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  140  EPVFQPGLLA  149



>ref|WP_040940037.1| magnesium chelatase [Prochloron didemni]
Length=664

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMA+ +H++LPPIE++KG+  
Sbjct  6    FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMAKAIHSLLPPIEVIKGNFC  65

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE W+D  A   E+  A ++ TE+I +PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  66   NCDPLNPETWDDLTA--AEWHGAEDLPTEVIPTPFVQIPLGVTEDRLLGSVDVEESVKRG  123

Query  652  TTVFQPGLLA  681
             +VFQPGLLA
Sbjct  124  ESVFQPGLLA  133



>ref|WP_012161187.1| magnesium-chelatase subunit ChlD [Acaryochloris marina]
 gb|ABW25585.1| magnesium protoporphyrin IX chelatase, D subunit [Acaryochloris 
marina MBIC11017]
Length=682

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGSI 
Sbjct  13   FPLTAVVGQEAIKLALLLTAVDPTLGGVVIAGRRGTAKSVMARAVHALLPPIEVVKGSIC  72

Query  472  NADPTCPEEWEDGLADRVE------YDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
              DP     W+D L   +E       D     +TEII +PFVQ+PLGVTEDRL+GSVDV 
Sbjct  73   QGDPEDTSAWDDDLLASLEAGAIPIVDGQPQPETEIIPTPFVQVPLGVTEDRLLGSVDVS  132

Query  634  ESVKSGTTVFQPGLLA  681
            +SVK G TVFQPGLLA
Sbjct  133  QSVKLGETVFQPGLLA  148



>ref|WP_010871417.1| magnesium-chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 ref|NP_440107.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 sp|P72772.1|CHLD_SYNY3 RecName: Full=Magnesium-chelatase subunit ChlD; Short=Mg-chelatase 
subunit D; AltName: Full=Mg-protoporphyrin IX chelatase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA16787.1| Mg chelatase subunit; ChlD [Synechocystis sp. PCC 6803]
 dbj|BAK48959.1| Mg chelatase subunit [Synechocystis sp. PCC 6803]
 dbj|BAL27958.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL31128.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL34297.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM50493.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 gb|AGF50476.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
Length=676

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FP+ A+VGQ+AIK ALLLGAID  +GGI I+G+RGTAK+VMAR +H +LPPIEI+KG+  
Sbjct  12   FPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLLPPIEIIKGNRY  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
              DP  P  W+D   ++        ++T++I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  72   QCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG  131

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  132  EAVFQPGLLA  141



>emb|CAA65418.1| magnesium chelatase [Synechocystis sp. PCC 6803]
Length=676

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FP+ A+VGQ+AIK ALLLGAID  +GGI I+G+RGTAK+VMAR +H +LPPIEI+KG+  
Sbjct  12   FPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLLPPIEIIKGNRY  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
              DP  P  W+D   ++        ++T++I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  72   QCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG  131

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  132  EAVFQPGLLA  141



>ref|WP_010478137.1| magnesium-chelatase subunit ChlD [Acaryochloris sp. CCMEE 5410]
Length=682

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 103/139 (74%), Gaps = 12/139 (9%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VK SI 
Sbjct  13   FPLTAVVGQEAIKLALLLTAVDPTLGGVVIAGRRGTAKSVMARAVHALLPPIEVVKDSIC  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNI---------KTEIIKSPFVQIPLGVTEDRLIGSV  624
              DP     W+D L   +E   AG+I         KTEII +PFVQ+PLGVTEDRL+GSV
Sbjct  73   QGDPEDTSAWDDDLLASLE---AGDIPIVDGRPQPKTEIIPTPFVQVPLGVTEDRLLGSV  129

Query  625  DVEESVKSGTTVFQPGLLA  681
            DV +SVK G TVFQPGLLA
Sbjct  130  DVSQSVKLGETVFQPGLLA  148



>ref|WP_006456157.1| magnesium-chelatase subunit ChlD [Synechococcus sp. PCC 7335]
 gb|EDX86391.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7335]
Length=680

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQD+IK ALLL A+D  +GG+ I+G+RGTAK+V+AR L+ +LPPIEI++GS  
Sbjct  13   FPLMAVVGQDSIKFALLLCAVDPGLGGVVIAGRRGTAKSVLARALYQLLPPIEIIQGS-C  71

Query  472  NADPTCPEEWEDGLADRVEYDSA-GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N DPT P+EW+D  A R   D+    + T++IK+PF+QIPLGVTEDRL+GSVDV +S++ 
Sbjct  72   NCDPTNPKEWDDETAGRFAADTPFDELPTQVIKAPFIQIPLGVTEDRLLGSVDVAKSIRL  131

Query  649  GTTVFQPGLLA  681
            G +VFQPGLLA
Sbjct  132  GESVFQPGLLA  142



>ref|WP_040945156.1| magnesium chelatase [Prochloron didemni]
Length=664

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMA+ +H++LPPIE++KG+  
Sbjct  6    FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMAKAIHSLLPPIEVIKGNFC  65

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE W+D  A   E+    ++ TE+I +PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  66   NCDPLSPETWDDLTA--AEWHGVEDLPTEVIPTPFVQIPLGVTEDRLLGSVDVEESVKRG  123

Query  652  TTVFQPGLLA  681
             +VFQPGLLA
Sbjct  124  ESVFQPGLLA  133



>ref|WP_013192842.1| magnesium-chelatase subunit ChlD [Trichormus azollae]
 gb|ADI65832.1| magnesium chelatase ATPase subunit D ['Nostoc azollae' 0708]
Length=668

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+V+GS+S
Sbjct  13   FPLTAVVGQEAIKIALLLAAVDPALGGVIIAGRRGTAKSVMARAIHALLPPIEVVQGSVS  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   PEEW+D L      +    I+ EII +PFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct  73   NCDSNHPEEWDDKLL----AEERHEIEREIIPAPFVQIPLGVTEDRLLGSVDVEQSVKQG  128

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  129  DTVFQPGLLA  138



>ref|WP_008232821.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
 emb|CCH66879.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis 
HH01]
Length=675

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            +  T+A     FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +++++
Sbjct  2    STSTSAQNIANFPLTAVVGQEAIKLALLLAAVDPELGGVVIAGRRGTAKSVMARAIYSLI  61

Query  439  PPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            PPIE+V GS SN DP   +EW+D L  R  Y++A ++  EII +PF+QIPLGVTEDRL+G
Sbjct  62   PPIEVVSGSFSNCDPYNSQEWDDELLSR--YETAIDVPKEIIPAPFIQIPLGVTEDRLLG  119

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVE+SV+ G T+FQPGLLA
Sbjct  120  SVDVEKSVRQGETIFQPGLLA  140



>ref|WP_017289571.1| magnesium-chelatase subunit ChlD [Leptolyngbya boryana]
Length=678

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+V+ SIS
Sbjct  12   FPLAAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEVVQDSIS  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N +P    EW+D   ++  Y S   + TEII++PFVQIPLGVTEDRL+GSVDV +S+K G
Sbjct  72   NCEPNAISEWDDLTLEK--YGSTEEVPTEIIRAPFVQIPLGVTEDRLLGSVDVSQSIKQG  129

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  130  ETVFQPGLLA  139



>ref|WP_017327748.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=673

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FP+ AVVGQ AIKTALLL A D  +GG+AI+G+RGTAK+++ARG+H +LPPIEIVKGS  
Sbjct  11   FPITAVVGQAAIKTALLLAAADPGLGGVAIAGRRGTAKSILARGIHDLLPPIEIVKGSPC  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PE W D   ++   D     +TE++ +PF+QIPLGVTEDRL+GSVDV +SVK+G
Sbjct  71   NDDPRHPETWSDWAKEQYP-DPTVFPETEVVPAPFIQIPLGVTEDRLLGSVDVSKSVKTG  129

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  130  ETVFQPGLLA  139



>gb|AFZ18337.1| protoporphyrin IX magnesium-chelatase [Microcoleus sp. PCC 7113]
Length=692

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 105/138 (76%), Gaps = 8/138 (6%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LHA+LPPIE+VK SI 
Sbjct  23   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHALLPPIEVVKDSIC  82

Query  472  NADPTCPEEWEDGLADRVEYDSAG--------NIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            N +P+ P EW+D L  +      G         + TEII +PFVQIPLGVTEDRL+GSVD
Sbjct  83   NCNPSYPNEWDDYLLAQYLSGKDGTTPISTIAELPTEIIPAPFVQIPLGVTEDRLLGSVD  142

Query  628  VEESVKSGTTVFQPGLLA  681
            VE+SVK G TVFQPGLLA
Sbjct  143  VEQSVKQGETVFQPGLLA  160



>ref|WP_041780025.1| magnesium chelatase [Microcoleus sp. PCC 7113]
Length=682

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 105/138 (76%), Gaps = 8/138 (6%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LHA+LPPIE+VK SI 
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHALLPPIEVVKDSIC  72

Query  472  NADPTCPEEWEDGLADRVEYDSAG--------NIKTEIIKSPFVQIPLGVTEDRLIGSVD  627
            N +P+ P EW+D L  +      G         + TEII +PFVQIPLGVTEDRL+GSVD
Sbjct  73   NCNPSYPNEWDDYLLAQYLSGKDGTTPISTIAELPTEIIPAPFVQIPLGVTEDRLLGSVD  132

Query  628  VEESVKSGTTVFQPGLLA  681
            VE+SVK G TVFQPGLLA
Sbjct  133  VEQSVKQGETVFQPGLLA  150



>ref|WP_012596729.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 8801]
 gb|ACK67470.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 8801]
Length=673

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL  +D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE +  +  
Sbjct  13   FPLTAVVGQEAIKLALLLAGVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIANNPF  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   +  E     +I TEII +PFVQIP+GVTEDRL+GSVDVEESVK G
Sbjct  73   NCDRNKPSEWDDNTQEEYESIRLEDIPTEIIPAPFVQIPIGVTEDRLLGSVDVEESVKRG  132

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  133  EAVFQPGLLA  142



>ref|WP_015784261.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 8802]
 gb|ACV01473.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 8802]
Length=673

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL  +D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE +  +  
Sbjct  13   FPLTAVVGQEAIKLALLLAGVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIANNPF  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   +  E     +I TEII +PFVQIP+GVTEDRL+GSVDVEESVK G
Sbjct  73   NCDRNKPSEWDDNTQEEYESIRLEDIPTEIIPAPFVQIPIGVTEDRLLGSVDVEESVKRG  132

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  133  EAVFQPGLLA  142



>ref|WP_008227854.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
 emb|CCH65289.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis 
HM01]
Length=673

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            +  T+A     FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +++++
Sbjct  2    STSTSAQNIANFPLTAVVGQEAIKLALLLAAVDPELGGVVIAGRRGTAKSVMARAIYSLI  61

Query  439  PPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            PPIE+V GS SN DP   +EW+D L  R  Y++  ++  EII +PF+QIPLGVTEDRL+G
Sbjct  62   PPIEVVSGSFSNCDPCNSQEWDDELLSR--YETTIDVPKEIIPAPFIQIPLGVTEDRLLG  119

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVE+SV+ G T+FQPGLLA
Sbjct  120  SVDVEKSVRQGETIFQPGLLA  140



>ref|WP_008309117.1| magnesium chelatase ATPase subunit D [Leptolyngbya sp. PCC 6406]
Length=685

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVV QDAIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LH +LPPIE+V GS  
Sbjct  13   FPLTAVVDQDAIKMALLLAAVDPRLGGVVIAGRRGTAKSVMARALHQLLPPIEVVVGSCC  72

Query  472  NADPTCPEEWEDGLADRVEYD-----SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEE  636
            NADP+ P  W+D    R E       +  ++ T++I +PF+QIPLGVTEDRL+GSVDV  
Sbjct  73   NADPSTPRHWDDETLGRFEGQIQADGTVPDLPTQVIPAPFIQIPLGVTEDRLLGSVDVAR  132

Query  637  SVKSGTTVFQPGLLA  681
            S+++G  VFQPGLLA
Sbjct  133  SIQTGDAVFQPGLLA  147



>ref|WP_015194081.1| protoporphyrin IX magnesium-chelatase [Stanieria cyanosphaera]
 gb|AFZ36414.1| protoporphyrin IX magnesium-chelatase [Stanieria cyanosphaera 
PCC 7437]
Length=672

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +1

Query  259  AADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVL  438
            +A TTA     FPL A++GQ+AIK ALLL AID  +GG+AI+G+RGTAK+VMARG+H++L
Sbjct  2    SALTTAPVNINFPLTAIIGQEAIKLALLLAAIDPELGGVAIAGRRGTAKSVMARGIHSLL  61

Query  439  PPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIG  618
            PPIEI+KGS+ N DP+ P EW+D   +     +   I TE+I +PFVQIPLGVTEDRL+G
Sbjct  62   PPIEIIKGSLYNCDPSKPREWDDDTIELYGNSNLAEISTEVIPAPFVQIPLGVTEDRLLG  121

Query  619  SVDVEESVKSGTTVFQPGLLA  681
            SVDVEESVK G  VFQPGLLA
Sbjct  122  SVDVEESVKQGEAVFQPGLLA  142



>ref|WP_017297332.1| hypothetical protein [Nodosilinea nodulosa]
Length=681

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVV Q AIK ALLL A+D ++GG  I+G+RGTAK+VMAR LH +LPPIE+++GS  
Sbjct  13   FPLAAVVEQGAIKMALLLAAVDPSLGGAVIAGRRGTAKSVMARALHQLLPPIEVIEGSCC  72

Query  472  NADPTCPEEWEDGLADRV--EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            NADP  P  W+D   DR    +D A ++ T +I +PF+QIPLGVTEDRL+GSVDV  S++
Sbjct  73   NADPAAPPLWDDQTRDRFGDSFDVA-DLPTRVIPAPFIQIPLGVTEDRLLGSVDVARSIQ  131

Query  646  SGTTVFQPGLLA  681
            +G +VFQPGLLA
Sbjct  132  AGESVFQPGLLA  143



>ref|WP_035984823.1| magnesium chelatase [Leptolyngbya sp. KIOST-1]
Length=690

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 17/147 (12%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAA+VGQDAIK+ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPPIE+V+GS  
Sbjct  11   FPLAAIVGQDAIKSALLLLAVDPGLGGVIIAGRRGTAKSVMARALHALLPPIEVVQGSRW  70

Query  472  NADPTCPEEWEDGLADRVEYDSAG-----------------NIKTEIIKSPFVQIPLGVT  600
            NADPT P++WED    R +   A                     T +I +PF+Q+PLGVT
Sbjct  71   NADPTNPDDWEDRGGIRSQELGASPKARPPSHPSTPSLPTPPFPTRLIPTPFIQVPLGVT  130

Query  601  EDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EDRL+GSVDV +S+K G  VFQPGLLA
Sbjct  131  EDRLLGSVDVTQSIKRGEPVFQPGLLA  157



>ref|WP_028947660.1| magnesium chelatase [Synechocystis sp. PCC 6714]
 gb|AIE74923.1| Protoporphyrin IX Mg-chelatase subunit D [Synechocystis sp. PCC 
6714]
Length=676

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FP+ A+VGQ+AIK ALLLGAID  +GGI I+G+RGTAK+VMAR +H +LPPIEI+KG+  
Sbjct  12   FPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLLPPIEIIKGNRY  71

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
              D   P  W+D   ++        ++T++I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct  72   QCDLKNPGSWDDDTLEKFANVPLEQLETQVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG  131

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  132  EAVFQPGLLA  141



>ref|WP_026099665.1| magnesium chelatase [Prochlorothrix hollandica]
Length=675

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL+AVVGQD+IK AL+L AID  +GG+ I+G+RGTAK+VMAR LH++LPPIEI+  S+ 
Sbjct  11   FPLSAVVGQDSIKLALILAAIDPGLGGVVIAGRRGTAKSVMARALHSLLPPIEIISQSL-  69

Query  472  NADPTCPEEWEDGLADRVEYDS-AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS  648
            N+DP  P +W+D   +R++  +   ++ T++I +PFVQ+PLG TEDRL+GSVDV +S+K 
Sbjct  70   NSDPQNPRQWDDETLERLDPATPLEDLPTQVIAAPFVQLPLGTTEDRLLGSVDVTQSMKR  129

Query  649  GTTVFQPGLLA  681
            G T+FQPGLLA
Sbjct  130  GETIFQPGLLA  140



>ref|WP_006529845.1| magnesium chelatase ATPase subunit D [Gloeocapsa sp. PCC 73106]
 gb|ELR97268.1| magnesium chelatase ATPase subunit D [Gloeocapsa sp. PCC 73106]
Length=657

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 13/133 (10%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            R  FPLAA+VGQ+AIK ALLL AID N+GG+AI+G+RGTAK+VMAR +HA++PPIEI+K 
Sbjct  10   RLSFPLAAIVGQEAIKLALLLIAIDPNLGGVAIAGRRGTAKSVMARAVHALVPPIEIIKD  69

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            +I N DP             + Y     +++EII +PFVQIPLGVTEDRL+GSVDVE S+
Sbjct  70   NIFNCDP-------------LSYPEDKTLQSEIIPAPFVQIPLGVTEDRLLGSVDVEASI  116

Query  643  KSGTTVFQPGLLA  681
            K G  VFQPGLLA
Sbjct  117  KEGNAVFQPGLLA  129



>ref|WP_006517412.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7375]
 gb|EKV03041.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7375]
Length=682

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%), Gaps = 4/134 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQDAIK ALLL A+D  +GG+ I+G+RGTAK+V+ARGLH +LPPIEI+ GS +
Sbjct  11   FPLMAVVGQDAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGLHQLLPPIEIIDGSYA  70

Query  472  NADPTCPEEWEDG----LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            NADPT   EW+D       DR +     ++ T++I +PF+QIPLGVTEDRL+GSVDV +S
Sbjct  71   NADPTNMREWDDATVERFGDREDPKDLDDLPTKVIPAPFIQIPLGVTEDRLLGSVDVAKS  130

Query  640  VKSGTTVFQPGLLA  681
            +++G +VFQPGLLA
Sbjct  131  IQTGESVFQPGLLA  144



>ref|WP_008051164.1| magnesium-chelatase subunit ChlD [Arthrospira sp. PCC 8005]
 emb|CCE16838.1| Magnesium-chelatase 60 kDa subunit (Mg-protoporphyrin IX chelatase) 
(Mg-chelatase subunit D) [Arthrospira sp. PCC 8005]
 emb|CDM96359.1| Magnesium-chelatase 60 kDa subunit (Mg-protoporphyrin IX chelatase) 
(Mg-chelatase subunit D) [Arthrospira sp. PCC 8005]
Length=664

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKDAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N     P  WE G             +TEII +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   N----IPPNWEAG---------EPTPETEIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>ref|WP_006624555.1| magnesium-chelatase subunit ChlD [Arthrospira platensis]
 gb|EKD07397.1| magnesium chelatase ATPase subunit D [Arthrospira platensis C1]
Length=662

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKDAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N     P  WE G             +TEII +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   N----IPPNWEAG---------EPTPETEIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>ref|WP_014275943.1| magnesium chelatase subunit D [Arthrospira platensis]
 dbj|BAI91458.1| magnesium chelatase subunit D [Arthrospira platensis NIES-39]
Length=663

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKNAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N  P     WE G             +TEII +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   NIAPN----WEAG---------EPTPETEIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>gb|ABF61893.1| magnesium chelatase D subunit [Arthrospira platensis]
Length=627

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKNAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N  P     WE G             +TEII +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   NIAPN----WEAG---------EPTPETEIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>ref|WP_035735687.1| magnesium chelatase [Arthrospira platensis]
 gb|KDR58513.1| magnesium chelatase [Arthrospira platensis str. Paraca]
Length=663

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKNAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N  P     WE G             +TEII +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   NIAPN----WEAG---------EPTPETEIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>ref|WP_009555513.1| Mg-chelatase subunit ChlI [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70935.1| Mg-chelatase subunit ChlI [Oscillatoriales cyanobacterium JSC-12]
Length=718

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL AID  +GG+ I+G+RGTAK+VMAR +HA+LPPIEIVKGS+ 
Sbjct  12   FPLAAVVGQEAIKLALLLAAIDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEIVKGSL-  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  PEEW+D    R E      ++TE+I +PFVQ+PLGVTEDRL+GSVDV  S+K G
Sbjct  71   NCDPNLPEEWDDETVKRFEEKGEFVVETEVIPAPFVQVPLGVTEDRLLGSVDVSLSIKKG  130

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  131  ETVFQPGLLA  140



>ref|XP_006446211.1| hypothetical protein CICLE_v100143611mg, partial [Citrus clementina]
 gb|ESR59451.1| hypothetical protein CICLE_v100143611mg, partial [Citrus clementina]
Length=160

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 87/112 (78%), Gaps = 12/112 (11%)
 Frame = +1

Query  184  RRPHRLRFRINAS--------ANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTAL  339
            R  H   F + AS        ANG+V AA +    D  +YGRQ+FPLAAVVGQDAIKTAL
Sbjct  53   RAKHHRFFHVRASSSNATLDSANGAVAAASE----DQDSYGRQFFPLAAVVGQDAIKTAL  108

Query  340  LLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPE  495
            LLGAIDR IGGIAISG+RGTAKTVMARGLHA+LPPIE+V GSI+NADPTCP+
Sbjct  109  LLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPD  160



>ref|WP_015124174.1| protoporphyrin IX magnesium-chelatase [Synechococcus sp. PCC 
6312]
 gb|AFY60630.1| protoporphyrin IX magnesium-chelatase [Synechococcus sp. PCC 
6312]
Length=668

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 7/134 (5%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +HA+LPPIEIVKGS+S
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVMARAIHALLPPIEIVKGSLS  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIK----TEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            N DP  P  W+  L ++++   AG I+    TE+I +PF+QIPLG+TEDRLIG+VDV +S
Sbjct  71   NCDPANPGAWDKRLIEQIQ---AGEIESPPPTEVIPAPFIQIPLGITEDRLIGAVDVSQS  127

Query  640  VKSGTTVFQPGLLA  681
            V+ G  +FQPGLLA
Sbjct  128  VQKGEAIFQPGLLA  141



>ref|WP_009631867.1| magnesium chelatase ATPase subunit D [Synechocystis sp. PCC 7509]
Length=651

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 17/130 (13%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GGIAI+G+RGTAK+VMAR LHA+LPPIE+VKGSI 
Sbjct  9    FPLTAVVGQEAIKLALLLVAVDPGLGGIAIAGRRGTAKSVMARALHALLPPIEVVKGSIF  68

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N                 E     N+ T+II +PF+QIPLG+TEDRL+GSVDVE+SVK+G
Sbjct  69   N-----------------EETGIDNVDTQIIPAPFIQIPLGITEDRLLGSVDVEQSVKTG  111

Query  652  TTVFQPGLLA  681
             +VFQPG+LA
Sbjct  112  ESVFQPGILA  121



>ref|WP_006670731.1| magnesium-chelatase subunit ChlD [Arthrospira maxima]
 gb|EDZ91982.1| magnesium chelatase ATPase subunit D [Arthrospira maxima CS-328]
Length=662

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 98/130 (75%), Gaps = 13/130 (10%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAAVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E+VK +I+
Sbjct  13   FPLAAVVGQEAIKFALLLAAVDPGLGGVVIAGRRGTAKSVMARALHALLPPLEVVKDAIA  72

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N     P  WE G             +T II +PFVQ+PLGVTEDRLIGSVDVE+SVK G
Sbjct  73   N----IPPNWEAG---------EPTPETAIIPAPFVQVPLGVTEDRLIGSVDVEKSVKQG  119

Query  652  TTVFQPGLLA  681
             TVFQPGLLA
Sbjct  120  DTVFQPGLLA  129



>ref|WP_004160664.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI13193.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9806]
Length=665

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P+EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNSPDEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_002768301.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI02673.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9443]
Length=666

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P+EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNPDEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_017315498.1| magnesium-chelatase subunit ChlD [Mastigocladopsis repens]
Length=702

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 110/155 (71%), Gaps = 25/155 (16%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AISG+RGTAK+VMAR +HA+LPPIE+VKGSIS
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPALGGVAISGRRGTAKSVMARAIHAILPPIEVVKGSIS  72

Query  472  NADPTCPEEWED------GLADRVEYDSAG-------------------NIKTEIIKSPF  576
            N DP  PEEW+D      G A  +  +  G                    ++TEII +PF
Sbjct  73   NCDPNHPEEWDDKLVALGGQASCLSLEEGGLDAPKFLSKETSAGTSLHPTVETEIIFAPF  132

Query  577  VQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA  681
            VQIPLGVTEDRL+GSVDVE+SVK G T+FQPGLLA
Sbjct  133  VQIPLGVTEDRLLGSVDVEQSVKQGDTIFQPGLLA  167



>ref|WP_004161459.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI17321.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9807]
Length=665

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P+EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNPDEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>emb|CCQ67555.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0402]
Length=327

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  71   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  131  EAIFQPGLLA  140



>ref|WP_022609398.1| magnesium chelatase ATPase subunit D [Rubidibacter lacunae]
 gb|ERN39788.1| magnesium chelatase ATPase subunit D [Rubidibacter lacunae KORDI 
51-2]
Length=672

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  283  RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG  462
            R  FPL A+VGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR + ++LPPIE+V G
Sbjct  7    RPTFPLTAIVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAVRSLLPPIEVVAG  66

Query  463  SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV  642
            S++N DP  P+ W+D    R     + ++ T +I +PF+Q+PLGVTEDRL+GSVDVE+S+
Sbjct  67   SLANCDPKSPDTWDDDTGSRWGDRPSADVPTAVIPAPFIQVPLGVTEDRLLGSVDVEQSM  126

Query  643  KSGTTVFQPGLLA  681
            + G  VFQPGLLA
Sbjct  127  RRGEPVFQPGLLA  139



>ref|WP_024970736.1| magnesium chelatase [Microcystis aeruginosa]
Length=665

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP  P+EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNPDEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKRG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_023075338.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA33815.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
Length=674

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 97/140 (69%), Gaps = 10/140 (7%)
 Frame = +1

Query  286  QYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGS  465
            Q FPL A+V Q+ IK ALLL A+D  +GG+ I+G+RGTAK+VMAR LHA+LPP+E++KG+
Sbjct  14   QAFPLTAIVNQEMIKLALLLIAVDPGLGGVIIAGRRGTAKSVMARALHALLPPMEVIKGT  73

Query  466  ISNADPTCPEEWEDGLADRVEYDSA--------GNIKTEIIKSPFVQIPLGVTEDRLIGS  621
              N DP  P EW+D    R  Y  A          I   +I  PF+Q+PLGVTEDRL+GS
Sbjct  74   CCNCDPAAPLEWDD--ETRYRYGGAPKSVAQDDHTIDRHMIPPPFIQVPLGVTEDRLLGS  131

Query  622  VDVEESVKSGTTVFQPGLLA  681
            VDV +S+  G +VFQPGLLA
Sbjct  132  VDVSQSITQGDSVFQPGLLA  151



>ref|WP_011057253.1| magnesium-chelatase subunit ChlD [Thermosynechococcus elongatus]
 ref|NP_682203.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
 dbj|BAC08965.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
Length=668

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGS--  465
            FP+ A+VGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE++     
Sbjct  8    FPITAIVGQEAIKLALLLAAVDPGLGGVIIAGRRGTAKSVLARGIHALLPPIEVIDQGEI  67

Query  466  ----ISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
                I+N DP CP+EW+  L    +    G +KT++I +PFVQIPLGVTEDRL+G+VDV 
Sbjct  68   PVPIIANPDPECPQEWDSRLQAWRQSHPHGELKTKVIPAPFVQIPLGVTEDRLLGAVDVS  127

Query  634  ESVKSGTTVFQPGLLA  681
            +SV+ G  VFQPGLLA
Sbjct  128  QSVQRGEAVFQPGLLA  143



>ref|WP_002761257.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCH98296.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9717]
Length=665

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_012267152.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 dbj|BAG04400.1| magnesium protoporphyrin IX chelatase subunit D [Microcystis 
aeruginosa NIES-843]
Length=665

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_004162637.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI28046.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9809]
Length=665

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>dbj|GAL95165.1| protoporphyrin IX Mg-chelatase subunit D [Microcystis aeruginosa 
NIES-44]
Length=665

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_002799821.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI34724.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9701]
Length=665

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_002792527.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI22341.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9808]
Length=665

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_021829762.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii]
 emb|CCQ49919.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 8502]
Length=682

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENTF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_002776007.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI06417.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
7941]
Length=665

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_016516746.1| Magnesium-chelatase 38 kDa subunit [Microcystis aeruginosa]
 gb|EPF18941.1| Magnesium-chelatase 38 kDa subunit [Microcystis aeruginosa SPC777]
Length=665

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_002744710.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa]
 gb|ELS47390.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa 
DIANCHI905]
Length=665

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_021832353.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii]
 emb|CCQ54207.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0005]
Length=565

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_002753131.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCH91758.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9432]
Length=665

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKRG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_008196613.1| magnesium-chelatase subunit ChlD [Microcystis sp. T1-4]
 emb|CCI30491.1| Magnesium-chelatase subunit ChlD [Microcystis sp. T1-4]
Length=665

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDHTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKRG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|WP_002736428.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa]
 gb|ELP53999.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa 
TAIHU98]
Length=666

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  8    FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  67

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  68   NCDPNNADEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  124

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  125  EPVFQPGLLA  134



>ref|XP_002178119.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50933.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=800

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 10/136 (7%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL+ +VGQD+IK ALLL AI+  +GG+ ISG +GT+K+VMAR LH +LPPIEI+K S  
Sbjct  97   FPLSMIVGQDSIKQALLLSAINNRMGGVVISGGKGTSKSVMARALHQLLPPIEILKDSAF  156

Query  472  NADPTCPEEWEDGLAD--RVEYDSAG----NIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            N DP    E E GL D  R E D+ G    + +TEII  PFVQ+PL V EDRLIGS D+E
Sbjct  157  NIDP----EGEFGLDDFTRTEIDNGGTPLADRETEIIPCPFVQVPLNVMEDRLIGSADLE  212

Query  634  ESVKSGTTVFQPGLLA  681
            ESVKSG TVF PGLLA
Sbjct  213  ESVKSGKTVFAPGLLA  228



>emb|CAO87035.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=704

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+VMAR +H++LPPIEI+ G++ 
Sbjct  47   FPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIEIIAGNVF  106

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N DP   +EW+D   +  EY S+G + TE+I++PFVQIPLGVTEDRL+GSVDVEESVK G
Sbjct  107  NCDPNNADEWDDRTKE--EY-SSGEVPTEVIRAPFVQIPLGVTEDRLLGSVDVEESVKQG  163

Query  652  TTVFQPGLLA  681
              VFQPGLLA
Sbjct  164  EPVFQPGLLA  173



>gb|ACJ13441.1| ChlD [Karlodinium veneficum]
Length=264

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 98/134 (73%), Gaps = 6/134 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPLAA+VGQ+A+KTALLL  ++  IGG+ ISG +G AK+VMAR +H ++PPIE+VKGS  
Sbjct  122  FPLAAIVGQEAVKTALLLAGVNPKIGGVIISGSKGVAKSVMARAIHKLMPPIEVVKGSPY  181

Query  472  NADPTCPEEWEDGLADRVEYDSAG----NIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            N DP+ P E +     R + D +G    +++T++I +PFVQ+PL V EDRLIGSVDV++S
Sbjct  182  NLDPSMPREIDS--ITRAQLDESGKTLADLETDVIPTPFVQMPLDVLEDRLIGSVDVQQS  239

Query  640  VKSGTTVFQPGLLA  681
             +    VF PGLLA
Sbjct  240  NEEWQPVFDPGLLA  253



>emb|CCQ62029.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0401]
Length=682

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_042712310.1| magnesium chelatase [Crocosphaera watsonii]
Length=672

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  71   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  131  EAIFQPGLLA  140



>gb|EHJ10536.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0003]
Length=682

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_035828596.1| magnesium chelatase [Crocosphaera watsonii]
Length=672

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  71   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  131  EAIFQPGLLA  140



>gb|EAM48772.1| Magnesium chelatase, ChlI subunit [Crocosphaera watsonii WH 8501]
Length=682

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEENPF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW+D   ++       +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRDKPSEWDDNTQEQYLNQRPEDITTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_023074366.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA34748.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
Length=681

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQDAIK ALLL AID  +GG+ I+G+RGTAK+V+ARGLH +LPPIE++ GS +
Sbjct  11   FPLMAVVGQDAIKLALLLAAIDPGLGGVVIAGRRGTAKSVLARGLHQLLPPIEVIDGSCA  70

Query  472  NADPTCPEEWEDGLADRV----EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES  639
            NADPT   EW+D   DR     E  +  ++ T++I +PF+QIPLGVTEDRL+GSVDV +S
Sbjct  71   NADPTNMREWDDATLDRFGNCGEPPNLDDLPTKVIPAPFIQIPLGVTEDRLLGSVDVAKS  130

Query  640  VKSGTTVFQPGLLA  681
            +++G +VFQPGLLA
Sbjct  131  IQTGESVFQPGLLA  144



>gb|EGK88663.1| LOW QUALITY PROTEIN: Magnesium chelatase [Microcoleus vaginatus 
FGP-2]
Length=704

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 105/136 (77%), Gaps = 6/136 (4%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR LH++LPPIEIVK S  
Sbjct  13   FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARALHSLLPPIEIVKDSFC  72

Query  472  NADPT--CPEEWEDGLADRVEYDS----AGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE  633
            NA+P     E+    LA+    D+    + ++ TEII +PF+QIPLGVTEDRL+GSVDVE
Sbjct  73   NAEPNEILAEQASGLLAENGGQDAHTTDSNSLTTEIIPTPFIQIPLGVTEDRLLGSVDVE  132

Query  634  ESVKSGTTVFQPGLLA  681
            +SVK G TVFQPGLLA
Sbjct  133  QSVKFGQTVFQPGLLA  148



>ref|XP_009032566.1| hypothetical protein AURANDRAFT_58588 [Aureococcus anophagefferens]
 gb|EGB12949.1| hypothetical protein AURANDRAFT_58588 [Aureococcus anophagefferens]
Length=696

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +1

Query  307  VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPT  486
            VVGQ++IKTALLL A++R++GG+ ISG RGTAK+VMAR LH++LPPIE VK S  N DP 
Sbjct  2    VVGQESIKTALLLAAVNRDMGGVLISGGRGTAKSVMARALHSLLPPIEKVKDSQYNVDPE  61

Query  487  CPEEWEDGLADRVEYDSAGNI-------KTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
             P E +  L  ++E D  G++       +TE++++PFVQIPL V +D L+GS+DVE+SVK
Sbjct  62   MPTEMDSLLRKQLE-DQGGSVAENLLALETEVVRAPFVQIPLNVMDDMLLGSIDVEQSVK  120

Query  646  SGTTVFQPGLLA  681
             G +VFQPGLLA
Sbjct  121  EGKSVFQPGLLA  132



>ref|WP_008278652.1| magnesium-chelatase subunit ChlD [Cyanothece sp. CCY0110]
 gb|EAZ88275.1| Mg chelatase subunit; ChlD [Cyanothece sp. CCY0110]
Length=672

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEDNPF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW++   ++     + +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  71   NCDRNKPSEWDNNTQEQYLNTPSQDIPTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  131  EAIFQPGLLA  140



>gb|ACB50424.1| magnesium chelatase, ATPase subunit D [Cyanothece sp. ATCC 51142]
Length=682

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  21   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEDNPF  80

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW++   ++     + +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  81   NCDRNKPSEWDNNTQEQYLNTPSQDIPTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  140

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  141  EAIFQPGLLA  150



>ref|WP_024750240.1| MULTISPECIES: magnesium chelatase [Cyanothece]
Length=672

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE ++ +  
Sbjct  11   FPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVLARGIHALLPPIERIEDNPF  70

Query  472  NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG  651
            N D   P EW++   ++     + +I TEI+ +PF+Q+P+GVTEDRL+GSVDVEESVK G
Sbjct  71   NCDRNKPSEWDNNTQEQYLNTPSQDIPTEIVPAPFIQVPIGVTEDRLLGSVDVEESVKQG  130

Query  652  TTVFQPGLLA  681
              +FQPGLLA
Sbjct  131  EAIFQPGLLA  140



>ref|WP_039782182.1| magnesium chelatase [Acaryochloris sp. CCMEE 5410]
Length=670

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 8/147 (5%)
 Frame = +1

Query  250  QKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLH  429
            Q+P+   T      FPL A+ GQ+AIK ALLL A+D ++GGI ISG+RGTAK+VMAR +H
Sbjct  5    QEPSTSITT-----FPLTAISGQNAIKLALLLAAVDPSLGGIIISGRRGTAKSVMARAIH  59

Query  430  AVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD---SAGNIKTEIIKSPFVQIPLGVT  600
             +LPPI +++GS  N DP  PEEW+D    R         G + T +I +PFVQ+PLGVT
Sbjct  60   DLLPPITVIQGSCCNCDPQHPEEWDDQTLRRAHAAKDVQNGRLPTAVIPTPFVQVPLGVT  119

Query  601  EDRLIGSVDVEESVKSGTTVFQPGLLA  681
            EDRL+GSVDV +S++ G  VFQPGL+A
Sbjct  120  EDRLLGSVDVSQSIRKGEPVFQPGLMA  146



>ref|XP_006843427.1| hypothetical protein AMTR_s00053p00151810 [Amborella trichopoda]
 gb|ERN05102.1| hypothetical protein AMTR_s00053p00151810 [Amborella trichopoda]
Length=148

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  265  DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPP  444
            +T +YGR YFPLAAVVGQDAIKTALLLGA+DR IGGIAISGKRGTAKTVMARGLH++LPP
Sbjct  71   ETVSYGRLYFPLAAVVGQDAIKTALLLGAVDREIGGIAISGKRGTAKTVMARGLHSILPP  130

Query  445  IEIVKGSISNADPTCPEE  498
            IE+V  SI+NADP CPEE
Sbjct  131  IEVVVESIANADPMCPEE  148



>ref|WP_035996666.1| magnesium chelatase [Leptolyngbya sp. JSC-1]
Length=680

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +1

Query  292  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS  471
            FPL AVVGQ+AIK ALLL AID  +GG+ I+G+RGTAK+VMAR +HA+LPPIE+VKGS  
Sbjct  13   FPLTAVVGQEAIKLALLLAAIDPALGGVVIAGRRGTAKSVMARAIHALLPPIEVVKGSCC  72

Query  472  NADPTCPEEWEDGLADRV--EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK  645
            N DPT P EW++    R   E + +G + TEII +PF+Q+PLGVTEDRL+GSVDV +S+K
Sbjct  73   NCDPTQPNEWDNETIARFASELNFSG-LPTEIIPAPFIQVPLGVTEDRLLGSVDVAQSIK  131

Query  646  SGTTVFQPGLLA  681
             G TVFQPGLLA
Sbjct  132  RGETVFQPGLLA  143



Lambda      K        H        a         alpha
   0.317    0.134    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340