BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022H18

Length=652
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007014163.1|  Calmodulin-binding protein isoform 4               350   2e-113   
ref|XP_007014160.1|  Calmodulin-binding protein isoform 1               350   2e-113   
ref|XP_002526232.1|  calmodulin binding protein, putative               342   1e-112   
gb|KDO62473.1|  hypothetical protein CISIN_1g006542mg                   337   2e-111   Citrus sinensis [apfelsine]
gb|KDO62472.1|  hypothetical protein CISIN_1g006542mg                   338   4e-111   Citrus sinensis [apfelsine]
ref|XP_011079310.1|  PREDICTED: uncharacterized protein LOC105162855    343   8e-111   Sesamum indicum [beniseed]
gb|KHG10046.1|  Protein very KIND                                       342   3e-110   Gossypium arboreum [tree cotton]
gb|KDO62470.1|  hypothetical protein CISIN_1g006542mg                   339   3e-109   Citrus sinensis [apfelsine]
ref|XP_006453423.1|  hypothetical protein CICLE_v10007720mg             338   4e-109   
gb|KDO62471.1|  hypothetical protein CISIN_1g006542mg                   338   4e-109   Citrus sinensis [apfelsine]
gb|KJB22129.1|  hypothetical protein B456_004G031000                    338   8e-109   Gossypium raimondii
gb|KDO75736.1|  hypothetical protein CISIN_1g006875mg                   330   4e-108   Citrus sinensis [apfelsine]
gb|KDP22927.1|  hypothetical protein JCGZ_01764                         336   4e-108   Jatropha curcas
ref|XP_010103014.1|  hypothetical protein L484_022898                   334   2e-107   Morus notabilis
ref|XP_006366189.1|  PREDICTED: uncharacterized protein LOC102581064    333   3e-107   
gb|KDO75731.1|  hypothetical protein CISIN_1g006875mg                   330   3e-106   Citrus sinensis [apfelsine]
ref|XP_006467892.1|  PREDICTED: uncharacterized protein LOC102626942    330   4e-106   Citrus sinensis [apfelsine]
ref|XP_010259794.1|  PREDICTED: uncharacterized protein LOC104599111    331   4e-106   
gb|EYU42432.1|  hypothetical protein MIMGU_mgv1a025463mg                330   7e-106   Erythranthe guttata [common monkey flower]
ref|XP_010092630.1|  hypothetical protein L484_006392                   330   9e-106   Morus notabilis
ref|XP_007025783.1|  Calmodulin-binding protein isoform 2               329   1e-105   
ref|XP_006449222.1|  hypothetical protein CICLE_v10014600mg             329   2e-105   Citrus clementina [clementine]
ref|XP_011001128.1|  PREDICTED: uncharacterized protein LOC105108501    328   3e-105   Populus euphratica
ref|XP_010688497.1|  PREDICTED: uncharacterized protein LOC104902420    327   8e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011043291.1|  PREDICTED: uncharacterized protein LOC105138...    325   1e-104   Populus euphratica
ref|XP_010265458.1|  PREDICTED: uncharacterized protein LOC104603...    327   2e-104   
ref|XP_010047006.1|  PREDICTED: uncharacterized protein LOC104435...    320   2e-104   
ref|XP_002316655.1|  calmodulin-binding protein 60-C                    326   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007225676.1|  hypothetical protein PRUPE_ppa002789mg             326   2e-104   Prunus persica
ref|XP_011043288.1|  PREDICTED: uncharacterized protein LOC105138...    326   3e-104   Populus euphratica
gb|EYU20919.1|  hypothetical protein MIMGU_mgv1a002870mg                325   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_011043289.1|  PREDICTED: uncharacterized protein LOC105138...    325   3e-104   Populus euphratica
gb|EYU20920.1|  hypothetical protein MIMGU_mgv1a002870mg                325   3e-104   Erythranthe guttata [common monkey flower]
gb|KHG27572.1|  Cytochrome P450                                         325   7e-104   Gossypium arboreum [tree cotton]
ref|XP_007025782.1|  Calmodulin-binding protein isoform 1               325   9e-104   
gb|KDO75730.1|  hypothetical protein CISIN_1g006875mg                   324   1e-103   Citrus sinensis [apfelsine]
ref|XP_006384008.1|  hypothetical protein POPTR_0004s03510g             324   1e-103   
ref|XP_004485707.1|  PREDICTED: uncharacterized protein LOC101498971    323   2e-103   Cicer arietinum [garbanzo]
gb|KJB83411.1|  hypothetical protein B456_013G246400                    323   3e-103   Gossypium raimondii
ref|XP_002524676.1|  calmodulin binding protein, putative               318   3e-103   
ref|XP_009376054.1|  PREDICTED: uncharacterized protein LOC103964...    322   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_010047003.1|  PREDICTED: uncharacterized protein LOC104435...    322   1e-102   Eucalyptus grandis [rose gum]
ref|XP_010646160.1|  PREDICTED: uncharacterized protein LOC100256775    321   2e-102   Vitis vinifera
emb|CAN66517.1|  hypothetical protein VITISV_001611                     321   2e-102   Vitis vinifera
emb|CBI23322.3|  unnamed protein product                                321   3e-102   Vitis vinifera
ref|XP_010265456.1|  PREDICTED: uncharacterized protein LOC104603...    321   3e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010536924.1|  PREDICTED: uncharacterized protein LOC104811802    321   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_007154785.1|  hypothetical protein PHAVU_003G147800g             320   3e-102   Phaseolus vulgaris [French bean]
ref|XP_010414641.1|  PREDICTED: uncharacterized protein LOC104700762    319   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008364144.1|  PREDICTED: uncharacterized protein LOC103427...    319   9e-102   
ref|XP_003549493.1|  PREDICTED: uncharacterized protein LOC100803...    319   9e-102   Glycine max [soybeans]
gb|KHN17575.1|  hypothetical protein glysoja_005772                     319   1e-101   Glycine soja [wild soybean]
ref|XP_011457401.1|  PREDICTED: uncharacterized protein LOC101314910    319   1e-101   Fragaria vesca subsp. vesca
gb|KEH36516.1|  calmodulin-binding protein                              318   2e-101   Medicago truncatula
ref|XP_004507834.1|  PREDICTED: uncharacterized protein LOC101488...    318   2e-101   
ref|XP_010489590.1|  PREDICTED: uncharacterized protein LOC104767243    318   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_004507832.1|  PREDICTED: uncharacterized protein LOC101488...    318   2e-101   Cicer arietinum [garbanzo]
ref|XP_004507831.1|  PREDICTED: uncharacterized protein LOC101488...    320   3e-101   Cicer arietinum [garbanzo]
ref|XP_007213593.1|  hypothetical protein PRUPE_ppa002740mg             318   5e-101   Prunus persica
gb|KHN22715.1|  hypothetical protein glysoja_027603                     317   5e-101   Glycine soja [wild soybean]
ref|XP_003542171.1|  PREDICTED: uncharacterized protein LOC100790...    317   5e-101   Glycine max [soybeans]
ref|XP_009375849.1|  PREDICTED: uncharacterized protein LOC103964...    318   5e-101   Pyrus x bretschneideri [bai li]
ref|XP_008383819.1|  PREDICTED: uncharacterized protein LOC103446473    317   6e-101   
ref|XP_010696620.1|  PREDICTED: uncharacterized protein LOC104909...    317   1e-100   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP02958.1|  unnamed protein product                                317   1e-100   Coffea canephora [robusta coffee]
emb|CDO99627.1|  unnamed protein product                                316   1e-100   Coffea canephora [robusta coffee]
ref|XP_011096210.1|  PREDICTED: uncharacterized protein LOC105175464    316   2e-100   Sesamum indicum [beniseed]
ref|XP_008224946.1|  PREDICTED: uncharacterized protein LOC103324...    316   2e-100   Prunus mume [ume]
ref|XP_004293506.1|  PREDICTED: uncharacterized protein LOC101308261    316   2e-100   Fragaria vesca subsp. vesca
ref|XP_006409114.1|  hypothetical protein EUTSA_v10022604mg             315   3e-100   Eutrema salsugineum [saltwater cress]
gb|AAD08944.2|  putative calmodulin-binding protein                     306   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270522.1|  PREDICTED: uncharacterized protein LOC100264...    315   4e-100   Vitis vinifera
ref|XP_008364142.1|  PREDICTED: uncharacterized protein LOC103427...    315   5e-100   Malus domestica [apple tree]
ref|XP_004146305.1|  PREDICTED: uncharacterized protein LOC101216741    315   7e-100   Cucumis sativus [cucumbers]
emb|CDY29246.1|  BnaA06g25110D                                          314   1e-99    Brassica napus [oilseed rape]
ref|XP_008453624.1|  PREDICTED: uncharacterized protein LOC103494282    314   1e-99    Cucumis melo [Oriental melon]
ref|XP_011044001.1|  PREDICTED: uncharacterized protein LOC105139309    314   1e-99    Populus euphratica
ref|XP_011018189.1|  PREDICTED: uncharacterized protein LOC105121292    314   1e-99    Populus euphratica
ref|XP_009150716.1|  PREDICTED: uncharacterized protein LOC103874061    313   1e-99    
ref|XP_010467708.1|  PREDICTED: uncharacterized protein LOC104747723    313   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_003610155.1|  Calmodulin-binding protein                         313   2e-99    Medicago truncatula
ref|XP_006297211.1|  hypothetical protein CARUB_v10013220mg             313   2e-99    Capsella rubella
ref|XP_010057559.1|  PREDICTED: uncharacterized protein LOC104445366    312   3e-99    Eucalyptus grandis [rose gum]
ref|XP_008224944.1|  PREDICTED: uncharacterized protein LOC103324...    312   7e-99    Prunus mume [ume]
ref|XP_004232807.1|  PREDICTED: uncharacterized protein LOC101255950    311   1e-98    Solanum lycopersicum
ref|XP_003608225.1|  Calmodulin-binding protein                         303   1e-98    
emb|CDY59605.1|  BnaC03g74590D                                          310   4e-98    Brassica napus [oilseed rape]
ref|XP_002316656.1|  calmodulin-binding protein 60-C                    309   5e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006347126.1|  PREDICTED: uncharacterized protein LOC102591443    309   7e-98    Solanum tuberosum [potatoes]
gb|EPS64102.1|  hypothetical protein M569_10679                         299   8e-98    Genlisea aurea
ref|NP_565441.2|  Calmodulin-binding protein                            308   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794879.1|  PREDICTED: uncharacterized protein LOC104241635    308   2e-97    Nicotiana sylvestris
ref|XP_002325070.1|  calmodulin-binding family protein                  307   9e-97    Populus trichocarpa [western balsam poplar]
ref|XP_009589610.1|  PREDICTED: uncharacterized protein LOC104086953    306   1e-96    Nicotiana tomentosiformis
ref|XP_010913644.1|  PREDICTED: uncharacterized protein LOC105039256    306   2e-96    Elaeis guineensis
gb|KJB68601.1|  hypothetical protein B456_010G254300                    305   2e-96    Gossypium raimondii
ref|XP_010696621.1|  PREDICTED: uncharacterized protein LOC104909...    305   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003608224.1|  Calmodulin-binding protein                         305   3e-96    Medicago truncatula
ref|XP_002886266.1|  calmodulin-binding protein                         304   4e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_004504984.1|  PREDICTED: uncharacterized protein LOC101509425    304   5e-96    Cicer arietinum [garbanzo]
gb|KHG24590.1|  eukaryotic translation initiation factor 3 subunit m    304   5e-96    Gossypium arboreum [tree cotton]
emb|CBI17793.3|  unnamed protein product                                304   6e-96    Vitis vinifera
ref|XP_009112562.1|  PREDICTED: uncharacterized protein LOC103837921    304   8e-96    Brassica rapa
ref|XP_010539448.1|  PREDICTED: uncharacterized protein LOC104813528    303   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_011043290.1|  PREDICTED: uncharacterized protein LOC105138...    302   3e-95    Populus euphratica
ref|XP_006401191.1|  hypothetical protein EUTSA_v10012939mg             303   3e-95    Eutrema salsugineum [saltwater cress]
ref|XP_009606927.1|  PREDICTED: uncharacterized protein LOC104101...    302   4e-95    Nicotiana tomentosiformis
emb|CDY30302.1|  BnaA09g09750D                                          301   9e-95    Brassica napus [oilseed rape]
ref|XP_007159256.1|  hypothetical protein PHAVU_002G222600g             300   2e-94    Phaseolus vulgaris [French bean]
ref|XP_009761691.1|  PREDICTED: uncharacterized protein LOC104213...    300   2e-94    Nicotiana sylvestris
gb|KJB57646.1|  hypothetical protein B456_009G173400                    300   3e-94    Gossypium raimondii
ref|XP_010929240.1|  PREDICTED: uncharacterized protein LOC105050...    300   3e-94    Elaeis guineensis
ref|XP_003545838.1|  PREDICTED: uncharacterized protein LOC100802...    300   3e-94    Glycine max [soybeans]
gb|KDP20890.1|  hypothetical protein JCGZ_21361                         299   4e-94    Jatropha curcas
ref|XP_009398635.1|  PREDICTED: uncharacterized protein LOC103983171    300   5e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004248098.1|  PREDICTED: uncharacterized protein LOC101268...    299   6e-94    Solanum lycopersicum
ref|XP_006281432.1|  hypothetical protein CARUB_v10027506mg             299   8e-94    Capsella rubella
ref|XP_007148242.1|  hypothetical protein PHAVU_006G191900g             298   2e-93    Phaseolus vulgaris [French bean]
ref|XP_010525739.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    297   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_006361013.1|  PREDICTED: uncharacterized protein LOC102605248    296   8e-93    Solanum tuberosum [potatoes]
ref|XP_010323248.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    296   9e-93    
ref|XP_002866219.1|  calmodulin-binding protein                         296   1e-92    
ref|XP_010443447.1|  PREDICTED: uncharacterized protein LOC104726314    296   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009394895.1|  PREDICTED: uncharacterized protein LOC103980282    295   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010452498.1|  PREDICTED: uncharacterized protein LOC104734591    295   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010929241.1|  PREDICTED: uncharacterized protein LOC105050...    294   5e-92    Elaeis guineensis
ref|XP_006845603.1|  hypothetical protein AMTR_s00019p00206980          293   1e-91    Amborella trichopoda
gb|KHN00110.1|  hypothetical protein glysoja_028638                     292   2e-91    Glycine soja [wild soybean]
ref|XP_009414724.1|  PREDICTED: uncharacterized protein LOC103995757    293   2e-91    
ref|XP_010483282.1|  PREDICTED: uncharacterized protein LOC104761843    293   3e-91    Camelina sativa [gold-of-pleasure]
ref|NP_200566.1|  Calmodulin-binding protein                            292   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808337.1|  PREDICTED: uncharacterized protein LOC103720426    292   3e-91    Phoenix dactylifera
ref|XP_010914125.1|  PREDICTED: uncharacterized protein LOC105039615    291   8e-91    Elaeis guineensis
emb|CDY69506.1|  BnaCnng63910D                                          291   1e-90    Brassica napus [oilseed rape]
ref|XP_009120276.1|  PREDICTED: uncharacterized protein LOC103845193    290   3e-90    Brassica rapa
emb|CDY49721.1|  BnaA10g11510D                                          290   3e-90    Brassica napus [oilseed rape]
ref|XP_002446536.1|  hypothetical protein SORBIDRAFT_06g017740          290   4e-90    Sorghum bicolor [broomcorn]
tpg|DAA37641.1|  TPA: hypothetical protein ZEAMMB73_949812              281   9e-90    
ref|NP_194310.3|  Calmodulin-binding protein                            286   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975725.1|  PREDICTED: uncharacterized protein LOC101760...    287   4e-89    Setaria italica
ref|XP_004975724.1|  PREDICTED: uncharacterized protein LOC101760...    287   4e-89    Setaria italica
emb|CDY02746.1|  BnaC02g11430D                                          286   4e-89    
ref|XP_002869655.1|  calmodulin-binding protein                         285   7e-89    
ref|NP_001046071.1|  Os02g0177800                                       285   1e-88    
ref|XP_010448367.1|  PREDICTED: uncharacterized protein LOC104730...    285   2e-88    Camelina sativa [gold-of-pleasure]
gb|EEC72606.1|  hypothetical protein OsI_06079                          285   3e-88    Oryza sativa Indica Group [Indian rice]
dbj|BAK04468.1|  predicted protein                                      284   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96828.1|  predicted protein                                      284   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ30858.1|  hypothetical protein OsJ_14930                          282   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130446.1|  uncharacterized protein LOC100191543               278   1e-87    
ref|NP_001052891.1|  Os04g0444200                                       283   2e-87    
gb|EAY94271.1|  hypothetical protein OsI_16040                          282   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_003570530.1|  PREDICTED: uncharacterized protein LOC100822237    281   3e-87    Brachypodium distachyon [annual false brome]
ref|XP_008667039.1|  PREDICTED: uncharacterized protein LOC100191...    282   4e-87    
ref|XP_008667040.1|  PREDICTED: uncharacterized protein LOC100191...    282   4e-87    Zea mays [maize]
ref|XP_006646962.1|  PREDICTED: uncharacterized protein LOC102709708    280   8e-87    Oryza brachyantha
gb|EMT33137.1|  hypothetical protein F775_28653                         287   9e-87    
emb|CDY59992.1|  BnaA02g35270D                                          280   1e-86    Brassica napus [oilseed rape]
emb|CDY52577.1|  BnaCnng22620D                                          280   1e-86    Brassica napus [oilseed rape]
gb|EMS55488.1|  hypothetical protein TRIUR3_12862                       281   1e-86    Triticum urartu
ref|XP_010433589.1|  PREDICTED: uncharacterized protein LOC104717678    279   3e-86    Camelina sativa [gold-of-pleasure]
ref|NP_001152440.1|  LOC100286080                                       278   3e-86    Zea mays [maize]
gb|ACG47634.1|  calmodulin binding protein                              278   4e-86    Zea mays [maize]
ref|XP_010438831.1|  PREDICTED: uncharacterized protein LOC104722380    278   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006282572.1|  hypothetical protein CARUB_v10004387mg             278   8e-86    Capsella rubella
ref|XP_009126828.1|  PREDICTED: uncharacterized protein LOC103851701    277   2e-85    Brassica rapa
ref|XP_004951715.1|  PREDICTED: uncharacterized protein LOC101768423    276   4e-85    Setaria italica
ref|XP_008800271.1|  PREDICTED: uncharacterized protein LOC103714689    276   6e-85    Phoenix dactylifera
gb|AFW70388.1|  calmodulin binding protein                              275   1e-84    
ref|NP_001150045.1|  calmodulin binding protein                         273   3e-84    Zea mays [maize]
dbj|BAJ96886.1|  predicted protein                                      268   1e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008805417.1|  PREDICTED: uncharacterized protein LOC103718396    272   2e-83    Phoenix dactylifera
ref|XP_002453396.1|  hypothetical protein SORBIDRAFT_04g005240          270   8e-83    Sorghum bicolor [broomcorn]
gb|KJB69416.1|  hypothetical protein B456_011G022600                    268   2e-82    Gossypium raimondii
emb|CDX94414.1|  BnaC01g17700D                                          266   5e-82    
ref|XP_003529298.1|  PREDICTED: uncharacterized protein LOC100812605    268   6e-82    Glycine max [soybeans]
ref|XP_009139545.1|  PREDICTED: uncharacterized protein LOC103863555    266   7e-82    Brassica rapa
dbj|BAJ94992.1|  predicted protein                                      268   9e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT06125.1|  hypothetical protein F775_27254                         268   2e-81    
gb|KHN07315.1|  hypothetical protein glysoja_027405                     265   4e-81    Glycine soja [wild soybean]
emb|CDX89394.1|  BnaA01g14990D                                          264   5e-81    
gb|EEC73417.1|  hypothetical protein OsI_07682                          264   2e-80    Oryza sativa Indica Group [Indian rice]
ref|NP_001047151.1|  Os02g0562300                                       264   2e-80    
ref|XP_002452291.1|  hypothetical protein SORBIDRAFT_04g023100          264   3e-80    Sorghum bicolor [broomcorn]
ref|XP_006647388.1|  PREDICTED: uncharacterized protein LOC102720...    260   6e-79    Oryza brachyantha
ref|XP_006647389.1|  PREDICTED: uncharacterized protein LOC102720...    260   6e-79    Oryza brachyantha
ref|XP_003575160.1|  PREDICTED: uncharacterized protein LOC100846...    260   8e-79    Brachypodium distachyon [annual false brome]
ref|XP_010235560.1|  PREDICTED: uncharacterized protein LOC100846...    260   9e-79    Brachypodium distachyon [annual false brome]
ref|XP_008645829.1|  PREDICTED: uncharacterized protein LOC103627...    259   1e-78    Zea mays [maize]
ref|XP_008645828.1|  PREDICTED: uncharacterized protein LOC103627...    259   1e-78    Zea mays [maize]
ref|XP_008678706.1|  PREDICTED: uncharacterized protein LOC103653644    258   4e-78    Zea mays [maize]
ref|XP_003532556.1|  PREDICTED: uncharacterized protein LOC100806393    257   5e-78    Glycine max [soybeans]
ref|XP_002309326.2|  calmodulin-binding protein 60-D                    256   5e-78    
gb|EMS66476.1|  hypothetical protein TRIUR3_28909                       260   6e-78    Triticum urartu
ref|XP_010448369.1|  PREDICTED: uncharacterized protein LOC104730...    255   3e-77    Camelina sativa [gold-of-pleasure]
ref|XP_004952753.1|  PREDICTED: uncharacterized protein LOC101756...    256   3e-77    Setaria italica
ref|XP_004952755.1|  PREDICTED: uncharacterized protein LOC101756...    256   3e-77    Setaria italica
gb|KDO59438.1|  hypothetical protein CISIN_1g007350mg                   248   7e-77    Citrus sinensis [apfelsine]
gb|AGT16661.1|  hypothetical protein SHCRBa_107_F16_R_30                255   8e-77    Saccharum hybrid cultivar R570
gb|EMT26442.1|  hypothetical protein F775_27587                         253   1e-76    
ref|XP_006453638.1|  hypothetical protein CICLE_v10008603mg             247   2e-76    
ref|XP_006473988.1|  PREDICTED: uncharacterized protein LOC102629839    252   3e-76    Citrus sinensis [apfelsine]
ref|XP_011033469.1|  PREDICTED: uncharacterized protein LOC105131940    252   4e-76    Populus euphratica
ref|XP_010417180.1|  PREDICTED: uncharacterized protein LOC104702...    241   5e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010265653.1|  PREDICTED: uncharacterized protein LOC104603341    251   5e-76    Nelumbo nucifera [Indian lotus]
ref|XP_006453635.1|  hypothetical protein CICLE_v10008603mg             246   7e-76    
ref|XP_006453637.1|  hypothetical protein CICLE_v10008603mg             246   8e-76    
emb|CBI18673.3|  unnamed protein product                                243   3e-75    Vitis vinifera
gb|KDO59436.1|  hypothetical protein CISIN_1g007350mg                   249   5e-75    Citrus sinensis [apfelsine]
ref|XP_010417178.1|  PREDICTED: uncharacterized protein LOC104702...    239   9e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006453636.1|  hypothetical protein CICLE_v10008603mg             248   1e-74    Citrus clementina [clementine]
gb|KEH37860.1|  calmodulin-binding protein                              248   1e-74    Medicago truncatula
ref|XP_002523509.1|  calmodulin binding protein, putative               243   1e-74    
gb|KJB27327.1|  hypothetical protein B456_004G291200                    247   3e-74    Gossypium raimondii
ref|XP_011017983.1|  PREDICTED: uncharacterized protein LOC105121148    247   4e-74    Populus euphratica
ref|XP_003533889.1|  PREDICTED: uncharacterized protein LOC100808...    246   7e-74    Glycine max [soybeans]
gb|KHG21283.1|  pentafunctional arom polypeptide                        246   7e-74    Gossypium arboreum [tree cotton]
ref|XP_004488927.1|  PREDICTED: uncharacterized protein LOC101515...    246   8e-74    Cicer arietinum [garbanzo]
ref|NP_001291237.1|  uncharacterized LOC105121148                       246   8e-74    Populus euphratica
emb|CDY20299.1|  BnaC04g36570D                                          245   1e-73    Brassica napus [oilseed rape]
ref|XP_002324557.1|  calmodulin-binding protein 60-D                    244   2e-73    
ref|XP_003546611.1|  PREDICTED: uncharacterized protein LOC100775528    245   2e-73    Glycine max [soybeans]
ref|XP_009140532.1|  PREDICTED: uncharacterized protein LOC103864...    244   3e-73    
ref|XP_003633161.1|  PREDICTED: uncharacterized protein LOC100255894    244   5e-73    Vitis vinifera
ref|XP_010472432.1|  PREDICTED: uncharacterized protein LOC104752066    243   6e-73    Camelina sativa [gold-of-pleasure]
ref|XP_002878744.1|  calmodulin-binding protein                         243   6e-73    
gb|KFK32663.1|  hypothetical protein AALP_AA6G272300                    243   7e-73    Arabis alpina [alpine rockcress]
ref|XP_009398637.1|  PREDICTED: uncharacterized protein LOC103983172    243   7e-73    
ref|XP_001761878.1|  predicted protein                                  239   8e-73    
ref|XP_010429400.1|  PREDICTED: uncharacterized protein LOC104713...    243   1e-72    
ref|XP_007138149.1|  hypothetical protein PHAVU_009G184300g             242   2e-72    Phaseolus vulgaris [French bean]
ref|XP_010265460.1|  PREDICTED: uncharacterized protein LOC104603...    242   2e-72    Nelumbo nucifera [Indian lotus]
ref|XP_007203768.1|  hypothetical protein PRUPE_ppa002988mg             242   2e-72    Prunus persica
ref|XP_009140533.1|  PREDICTED: uncharacterized protein LOC103864...    241   3e-72    Brassica rapa
ref|NP_973527.1|  Calmodulin-binding protein                            241   3e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CDY46137.1|  BnaA04g14250D                                          241   3e-72    Brassica napus [oilseed rape]
ref|XP_007011981.1|  Calmodulin-binding protein isoform 2               241   5e-72    
ref|XP_008796874.1|  PREDICTED: uncharacterized protein LOC103712...    240   7e-72    Phoenix dactylifera
ref|XP_002964136.1|  hypothetical protein SELMODRAFT_166784             240   8e-72    
ref|XP_002993171.1|  hypothetical protein SELMODRAFT_187271             240   9e-72    
gb|KDO75734.1|  hypothetical protein CISIN_1g006875mg                   240   1e-71    Citrus sinensis [apfelsine]
ref|XP_010429406.1|  PREDICTED: uncharacterized protein LOC104713...    240   1e-71    Camelina sativa [gold-of-pleasure]
gb|KDP38647.1|  hypothetical protein JCGZ_04000                         240   2e-71    Jatropha curcas
gb|EMS66803.1|  hypothetical protein TRIUR3_04882                       239   2e-71    Triticum urartu
ref|XP_006295420.1|  hypothetical protein CARUB_v10024519mg             240   2e-71    
ref|XP_008242948.1|  PREDICTED: uncharacterized protein LOC103341237    239   3e-71    Prunus mume [ume]
ref|XP_006449221.1|  hypothetical protein CICLE_v10014600mg             239   3e-71    
ref|XP_009358482.1|  PREDICTED: uncharacterized protein LOC103949109    238   8e-71    Pyrus x bretschneideri [bai li]
ref|XP_008796866.1|  PREDICTED: uncharacterized protein LOC103712...    236   3e-70    Phoenix dactylifera
ref|XP_010265459.1|  PREDICTED: uncharacterized protein LOC104603...    236   3e-70    Nelumbo nucifera [Indian lotus]
ref|XP_010103374.1|  hypothetical protein L484_016885                   239   3e-70    
ref|XP_010548510.1|  PREDICTED: uncharacterized protein LOC104819913    236   4e-70    
ref|XP_008336916.1|  PREDICTED: uncharacterized protein LOC103400014    235   8e-70    
ref|XP_008384593.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    232   1e-68    
ref|XP_009366145.1|  PREDICTED: uncharacterized protein LOC103955955    231   3e-68    Pyrus x bretschneideri [bai li]
ref|NP_194829.2|  Calmodulin-binding protein                            230   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002987748.1|  hypothetical protein SELMODRAFT_43458              225   5e-68    
ref|XP_001758879.1|  predicted protein                                  230   9e-68    
ref|XP_002987508.1|  hypothetical protein SELMODRAFT_42312              224   1e-67    
ref|XP_010039929.1|  PREDICTED: uncharacterized protein LOC104428665    219   3e-67    
ref|XP_001767931.1|  predicted protein                                  228   8e-67    
ref|XP_007011980.1|  Calmodulin-binding protein isoform 1               226   4e-66    
ref|XP_006283459.1|  hypothetical protein CARUB_v10004503mg             223   1e-65    Capsella rubella
ref|XP_010436318.1|  PREDICTED: uncharacterized protein LOC104720044    223   2e-65    Camelina sativa [gold-of-pleasure]
gb|KCW45622.1|  hypothetical protein EUGRSUZ_L006163                    212   5e-65    Eucalyptus grandis [rose gum]
ref|XP_010927523.1|  PREDICTED: uncharacterized protein LOC105049...    221   5e-65    Elaeis guineensis
ref|XP_010438091.1|  PREDICTED: uncharacterized protein LOC104721...    221   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010049867.1|  PREDICTED: uncharacterized protein LOC104438419    221   1e-64    Eucalyptus grandis [rose gum]
ref|XP_001766477.1|  predicted protein                                  219   5e-64    
ref|XP_010447628.1|  PREDICTED: uncharacterized protein LOC104730192    219   5e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010927522.1|  PREDICTED: uncharacterized protein LOC105049...    217   2e-63    Elaeis guineensis
emb|CDY28237.1|  BnaA01g06120D                                          216   8e-63    Brassica napus [oilseed rape]
ref|XP_001756257.1|  predicted protein                                  213   2e-61    
ref|XP_009127315.1|  PREDICTED: uncharacterized protein LOC103852...    211   4e-61    Brassica rapa
emb|CDX68716.1|  BnaC01g07370D                                          210   1e-60    
ref|XP_004287109.1|  PREDICTED: uncharacterized protein LOC101306949    209   7e-60    Fragaria vesca subsp. vesca
ref|XP_006412639.1|  hypothetical protein EUTSA_v10024817mg             208   8e-60    
ref|XP_001782625.1|  predicted protein                                  207   4e-59    
ref|XP_010656822.1|  PREDICTED: uncharacterized protein LOC100264...    202   2e-57    
ref|XP_009606926.1|  PREDICTED: uncharacterized protein LOC104101...    200   7e-57    
ref|XP_002869350.1|  calmodulin-binding protein                         198   3e-56    
ref|XP_009761692.1|  PREDICTED: uncharacterized protein LOC104213...    198   5e-56    
ref|XP_009396703.1|  PREDICTED: uncharacterized protein LOC103981686    192   6e-56    
ref|XP_010327020.1|  PREDICTED: uncharacterized protein LOC101268...    194   9e-55    
ref|XP_010327019.1|  PREDICTED: uncharacterized protein LOC101268...    193   5e-54    
ref|XP_004248099.1|  PREDICTED: uncharacterized protein LOC101268...    193   5e-54    
gb|KHG17962.1|  Insulin-like receptor                                   188   1e-52    
ref|NP_180007.2|  Calmodulin-binding protein                            184   8e-51    
gb|EYU27904.1|  hypothetical protein MIMGU_mgv1a0037712mg               181   5e-50    
ref|NP_001190876.1|  Calmodulin-binding protein                         178   9e-49    
gb|KJB27328.1|  hypothetical protein B456_004G291200                    176   7e-48    
gb|KDO59439.1|  hypothetical protein CISIN_1g007350mg                   167   5e-45    
emb|CBI18672.3|  unnamed protein product                                167   5e-45    
gb|KDO45336.1|  hypothetical protein CISIN_1g011961mg                   160   2e-43    
gb|KDO45337.1|  hypothetical protein CISIN_1g011961mg                   160   2e-43    
ref|XP_006384007.1|  hypothetical protein POPTR_0004s03500g             159   8e-43    
ref|XP_006442616.1|  hypothetical protein CICLE_v10019990mg             161   8e-43    
gb|KDO45335.1|  hypothetical protein CISIN_1g011961mg                   160   9e-43    
ref|XP_006485820.1|  PREDICTED: uncharacterized protein LOC102612087    160   2e-42    
ref|XP_010272043.1|  PREDICTED: uncharacterized protein LOC104607948    160   4e-42    
gb|KJB53237.1|  hypothetical protein B456_008G297800                    155   5e-42    
ref|XP_002321568.2|  hypothetical protein POPTR_0015s08320g             158   2e-41    
gb|KJB53235.1|  hypothetical protein B456_008G297800                    154   2e-41    
gb|KJB53233.1|  hypothetical protein B456_008G297800                    154   9e-41    
ref|XP_011028618.1|  PREDICTED: uncharacterized protein LOC105128...    156   1e-40    
ref|XP_004981226.1|  PREDICTED: uncharacterized protein LOC101754...    155   1e-40    
gb|KJB53232.1|  hypothetical protein B456_008G297800                    155   3e-40    
gb|KHG14637.1|  hypothetical protein F383_07493                         154   3e-40    
emb|CAB39601.1|  putative calmodulin-binding protein                    154   5e-40    
ref|XP_010024363.1|  PREDICTED: uncharacterized protein LOC104414833    147   5e-40    
ref|XP_010042648.1|  PREDICTED: uncharacterized protein LOC104431789    150   6e-40    
gb|AAB37246.1|  calmodulin-binding protein                              153   8e-40    
ref|XP_007036568.1|  Calmodulin binding protein-like, putative          152   1e-39    
ref|NP_001151502.1|  calmodulin binding protein                         152   2e-39    
ref|XP_010227513.1|  PREDICTED: uncharacterized protein LOC100835...    152   2e-39    
ref|XP_010023872.1|  PREDICTED: uncharacterized protein LOC104414422    147   2e-39    
gb|ABF96807.1|  calmodulin-binding protein, putative, expressed         151   2e-39    
ref|XP_003620431.1|  Calmodulin-binding protein                         147   3e-39    
ref|XP_003563479.1|  PREDICTED: uncharacterized protein LOC100835...    152   3e-39    
gb|AFW67117.1|  calmodulin binding protein                              152   4e-39    
gb|KDP31144.1|  hypothetical protein JCGZ_11520                         152   4e-39    
ref|NP_001050439.2|  Os03g0436300                                       151   5e-39    
ref|XP_006476725.1|  PREDICTED: uncharacterized protein LOC102629...    151   5e-39    
ref|XP_010041698.1|  PREDICTED: uncharacterized protein LOC104430653    149   9e-39    
ref|XP_004981227.1|  PREDICTED: uncharacterized protein LOC101754...    150   1e-38    
ref|XP_010254821.1|  PREDICTED: uncharacterized protein LOC104595...    150   1e-38    
gb|EAY90582.1|  hypothetical protein OsI_12183                          149   2e-38    
ref|XP_010046813.1|  PREDICTED: uncharacterized protein LOC104435...    147   2e-38    
ref|XP_010037594.1|  PREDICTED: uncharacterized protein LOC104426...    149   2e-38    
ref|XP_010041291.1|  PREDICTED: uncharacterized protein LOC104430230    145   3e-38    
gb|KJB19585.1|  hypothetical protein B456_003G109800                    149   4e-38    
ref|XP_002463614.1|  hypothetical protein SORBIDRAFT_01g002950          149   4e-38    
ref|XP_010065604.1|  PREDICTED: uncharacterized protein LOC104452820    144   5e-38    
gb|KCW44162.1|  hypothetical protein EUGRSUZ_L02421                     146   5e-38    
ref|XP_010046812.1|  PREDICTED: uncharacterized protein LOC104435...    148   5e-38    
ref|XP_010046810.1|  PREDICTED: uncharacterized protein LOC104435...    147   6e-38    
ref|XP_010046808.1|  PREDICTED: uncharacterized protein LOC104435...    147   6e-38    
ref|XP_010032156.1|  PREDICTED: uncharacterized protein LOC104421771    147   6e-38    
ref|XP_009413219.1|  PREDICTED: uncharacterized protein LOC103994572    148   7e-38    
ref|XP_010037595.1|  PREDICTED: uncharacterized protein LOC104426...    148   8e-38    
gb|KCW88041.1|  hypothetical protein EUGRSUZ_A00457                     147   9e-38    
ref|XP_002511452.1|  calmodulin binding protein, putative               147   9e-38    
ref|XP_010678697.1|  PREDICTED: uncharacterized protein LOC104894210    147   9e-38    
dbj|BAK03856.1|  predicted protein                                      148   9e-38    
emb|CBI15082.3|  unnamed protein product                                145   1e-37    
ref|XP_006472172.1|  PREDICTED: uncharacterized protein LOC102614...    147   1e-37    
ref|XP_006472171.1|  PREDICTED: uncharacterized protein LOC102614...    147   1e-37    
ref|XP_011071789.1|  PREDICTED: uncharacterized protein LOC105157...    147   1e-37    
gb|AES76641.2|  calmodulin-binding-like protein                         146   2e-37    
ref|XP_011045832.1|  PREDICTED: uncharacterized protein LOC105140...    145   2e-37    
ref|XP_011045831.1|  PREDICTED: uncharacterized protein LOC105140...    145   3e-37    
ref|XP_002318022.2|  hypothetical protein POPTR_0012s07850g             146   4e-37    
gb|KCW78559.1|  hypothetical protein EUGRSUZ_C00024                     146   4e-37    
ref|XP_006439747.1|  hypothetical protein CICLE_v10019512mg             146   4e-37    
gb|EYU19014.1|  hypothetical protein MIMGU_mgv1a017885mg                144   4e-37    
ref|XP_002318542.2|  calmodulin-binding protein 60-C                    145   4e-37    
ref|XP_002280322.1|  PREDICTED: uncharacterized protein LOC100255354    145   4e-37    
ref|XP_003533359.1|  PREDICTED: uncharacterized protein LOC100803213    145   5e-37    
gb|KCW83410.1|  hypothetical protein EUGRSUZ_B00342                     144   5e-37    
gb|KDP20146.1|  hypothetical protein JCGZ_05915                         145   6e-37    
ref|XP_006433503.1|  hypothetical protein CICLE_v10000733mg             145   8e-37    
ref|XP_011044351.1|  PREDICTED: uncharacterized protein LOC105139567    145   8e-37    
ref|XP_008239717.1|  PREDICTED: uncharacterized protein LOC103338302    145   9e-37    
gb|EMS59700.1|  hypothetical protein TRIUR3_12153                       145   1e-36    
ref|XP_010057574.1|  PREDICTED: uncharacterized protein LOC104445...    144   1e-36    
gb|KDO81720.1|  hypothetical protein CISIN_1g008593mg                   144   1e-36    
ref|XP_006476727.1|  PREDICTED: uncharacterized protein LOC102629...    144   1e-36    
ref|XP_010059379.1|  PREDICTED: uncharacterized protein LOC104447325    144   1e-36    
gb|AAU89225.1|  hypothetical protein                                    144   2e-36    
ref|XP_010045651.1|  PREDICTED: uncharacterized protein LOC104434413    143   2e-36    
ref|XP_010057575.1|  PREDICTED: uncharacterized protein LOC104445...    143   3e-36    
gb|KEH27025.1|  calmodulin-binding-like protein                         142   3e-36    
ref|XP_010057573.1|  PREDICTED: uncharacterized protein LOC104445...    143   3e-36    
ref|XP_010091049.1|  hypothetical protein L484_006414                   143   3e-36    
ref|XP_010057576.1|  PREDICTED: uncharacterized protein LOC104445...    143   4e-36    
ref|XP_010065545.1|  PREDICTED: uncharacterized protein LOC104452768    144   4e-36    
ref|XP_010057570.1|  PREDICTED: uncharacterized protein LOC104445...    143   4e-36    
ref|XP_009360136.1|  PREDICTED: uncharacterized protein LOC103950631    142   4e-36    
ref|XP_010027966.1|  PREDICTED: uncharacterized protein LOC104418...    142   5e-36    
ref|XP_007155393.1|  hypothetical protein PHAVU_003G197500g             142   6e-36    
ref|XP_003530023.1|  PREDICTED: uncharacterized protein LOC100792405    142   7e-36    
ref|XP_011028619.1|  PREDICTED: uncharacterized protein LOC105128...    142   7e-36    
ref|XP_003530806.1|  PREDICTED: uncharacterized protein LOC100788183    142   7e-36    
ref|XP_002318021.2|  hypothetical protein POPTR_0012s07850g             141   7e-36    
gb|KHN20748.1|  hypothetical protein glysoja_019065                     142   9e-36    
gb|EPS59462.1|  hypothetical protein M569_15344                         140   1e-35    
ref|XP_004508839.1|  PREDICTED: uncharacterized protein LOC101513422    141   1e-35    
ref|XP_007036114.1|  Calmodulin binding protein-like isoform 2          141   1e-35    
ref|XP_009409798.1|  PREDICTED: uncharacterized protein LOC103991...    140   2e-35    
ref|XP_009409793.1|  PREDICTED: uncharacterized protein LOC103991...    140   2e-35    
ref|XP_007036113.1|  Calmodulin binding protein-like isoform 1          141   2e-35    
ref|XP_011008308.1|  PREDICTED: uncharacterized protein LOC105113713    140   2e-35    
ref|XP_003620423.1|  hypothetical protein MTR_6g083730                  141   2e-35    
ref|XP_004299585.1|  PREDICTED: uncharacterized protein LOC101299...    141   2e-35    
ref|XP_010059372.1|  PREDICTED: uncharacterized protein LOC104447318    140   2e-35    
ref|XP_003630882.1|  hypothetical protein MTR_8g104510                  140   3e-35    
ref|XP_008367583.1|  PREDICTED: uncharacterized protein LOC103431225    140   4e-35    
ref|XP_009757664.1|  PREDICTED: uncharacterized protein LOC104210461    140   4e-35    
gb|EMT24884.1|  hypothetical protein F775_01646                         143   4e-35    
ref|XP_010065486.1|  PREDICTED: uncharacterized protein LOC104452712    140   4e-35    
gb|KJB19586.1|  hypothetical protein B456_003G109800                    140   5e-35    
emb|CDP16416.1|  unnamed protein product                                140   5e-35    
ref|XP_006341580.1|  PREDICTED: uncharacterized protein LOC102585109    139   6e-35    
ref|XP_010042823.1|  PREDICTED: uncharacterized protein LOC104432014    136   6e-35    
ref|XP_007031106.1|  Calmodulin-binding protein, putative isoform 2     139   6e-35    
ref|XP_006587151.1|  PREDICTED: uncharacterized protein LOC100808...    139   7e-35    
ref|XP_010265059.1|  PREDICTED: uncharacterized protein LOC104602900    139   7e-35    
ref|XP_010927048.1|  PREDICTED: uncharacterized protein LOC105049175    139   9e-35    
ref|XP_008240237.1|  PREDICTED: uncharacterized protein LOC103338768    139   9e-35    
gb|KCW74763.1|  hypothetical protein EUGRSUZ_E03496                     139   9e-35    
ref|XP_010059376.1|  PREDICTED: uncharacterized protein LOC104447321    136   1e-34    
ref|XP_007031105.1|  Calmodulin-binding protein, putative isoform 1     139   1e-34    
ref|XP_009589461.1|  PREDICTED: uncharacterized protein LOC104086819    138   1e-34    
gb|KHN18485.1|  hypothetical protein glysoja_006898                     139   1e-34    
ref|XP_010059363.1|  PREDICTED: uncharacterized protein LOC104447309    137   1e-34    
gb|KCW74758.1|  hypothetical protein EUGRSUZ_E03487                     135   1e-34    
ref|XP_008374776.1|  PREDICTED: uncharacterized protein LOC103438015    138   2e-34    
ref|XP_007208838.1|  hypothetical protein PRUPE_ppa025469mg             137   2e-34    
gb|KCW74759.1|  hypothetical protein EUGRSUZ_E03489                     138   2e-34    
ref|XP_003630879.1|  hypothetical protein MTR_8g104490                  137   2e-34    
ref|XP_010057569.1|  PREDICTED: uncharacterized protein LOC104445380    138   3e-34    
ref|XP_011087167.1|  PREDICTED: uncharacterized protein LOC105168...    138   3e-34    
ref|XP_008374473.1|  PREDICTED: uncharacterized protein LOC103437753    138   3e-34    
ref|XP_010663614.1|  PREDICTED: uncharacterized protein LOC100259493    137   3e-34    
gb|KHN48619.1|  hypothetical protein glysoja_015767                     137   3e-34    
ref|XP_010059382.1|  PREDICTED: uncharacterized protein LOC104447329    137   3e-34    
ref|XP_006579554.1|  PREDICTED: uncharacterized protein LOC100804...    137   4e-34    
ref|XP_009596878.1|  PREDICTED: uncharacterized protein LOC104092894    137   4e-34    
ref|XP_010268068.1|  PREDICTED: uncharacterized protein LOC104605...    137   4e-34    
ref|XP_010268067.1|  PREDICTED: uncharacterized protein LOC104605...    137   4e-34    
ref|XP_002276874.1|  PREDICTED: uncharacterized protein LOC100264668    137   4e-34    
ref|XP_010037596.1|  PREDICTED: uncharacterized protein LOC104426...    137   6e-34    
ref|XP_009151378.1|  PREDICTED: uncharacterized protein LOC103874695    136   7e-34    
ref|XP_010023984.1|  PREDICTED: uncharacterized protein LOC104414504    137   8e-34    
ref|XP_009347344.1|  PREDICTED: uncharacterized protein LOC103939014    136   8e-34    
ref|XP_006855337.1|  hypothetical protein AMTR_s00057p00092720          136   9e-34    
ref|XP_011087459.1|  PREDICTED: uncharacterized protein LOC105168...    136   1e-33    
ref|XP_010027958.1|  PREDICTED: uncharacterized protein LOC104418...    136   1e-33    
ref|XP_008812376.1|  PREDICTED: uncharacterized protein LOC103723276    135   1e-33    
ref|XP_011087460.1|  PREDICTED: uncharacterized protein LOC105168...    135   1e-33    
emb|CDY56640.1|  BnaCnng30830D                                          135   1e-33    
ref|XP_010264646.1|  PREDICTED: uncharacterized protein LOC104602601    135   1e-33    
ref|XP_010268064.1|  PREDICTED: uncharacterized protein LOC104605...    136   1e-33    
ref|XP_010268063.1|  PREDICTED: uncharacterized protein LOC104605...    136   1e-33    
ref|XP_002321484.2|  hypothetical protein POPTR_0015s03860g             135   2e-33    
emb|CDP16419.1|  unnamed protein product                                129   2e-33    
ref|XP_010259392.1|  PREDICTED: uncharacterized protein LOC104598...    135   2e-33    
emb|CDY00305.1|  BnaA06g22060D                                          135   3e-33    
ref|XP_004235786.1|  PREDICTED: uncharacterized protein LOC101248759    134   3e-33    
ref|XP_010059381.1|  PREDICTED: uncharacterized protein LOC104447328    132   3e-33    
gb|KHG25212.1|  Kelch repeat-containing                                 134   3e-33    
ref|XP_010268065.1|  PREDICTED: uncharacterized protein LOC104605...    135   4e-33    
ref|XP_010905678.1|  PREDICTED: uncharacterized protein LOC105032...    135   4e-33    
ref|XP_010927335.1|  PREDICTED: uncharacterized protein LOC105049...    134   4e-33    
ref|XP_010054940.1|  PREDICTED: uncharacterized protein LOC104443310    129   4e-33    
ref|XP_010089242.1|  hypothetical protein L484_001320                   133   5e-33    
ref|XP_010050182.1|  PREDICTED: uncharacterized protein LOC104438698    131   6e-33    
ref|XP_010916435.1|  PREDICTED: uncharacterized protein LOC105041252    133   6e-33    
ref|XP_010040875.1|  PREDICTED: uncharacterized protein LOC104429...    134   6e-33    
gb|KCW74754.1|  hypothetical protein EUGRSUZ_E03479                     130   8e-33    
ref|XP_010059378.1|  PREDICTED: uncharacterized protein LOC104447324    134   8e-33    
ref|XP_003525237.1|  PREDICTED: uncharacterized protein LOC100802257    133   1e-32    
ref|XP_010041878.1|  PREDICTED: uncharacterized protein LOC104430862    127   1e-32    
gb|AAD18103.1|  putative calmodulin-binding protein                     133   1e-32    
ref|XP_010537458.1|  PREDICTED: uncharacterized protein LOC104812149    132   1e-32    
ref|XP_009782886.1|  PREDICTED: uncharacterized protein LOC104231571    132   1e-32    
ref|XP_010419298.1|  PREDICTED: uncharacterized protein LOC104705003    130   1e-32    
ref|XP_010040988.1|  PREDICTED: uncharacterized protein LOC104429893    132   1e-32    
gb|KHN21595.1|  hypothetical protein glysoja_023447                     132   1e-32    
ref|XP_010040872.1|  PREDICTED: uncharacterized protein LOC104429...    134   1e-32    
ref|XP_010040871.1|  PREDICTED: uncharacterized protein LOC104429...    134   2e-32    
ref|XP_010040870.1|  PREDICTED: uncharacterized protein LOC104429...    134   2e-32    
ref|XP_010057567.1|  PREDICTED: uncharacterized protein LOC104445...    131   3e-32    
emb|CAN82842.1|  hypothetical protein VITISV_019567                     132   3e-32    
ref|XP_010057568.1|  PREDICTED: uncharacterized protein LOC104445...    131   3e-32    
emb|CBI39569.3|  unnamed protein product                                132   3e-32    
ref|XP_010059364.1|  PREDICTED: uncharacterized protein LOC104447310    131   3e-32    
ref|XP_010659675.1|  PREDICTED: uncharacterized protein LOC104881366    133   3e-32    
ref|XP_006650818.1|  PREDICTED: uncharacterized protein LOC102714360    132   3e-32    
ref|XP_004503377.1|  PREDICTED: uncharacterized protein LOC101500...    131   4e-32    
gb|KCW73464.1|  hypothetical protein EUGRSUZ_E01952                     129   4e-32    
ref|XP_004503376.1|  PREDICTED: uncharacterized protein LOC101500...    131   4e-32    
ref|XP_010065438.1|  PREDICTED: uncharacterized protein LOC104452669    132   4e-32    
ref|XP_009601568.1|  PREDICTED: uncharacterized protein LOC104096838    131   4e-32    
ref|XP_008797680.1|  PREDICTED: uncharacterized protein LOC103712820    131   4e-32    
ref|XP_010070280.1|  PREDICTED: uncharacterized protein LOC104456...    131   4e-32    
ref|XP_010059361.1|  PREDICTED: uncharacterized protein LOC104447306    127   5e-32    
ref|XP_006404953.1|  hypothetical protein EUTSA_v10000138mg             130   8e-32    
gb|KDO69773.1|  hypothetical protein CISIN_1g0084532mg                  129   8e-32    
ref|XP_007011982.1|  Calmodulin-binding protein isoform 3               130   8e-32    
ref|XP_004300508.1|  PREDICTED: uncharacterized protein LOC101291831    130   9e-32    
ref|XP_010905679.1|  PREDICTED: uncharacterized protein LOC105032...    131   1e-31    
ref|XP_010057566.1|  PREDICTED: uncharacterized protein LOC104445...    131   1e-31    
ref|XP_010054934.1|  PREDICTED: uncharacterized protein LOC104443305    130   1e-31    
ref|XP_010059367.1|  PREDICTED: uncharacterized protein LOC104447313    130   1e-31    
ref|XP_002524906.1|  calmodulin binding protein, putative               129   1e-31    
ref|XP_004252230.1|  PREDICTED: uncharacterized protein LOC101256262    129   1e-31    
ref|XP_010065448.1|  PREDICTED: uncharacterized protein LOC104452678    129   2e-31    
ref|XP_006353810.1|  PREDICTED: uncharacterized protein LOC102604313    129   2e-31    
gb|KCW78560.1|  hypothetical protein EUGRSUZ_C00025                     129   2e-31    



>ref|XP_007014163.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
 gb|EOY31782.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
Length=643

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERTNS+ RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTNSIARGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGP R+  RSSPKRIEGPDG ++QLHFRSRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPPRLNGRSSPKRIEGPDGLSLQLHFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIH+VL+D+N+G VVTTGPE+C+KLDVVVLEGDFNNEDD+DWTQEEFESHVVKEREGKR
Sbjct  121  AAIHIVLVDTNTGQVVTTGPEACVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_007014160.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014161.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014162.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31779.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31780.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31781.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERTNS+ RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTNSIARGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGP R+  RSSPKRIEGPDG ++QLHFRSRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPPRLNGRSSPKRIEGPDGLSLQLHFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIH+VL+D+N+G VVTTGPE+C+KLDVVVLEGDFNNEDD+DWTQEEFESHVVKEREGKR
Sbjct  121  AAIHIVLVDTNTGQVVTTGPEACVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_002526232.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF36173.1| calmodulin binding protein, putative [Ricinus communis]
Length=466

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 183/190 (96%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD-EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYMERTNSM RGKR+LEG  EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQTRYMERTNSMARGKRALEGGGEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGP R++ RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKLGPPRLSGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VL+D+NSGHV+T+GPE+ +KLDV+VLEGDFNNEDD+DW+QEEFESHVVKEREGKRP
Sbjct  121  AIHIVLLDANSGHVLTSGPEASVKLDVLVLEGDFNNEDDEDWSQEEFESHVVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGDLQVTL
Sbjct  181  LLTGDLQVTL  190



>gb|KDO62473.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=400

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERT+SM RGKRSLE +E++QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTSSMSRGKRSLESNEDEQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIA-ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPAR+   R+SPKRIEGPDGRN+QL+FRSRLSLPLFTGGKVEGEQ
Sbjct  61   RRVVSEEVERALAKLGPARLNNGRASPKRIEGPDGRNLQLYFRSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D+N+GHVVT+GPE+ +KLD+VVLEGDFNNEDDD WTQEEFESHVVKEREGK
Sbjct  121  GAAIHVVLVDANTGHVVTSGPEASVKLDIVVLEGDFNNEDDDGWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>gb|KDO62472.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=465

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERT+SM RGKRSLE +E++QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTSSMSRGKRSLESNEDEQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIA-ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPAR+   R+SPKRIEGPDGRN+QL+FRSRLSLPLFTGGKVEGEQ
Sbjct  61   RRVVSEEVERALAKLGPARLNNGRASPKRIEGPDGRNLQLYFRSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D+N+GHVVT+GPE+ +KLD+VVLEGDFNNEDDD WTQEEFESHVVKEREGK
Sbjct  121  GAAIHVVLVDANTGHVVTSGPEASVKLDIVVLEGDFNNEDDDGWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_011079310.1| PREDICTED: uncharacterized protein LOC105162855 [Sesamum indicum]
Length=643

 Score =   343 bits (880),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 183/192 (95%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM--RGKRSLEG--DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMERTNSM  RGKRSLEG  DEEQ+ ERKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQTRYMERTNSMKGRGKRSLEGGGDEEQESERKRPALASVIVEALKVDSLQKLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPAR+  RSSPKR+EGPDGRN+QLHF+SRLSLPLFTGGKVEGEQ
Sbjct  61   LRRVVSEEVERALAKLGPARLNGRSSPKRLEGPDGRNLQLHFKSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVLID+N+GHVVT+GPES MKLDV+VLEGDFNNED++ W+QEEFESHVVKEREGK
Sbjct  121  GAAIHVVLIDANTGHVVTSGPESSMKLDVIVLEGDFNNEDEEGWSQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>gb|KHG10046.1| Protein very KIND [Gossypium arboreum]
Length=640

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 180/189 (95%), Gaps = 1/189 (1%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRR  264
            M TRYMERTNSM RGKRSL+GD+ QQPE KRPALASVIVEALKVDSLQKLCSSLEPILRR
Sbjct  1    MHTRYMERTNSMARGKRSLDGDDNQQPEPKRPALASVIVEALKVDSLQKLCSSLEPILRR  60

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VVSEEVERALAKLGP R++ RSSPK+IEGPDGR++QLHFRSRLSLPLFTGGKVEGEQGAA
Sbjct  61   VVSEEVERALAKLGPPRLSGRSSPKQIEGPDGRSLQLHFRSRLSLPLFTGGKVEGEQGAA  120

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IH+VL+DS +GHVVTTGPE+ +KLDVVVLEGDFNNEDD+DWTQEEFESHVVKEREGKRPL
Sbjct  121  IHIVLVDSKTGHVVTTGPEASVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKRPL  180

Query  625  LTGDLQVTL  651
            LTGDLQV L
Sbjct  181  LTGDLQVIL  189



>gb|KDO62470.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=639

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERT+SM RGKRSLE +E++QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTSSMSRGKRSLESNEDEQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIA-ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPAR+   R+SPKRIEGPDGRN+QL+FRSRLSLPLFTGGKVEGEQ
Sbjct  61   RRVVSEEVERALAKLGPARLNNGRASPKRIEGPDGRNLQLYFRSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D+N+GHVVT+GPE+ +KLD+VVLEGDFNNEDDD WTQEEFESHVVKEREGK
Sbjct  121  GAAIHVVLVDANTGHVVTSGPEASVKLDIVVLEGDFNNEDDDGWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_006453423.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006453424.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006474152.1| PREDICTED: uncharacterized protein LOC102625149 isoform X1 [Citrus 
sinensis]
 ref|XP_006474153.1| PREDICTED: uncharacterized protein LOC102625149 isoform X2 [Citrus 
sinensis]
 gb|ESR66663.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|ESR66664.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|KDO62468.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
 gb|KDO62469.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=641

 Score =   338 bits (868),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERT+SM RGKRSLE +E++QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTSSMSRGKRSLESNEDEQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIA-ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPAR+   R+SPKRIEGPDGRN+QL+FRSRLSLPLFTGGKVEGEQ
Sbjct  61   RRVVSEEVERALAKLGPARLNNGRASPKRIEGPDGRNLQLYFRSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D+N+GHVVT+GPE+ +KLD+VVLEGDFNNEDDD WTQEEFESHVVKEREGK
Sbjct  121  GAAIHVVLVDANTGHVVTSGPEASVKLDIVVLEGDFNNEDDDGWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>gb|KDO62471.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=635

 Score =   338 bits (868),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 184/192 (96%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYMERT+SM RGKRSLE +E++QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMERTSSMSRGKRSLESNEDEQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIA-ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPAR+   R+SPKRIEGPDGRN+QL+FRSRLSLPLFTGGKVEGEQ
Sbjct  61   RRVVSEEVERALAKLGPARLNNGRASPKRIEGPDGRNLQLYFRSRLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D+N+GHVVT+GPE+ +KLD+VVLEGDFNNEDDD WTQEEFESHVVKEREGK
Sbjct  121  GAAIHVVLVDANTGHVVTSGPEASVKLDIVVLEGDFNNEDDDGWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>gb|KJB22129.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22130.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22131.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
Length=640

 Score =   338 bits (866),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRR  264
            M TRYMERTNSM RGKRSL+GD+ QQPE KRPALASVIVEALKVDSLQKLCSSLEPILRR
Sbjct  1    MHTRYMERTNSMARGKRSLDGDDNQQPEPKRPALASVIVEALKVDSLQKLCSSLEPILRR  60

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VVSEEVERALAKLGP R++ RSSPK+IEGPDGR++QL FRSRLSLPLFTGGKVEGEQGAA
Sbjct  61   VVSEEVERALAKLGPPRLSGRSSPKQIEGPDGRSLQLLFRSRLSLPLFTGGKVEGEQGAA  120

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IH+VL+DS +GHVVTTGPE+ +KLDVVVLEGDFNNEDD+DWTQEEFESHVVKEREGKRPL
Sbjct  121  IHIVLVDSKTGHVVTTGPEASVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKRPL  180

Query  625  LTGDLQVTL  651
            LTGDLQV L
Sbjct  181  LTGDLQVIL  189



>gb|KDO75736.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=448

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMER+NS RG  S    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERSNSKRGLDSSSA-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  60   VSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  120  HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  179

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  180  SGDLQVTL  187



>gb|KDP22927.1| hypothetical protein JCGZ_01764 [Jatropha curcas]
Length=631

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 1/184 (1%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            MERTNSM RGKR+LEG EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE
Sbjct  1    MERTNSMARGKRALEGGEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  60

Query  280  VERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVL  459
            VERALAKLGP RI  R+SPKRIEG DGR++QLHFRSRLSLPLFTGGKVEGEQGAAIH+VL
Sbjct  61   VERALAKLGPPRINGRTSPKRIEGRDGRSLQLHFRSRLSLPLFTGGKVEGEQGAAIHIVL  120

Query  460  IDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDL  639
            ID+NSGHVVT GPE+ +KLDVVVLEGDFNNEDD+DWTQEEFESHVVKEREGKRPLLTGDL
Sbjct  121  IDANSGHVVTAGPEASVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGDL  180

Query  640  QVTL  651
            QVTL
Sbjct  181  QVTL  184



>ref|XP_010103014.1| hypothetical protein L484_022898 [Morus notabilis]
 gb|EXB94581.1| hypothetical protein L484_022898 [Morus notabilis]
Length=641

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTR MERTNSMRGKR LEG++  QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRLMERTNSMRGKRPLEGEDGDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  60

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA +  RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQGAA+
Sbjct  61   VSEEVERALAKLGPAMLPGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGAAV  120

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID N+GH+VT+GPE+  KLDVVVLEGDFN EDD+ WT E+FESHVVKEREGKRPLL
Sbjct  121  HIVLIDGNTGHLVTSGPEASSKLDVVVLEGDFNTEDDEGWTPEDFESHVVKEREGKRPLL  180

Query  628  TGDLQVTL  651
            TGDLQVTL
Sbjct  181  TGDLQVTL  188



>ref|XP_006366189.1| PREDICTED: uncharacterized protein LOC102581064 [Solanum tuberosum]
Length=618

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 4/190 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMERT SM  KRSLE D++Q PERKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERTKSM--KRSLEDDDDQPPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  58

Query  268  VSEEVERALAKLGPARIAA--RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            VSEEVERALAKLGPARI++  RSSPKRIEGPDG N+QL FRSRLSLPLFTGGKVEGE GA
Sbjct  59   VSEEVERALAKLGPARISSGFRSSPKRIEGPDGSNLQLQFRSRLSLPLFTGGKVEGEHGA  118

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVLID+N+GH+VT GPESC+KLDVVVLEGDFNNEDD+ WTQEEF+SHVVKEREGKRP
Sbjct  119  AIHVVLIDTNTGHLVTAGPESCIKLDVVVLEGDFNNEDDEGWTQEEFDSHVVKEREGKRP  178

Query  622  LLTGDLQVTL  651
            LLTGDLQ+TL
Sbjct  179  LLTGDLQITL  188



>gb|KDO75731.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=623

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMER+NS RG  S    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERSNSKRGLDSSSA-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  60   VSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  120  HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  179

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  180  SGDLQVTL  187



>ref|XP_006467892.1| PREDICTED: uncharacterized protein LOC102626942 [Citrus sinensis]
 gb|KDO75732.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75733.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=628

 Score =   330 bits (847),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMER+NS RG  S    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERSNSKRGLDSSSA-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  60   VSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  120  HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  179

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  180  SGDLQVTL  187



>ref|XP_010259794.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259795.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259796.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
Length=644

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDE--EQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            ++ QTRY+ER+N+M R KR L+  E  E QPE+KRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQRQTRYLERSNTMNREKRGLDPSEGEEGQPEKKRPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPAR+  RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGE
Sbjct  61   ILRRVVSEEVERALAKLGPARLNGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGE  120

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAA+HVVL+D+N+GHVVTTG ES +KLDVVVLEGDFNNEDDDDWTQE+FESHVVKEREG
Sbjct  121  QGAAVHVVLLDANTGHVVTTGSESSVKLDVVVLEGDFNNEDDDDWTQEDFESHVVKEREG  180

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQVTL
Sbjct  181  KRPLLTGDLQVTL  193



>gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Erythranthe guttata]
Length=648

 Score =   330 bits (847),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 178/194 (92%), Gaps = 6/194 (3%)
 Frame = +1

Query  88   MQTRYMERTNSM--RGKRSLE---GDEEQQ-PERKRPALASVIVEALKVDSLQKLCSSLE  249
            MQTRYMERTNSM  RGKRSLE    DEEQQ PERKRPALASVIVEALK+DSLQKLCSSLE
Sbjct  1    MQTRYMERTNSMKGRGKRSLEEGAADEEQQEPERKRPALASVIVEALKLDSLQKLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEG  429
            PILRRVVSEEVERALAKLGPA +  RSSPKRI GPDGRN+QLHF+SRLSLPLFTGGKVEG
Sbjct  61   PILRRVVSEEVERALAKLGPAMLNGRSSPKRIGGPDGRNLQLHFKSRLSLPLFTGGKVEG  120

Query  430  EQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKERE  609
            EQGAAIHVVLID+N+GH VT+GPES +KLD+VVLEGDFNNEDD+ W QEEF+SHVVKERE
Sbjct  121  EQGAAIHVVLIDANTGHAVTSGPESSVKLDIVVLEGDFNNEDDEGWNQEEFDSHVVKERE  180

Query  610  GKRPLLTGDLQVTL  651
            GKRPLLTGDLQV L
Sbjct  181  GKRPLLTGDLQVAL  194



>ref|XP_010092630.1| hypothetical protein L484_006392 [Morus notabilis]
 gb|EXB51819.1| hypothetical protein L484_006392 [Morus notabilis]
Length=650

 Score =   330 bits (846),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            ++MQTRYMER+NS+ R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  20   MKMQTRYMERSNSVVREKRGLDSASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEP  79

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPA++  RSSPKRI GPDGR++QLHFRSRLSLPLFTGGKVEGE
Sbjct  80   ILRRVVSEEVERALAKLGPAKLTGRSSPKRIGGPDGRDLQLHFRSRLSLPLFTGGKVEGE  139

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIH+VLID+N+GHVVT GPES +KLD++VLEGDFNNEDDD+WTQEEF+SHVVKEREG
Sbjct  140  QGAAIHIVLIDANTGHVVTIGPESSVKLDIIVLEGDFNNEDDDNWTQEEFDSHVVKEREG  199

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQVT+
Sbjct  200  KRPLLTGDLQVTM  212



>ref|XP_007025783.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
 gb|EOY28405.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
Length=632

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 176/192 (92%), Gaps = 6/192 (3%)
 Frame = +1

Query  88   MQTRYMERTNSM----RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMER+NSM    RG  S  GDE   P+RKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQTRYMERSNSMAREKRGLDSSSGDE--GPDRKRPALASVIVEALKVDSLQKLCSSLEPI  58

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPA++ A SSPKRIEGPDGRN+Q+HFRSRLSLPLFTGGKVEGEQ
Sbjct  59   LRRVVSEEVERALAKLGPAKLTANSSPKRIEGPDGRNLQVHFRSRLSLPLFTGGKVEGEQ  118

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIH+VLIDSN+ HVVT GPES +KLDVVVLEGDFNNEDDD+WTQEEF+SHVVKEREGK
Sbjct  119  GAAIHIVLIDSNTRHVVTCGPESSVKLDVVVLEGDFNNEDDDNWTQEEFDSHVVKEREGK  178

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  179  RPLLTGDLQVTL  190



>ref|XP_006449222.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62462.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=628

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 174/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMER+NS RG  S    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERSNSKRGLDSSSA-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA +  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  60   VSEEVERALAKLGPAMLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  120  HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  179

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  180  SGDLQVTL  187



>ref|XP_011001128.1| PREDICTED: uncharacterized protein LOC105108501 [Populus euphratica]
Length=637

 Score =   328 bits (842),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 179/195 (92%), Gaps = 7/195 (4%)
 Frame = +1

Query  88   MQTRYMERTNSM----RGKRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSL  246
            MQTRY+ER+NSM    RGKR L+   GD+E QP+RKRPALASVIVEALKVDSLQKLCSSL
Sbjct  1    MQTRYVERSNSMAAAARGKRGLDSSSGDDEGQPDRKRPALASVIVEALKVDSLQKLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            EPILRRVVSEEVERALAKLGPA++  RSSPKR+EGPDGRN+QLHFR+RLSLPLFT GKVE
Sbjct  61   EPILRRVVSEEVERALAKLGPAKLTVRSSPKRLEGPDGRNLQLHFRTRLSLPLFTAGKVE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQG+AIH+VLID N+G VVT+GPES +KLDV+VLEGDFNNED D+WTQEEFESHVVKER
Sbjct  121  GEQGSAIHIVLIDGNTGRVVTSGPESSVKLDVIVLEGDFNNEDGDNWTQEEFESHVVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            EGKRPLLTGDLQVTL
Sbjct  181  EGKRPLLTGDLQVTL  195



>ref|XP_010688497.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688498.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
Length=645

 Score =   327 bits (839),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 180/201 (90%), Gaps = 11/201 (5%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEE-----------QQPERKRPALASVIVEALKVDSLQ  228
            ++ QTR MER+NSMRGKRSL+               +QPERKRPALASVIVEALKVDSLQ
Sbjct  1    MQRQTRSMERSNSMRGKRSLDSGGGDGGDGGGGGDDEQPERKRPALASVIVEALKVDSLQ  60

Query  229  KLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLF  408
            +LCSSLEPILRRVVSEEVERALAK+GPARI+ R+SPKRIEG DGRN+QLHFRS+LSLPLF
Sbjct  61   RLCSSLEPILRRVVSEEVERALAKIGPARISGRASPKRIEGSDGRNLQLHFRSKLSLPLF  120

Query  409  TGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFES  588
            TGGKVEGEQGAAIHVVLID+N+GH+V +GPES MKLDVVVLEGDFNNEDD+DW+QEEFES
Sbjct  121  TGGKVEGEQGAAIHVVLIDANTGHMVISGPESSMKLDVVVLEGDFNNEDDEDWSQEEFES  180

Query  589  HVVKEREGKRPLLTGDLQVTL  651
            HVVKEREGKRPLLTG+LQVTL
Sbjct  181  HVVKEREGKRPLLTGELQVTL  201



>ref|XP_011043291.1| PREDICTED: uncharacterized protein LOC105138780 isoform X4 [Populus 
euphratica]
Length=578

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 176/197 (89%), Gaps = 9/197 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM---------RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCS  240
            MQTRY++R+NSM         RG  S  G +E QPERKRPALASVIVEALKVDSLQ+LCS
Sbjct  1    MQTRYVDRSNSMAAAAPAREKRGLDSSTGGDEGQPERKRPALASVIVEALKVDSLQRLCS  60

Query  241  SLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGK  420
            SLEPILRRVVSEEVERALAKLGPA++  RSSPK +EGP GRN+QLHFRSRLSLPLFTGGK
Sbjct  61   SLEPILRRVVSEEVERALAKLGPAKLTGRSSPKCLEGPGGRNLQLHFRSRLSLPLFTGGK  120

Query  421  VEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVK  600
            VEGEQGAAIHVVLID N+GHVVT+GPES +KLDV+VLEGDFNNEDDD+WTQEEFESHVVK
Sbjct  121  VEGEQGAAIHVVLIDGNTGHVVTSGPESSVKLDVIVLEGDFNNEDDDNWTQEEFESHVVK  180

Query  601  EREGKRPLLTGDLQVTL  651
            EREGKRPLLTGDLQVTL
Sbjct  181  EREGKRPLLTGDLQVTL  197



>ref|XP_010265458.1| PREDICTED: uncharacterized protein LOC104603183 isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDE--EQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            ++ QTRY+ER+N+M R KR L+  E  E QPE+KRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQRQTRYLERSNTMTREKRGLDPSEGEEGQPEKKRPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPAR+  RSSPK+IEGPDGRN+QLHFRSRLSLPLFTGGKVEGE
Sbjct  61   ILRRVVSEEVERALAKLGPARLNGRSSPKQIEGPDGRNLQLHFRSRLSLPLFTGGKVEGE  120

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QG A+HVVL+D+N+GHVVTTGPE+ +KLDVVVLEGDFNNEDDD WTQE+FESHVVKEREG
Sbjct  121  QGTAVHVVLLDANTGHVVTTGPEASVKLDVVVLEGDFNNEDDDGWTQEDFESHVVKEREG  180

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQVTL
Sbjct  181  KRPLLTGDLQVTL  193



>ref|XP_010047006.1| PREDICTED: uncharacterized protein LOC104435977 isoform X2 [Eucalyptus 
grandis]
Length=443

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 178/193 (92%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   IRMQTRYMERTNSM--RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            ++ QTRYMER NSM  RGKRSLEG+++QQ ERKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQRQTRYMERNNSMNNRGKRSLEGEDDQQ-ERKRPALASVIVEALKVDSLQKLCSSLEPI  59

Query  256  LRRVVSEEVERALAKLG-PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            LRRVVSEEVERALAKLG P R+  R+SPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGE
Sbjct  60   LRRVVSEEVERALAKLGGPPRLNGRASPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGE  119

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIH VL+D+N+ HVVT+G ES +KLDVVVLEGDFNNEDD+ WTQEEFESHVVKEREG
Sbjct  120  QGAAIHAVLVDANTSHVVTSGLESSVKLDVVVLEGDFNNEDDEGWTQEEFESHVVKEREG  179

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQ+TL
Sbjct  180  KRPLLTGDLQITL  192



>ref|XP_002316655.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97267.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=637

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 176/196 (90%), Gaps = 8/196 (4%)
 Frame = +1

Query  88   MQTRYMERTNSM--------RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSS  243
            MQTRY++R+NSM        RG  S  G +E QPERKRPALASVIVEALKVDSLQ+LCSS
Sbjct  1    MQTRYVDRSNSMAAAPAREKRGLDSSTGGDEGQPERKRPALASVIVEALKVDSLQRLCSS  60

Query  244  LEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            LEPILRRVVSEEVERALAK+GPA++  RSSPK IEGP GRN+QLHFRSRLSLPLFTGGKV
Sbjct  61   LEPILRRVVSEEVERALAKIGPAKLTGRSSPKCIEGPGGRNLQLHFRSRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIH+VLID N+GHVVT+GPES +KLDV+VLEGDFNNEDDD+WTQEEFESHVVKE
Sbjct  121  EGEQGAAIHIVLIDGNTGHVVTSGPESSVKLDVIVLEGDFNNEDDDNWTQEEFESHVVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGDLQVTL
Sbjct  181  REGKRPLLTGDLQVTL  196



>ref|XP_007225676.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
 gb|EMJ26875.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
Length=633

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            ++ QTR MERTNSMRGKR +EG EE+QPERKRPALASVI+EALKVDSLQKLCSSLEPILR
Sbjct  1    MQRQTRLMERTNSMRGKRQMEGGEEEQPERKRPALASVIIEALKVDSLQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGP R+  RSSPKRIEGP+G+N+QL FRS LSLP+FTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKLGPPRVNGRSSPKRIEGPNGQNLQLEFRSNLSLPIFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D N+  VVT+GPES +KLDVVVLEGDFNNEDD+ WTQEEF+SHVVKEREGKRP
Sbjct  121  AIHVVLVDRNTQRVVTSGPESSVKLDVVVLEGDFNNEDDEGWTQEEFDSHVVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LLTG+LQVTL
Sbjct  181  LLTGELQVTL  190



>ref|XP_011043288.1| PREDICTED: uncharacterized protein LOC105138780 isoform X1 [Populus 
euphratica]
Length=637

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 176/197 (89%), Gaps = 9/197 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM---------RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCS  240
            MQTRY++R+NSM         RG  S  G +E QPERKRPALASVIVEALKVDSLQ+LCS
Sbjct  1    MQTRYVDRSNSMAAAAPAREKRGLDSSTGGDEGQPERKRPALASVIVEALKVDSLQRLCS  60

Query  241  SLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGK  420
            SLEPILRRVVSEEVERALAKLGPA++  RSSPK +EGP GRN+QLHFRSRLSLPLFTGGK
Sbjct  61   SLEPILRRVVSEEVERALAKLGPAKLTGRSSPKCLEGPGGRNLQLHFRSRLSLPLFTGGK  120

Query  421  VEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVK  600
            VEGEQGAAIHVVLID N+GHVVT+GPES +KLDV+VLEGDFNNEDDD+WTQEEFESHVVK
Sbjct  121  VEGEQGAAIHVVLIDGNTGHVVTSGPESSVKLDVIVLEGDFNNEDDDNWTQEEFESHVVK  180

Query  601  EREGKRPLLTGDLQVTL  651
            EREGKRPLLTGDLQVTL
Sbjct  181  EREGKRPLLTGDLQVTL  197



>gb|EYU20919.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=611

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 178/193 (92%), Gaps = 5/193 (3%)
 Frame = +1

Query  88   MQTRYMERTNSM--RGKRSLEG---DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            MQTRYMERTNSM  RGKRSLEG   +E+Q+ ERKRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQTRYMERTNSMKGRGKRSLEGGDDEEKQESERKRPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPAR+  RSSPKRI+GP GRN+QLHF+SRLS PLFTGGKVEGE
Sbjct  61   ILRRVVSEEVERALAKLGPARLEGRSSPKRIDGPGGRNLQLHFKSRLSFPLFTGGKVEGE  120

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIHVVLID+N+G  VT GPES +KLDVVVLEGDFNNED++ W+QEEF+SH+VKEREG
Sbjct  121  QGAAIHVVLIDANTGRAVTAGPESSVKLDVVVLEGDFNNEDEEGWSQEEFDSHLVKEREG  180

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQVTL
Sbjct  181  KRPLLTGDLQVTL  193



>ref|XP_011043289.1| PREDICTED: uncharacterized protein LOC105138780 isoform X2 [Populus 
euphratica]
Length=626

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 176/197 (89%), Gaps = 9/197 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM---------RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCS  240
            MQTRY++R+NSM         RG  S  G +E QPERKRPALASVIVEALKVDSLQ+LCS
Sbjct  1    MQTRYVDRSNSMAAAAPAREKRGLDSSTGGDEGQPERKRPALASVIVEALKVDSLQRLCS  60

Query  241  SLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGK  420
            SLEPILRRVVSEEVERALAKLGPA++  RSSPK +EGP GRN+QLHFRSRLSLPLFTGGK
Sbjct  61   SLEPILRRVVSEEVERALAKLGPAKLTGRSSPKCLEGPGGRNLQLHFRSRLSLPLFTGGK  120

Query  421  VEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVK  600
            VEGEQGAAIHVVLID N+GHVVT+GPES +KLDV+VLEGDFNNEDDD+WTQEEFESHVVK
Sbjct  121  VEGEQGAAIHVVLIDGNTGHVVTSGPESSVKLDVIVLEGDFNNEDDDNWTQEEFESHVVK  180

Query  601  EREGKRPLLTGDLQVTL  651
            EREGKRPLLTGDLQVTL
Sbjct  181  EREGKRPLLTGDLQVTL  197



>gb|EYU20920.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=629

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 178/193 (92%), Gaps = 5/193 (3%)
 Frame = +1

Query  88   MQTRYMERTNSM--RGKRSLEG---DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            MQTRYMERTNSM  RGKRSLEG   +E+Q+ ERKRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQTRYMERTNSMKGRGKRSLEGGDDEEKQESERKRPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPAR+  RSSPKRI+GP GRN+QLHF+SRLS PLFTGGKVEGE
Sbjct  61   ILRRVVSEEVERALAKLGPARLEGRSSPKRIDGPGGRNLQLHFKSRLSFPLFTGGKVEGE  120

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIHVVLID+N+G  VT GPES +KLDVVVLEGDFNNED++ W+QEEF+SH+VKEREG
Sbjct  121  QGAAIHVVLIDANTGRAVTAGPESSVKLDVVVLEGDFNNEDEEGWSQEEFDSHLVKEREG  180

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQVTL
Sbjct  181  KRPLLTGDLQVTL  193



>gb|KHG27572.1| Cytochrome P450 [Gossypium arboreum]
Length=643

 Score =   325 bits (833),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYM RTNSM RGKRSLEGDE+QQPE KRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMTRTNSMVRGKRSLEGDEDQQPEPKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKL P R+  RSSPK +EGP G ++QL FRSRLSLPL+TGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLAPPRLNGRSSPKCLEGPGGGSLQLRFRSRLSLPLYTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIH+VL+DSN+GHVVTTGPE+ MKLDVVVLEGDF NEDD+DWTQEEF+SH+VKER GKR
Sbjct  121  AAIHIVLVDSNTGHVVTTGPEASMKLDVVVLEGDFTNEDDEDWTQEEFDSHLVKERPGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_007025782.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY28404.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=635

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 177/195 (91%), Gaps = 9/195 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM----RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMER+NSM    RG  S  GDE   P+RKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQTRYMERSNSMAREKRGLDSSSGDE--GPDRKRPALASVIVEALKVDSLQKLCSSLEPI  58

Query  256  LRRVVSEEVERALAKLGPARIAAR---SSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            LRRVVSEEVERALAKLGPA++ A+   SSPKRIEGPDGRN+Q+HFRSRLSLPLFTGGKVE
Sbjct  59   LRRVVSEEVERALAKLGPAKLTAKKCSSSPKRIEGPDGRNLQVHFRSRLSLPLFTGGKVE  118

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIH+VLIDSN+ HVVT GPES +KLDVVVLEGDFNNEDDD+WTQEEF+SHVVKER
Sbjct  119  GEQGAAIHIVLIDSNTRHVVTCGPESSVKLDVVVLEGDFNNEDDDNWTQEEFDSHVVKER  178

Query  607  EGKRPLLTGDLQVTL  651
            EGKRPLLTGDLQVTL
Sbjct  179  EGKRPLLTGDLQVTL  193



>gb|KDO75730.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=627

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 2/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTRYMER+NS RG  S    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTRYMERSNSKRGLDSSSA-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
             SEEVERALAKLGPA++  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  60   -SEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  118

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  119  HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  178

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  179  SGDLQVTL  186



>ref|XP_006384008.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
 gb|ERP61805.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
Length=640

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 179/198 (90%), Gaps = 10/198 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM----RGKRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSL  246
            MQT Y+ER+NSM    RGKR L+   GD+E QP+RKRPALASVIVEALKVDSLQKLCSSL
Sbjct  1    MQTGYVERSNSMAAAARGKRGLDSSSGDDEGQPDRKRPALASVIVEALKVDSLQKLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPARIA---ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            EPILRRVVSEEVERALAKLGPA++     RSSPKR+EGPDGRN+QLHFRSRLSLPLFT G
Sbjct  61   EPILRRVVSEEVERALAKLGPAKLTVRECRSSPKRLEGPDGRNLQLHFRSRLSLPLFTAG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIH+VLID N+G VVT+GPES +KLDV+VLEGDFNNEDDD+WT+EEFESHVV
Sbjct  121  KVEGEQGAAIHIVLIDGNTGRVVTSGPESSVKLDVIVLEGDFNNEDDDNWTREEFESHVV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>ref|XP_004485707.1| PREDICTED: uncharacterized protein LOC101498971 [Cicer arietinum]
Length=634

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRG-KRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            M+TRYMER+NSM   KRSL+    EE QPERKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MKTRYMERSNSMAMEKRSLDSSASEEDQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA  + RSSPKRIEGPDGRN+QL FR+RLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPANFSERSSPKRIEGPDGRNLQLQFRTRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
             AIH+VLID+N+GHVVT+GP SC++LD++VLEGDFNNEDDD W++EEFESHVVKEREGKR
Sbjct  121  TAIHIVLIDANTGHVVTSGPSSCVRLDIIVLEGDFNNEDDDTWSEEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDL VTL
Sbjct  181  PLLTGDLLVTL  191



>gb|KJB83411.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83412.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83413.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
Length=644

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            ++ QTRYM RTNSM RGKRSLEGDE+QQPE KRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQRQTRYMTRTNSMVRGKRSLEGDEDQQPEPKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKL P R+  RSSPK +EGP G ++QL FRSRLSLPL+TGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLAPPRLNGRSSPKCLEGPGGGSLQLRFRSRLSLPLYTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIH+VL+DSN+ HVVTTGPE+ MKLDVVVLEGDF+NEDD+DWTQEEF+SH+VKER GKR
Sbjct  121  AAIHIVLVDSNTAHVVTTGPEASMKLDVVVLEGDFSNEDDEDWTQEEFDSHLVKERPGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_002524676.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF37695.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 5/192 (3%)
 Frame = +1

Query  88   MQTRYMERTNSM----RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTR+MER++SM    RG  S  GDE  QP++KRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQTRFMERSSSMAREKRGLDSSSGDE-GQPDKKRPALASVIVEALKVDSLQKLCSSLEPI  59

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLG A++  RSSPK I GPDGRN+QLHFRSRLSLPLFTGGKVEGEQ
Sbjct  60   LRRVVSEEVERALAKLGSAKLTGRSSPKCIGGPDGRNLQLHFRSRLSLPLFTGGKVEGEQ  119

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAA+H+VLID+N+GHVVT+GPES +KLDV+VLEGDFNNEDDD+WT EEF+SHVVKEREGK
Sbjct  120  GAAVHIVLIDANTGHVVTSGPESSVKLDVIVLEGDFNNEDDDNWTPEEFDSHVVKEREGK  179

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  180  RPLLTGDLQVTL  191



>ref|XP_009376054.1| PREDICTED: uncharacterized protein LOC103964603 isoform X2 [Pyrus 
x bretschneideri]
Length=637

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 178/191 (93%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KRSL+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRSLDSSSPEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPK+IEGPDGRN+QLHFRSRLSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKQIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEWG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AI +VLID+N+ +VVT+GPES +KLDVVVLEGDFNNEDD++WT+EEFESHVVKEREGKR
Sbjct  121  SAIPIVLIDANTKNVVTSGPESAVKLDVVVLEGDFNNEDDENWTEEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_010047003.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047005.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78744.1| hypothetical protein EUGRSUZ_C00185 [Eucalyptus grandis]
Length=635

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 178/193 (92%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   IRMQTRYMERTNSM--RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            ++ QTRYMER NSM  RGKRSLEG+++QQ ERKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQRQTRYMERNNSMNNRGKRSLEGEDDQQ-ERKRPALASVIVEALKVDSLQKLCSSLEPI  59

Query  256  LRRVVSEEVERALAKLG-PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            LRRVVSEEVERALAKLG P R+  R+SPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGE
Sbjct  60   LRRVVSEEVERALAKLGGPPRLNGRASPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGE  119

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIH VL+D+N+ HVVT+G ES +KLDVVVLEGDFNNEDD+ WTQEEFESHVVKEREG
Sbjct  120  QGAAIHAVLVDANTSHVVTSGLESSVKLDVVVLEGDFNNEDDEGWTQEEFESHVVKEREG  179

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDLQ+TL
Sbjct  180  KRPLLTGDLQITL  192



>ref|XP_010646160.1| PREDICTED: uncharacterized protein LOC100256775 [Vitis vinifera]
Length=631

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NS+ R KR+L+    EE Q +RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSLAREKRALDPSSTEEGQSDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
              IH+VL+D+++GHVVT+GPES +KLDVVVLEGDFNNEDDD W QEEFESHVVKEREGKR
Sbjct  121  TTIHIVLLDASTGHVVTSGPESSVKLDVVVLEGDFNNEDDDGWNQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>emb|CAN66517.1| hypothetical protein VITISV_001611 [Vitis vinifera]
Length=637

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NS+ R KR+L+    EE Q +RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSLAREKRALDPSSTEEGQSDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
              IH+VL+D+++GHVVT+GPES +KLDVVVLEGDFNNEDDD W QEEFESHVVKEREGKR
Sbjct  121  TTIHIVLLDASTGHVVTSGPESSVKLDVVVLEGDFNNEDDDGWNQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>emb|CBI23322.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NS+ R KR+L+    EE Q +RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSLAREKRALDPSSTEEGQSDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
              IH+VL+D+++GHVVT+GPES +KLDVVVLEGDFNNEDDD W QEEFESHVVKEREGKR
Sbjct  121  TTIHIVLLDASTGHVVTSGPESSVKLDVVVLEGDFNNEDDDGWNQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_010265456.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265457.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 179/196 (91%), Gaps = 6/196 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLEGDE--EQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            ++ QTRY+ER+N+M R KR L+  E  E QPE+KRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQRQTRYLERSNTMTREKRGLDPSEGEEGQPEKKRPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAAR---SSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRRVVSEEVERALAKLGPAR+  R   SSPK+IEGPDGRN+QLHFRSRLSLPLFTGGKV
Sbjct  61   ILRRVVSEEVERALAKLGPARLNGRKCRSSPKQIEGPDGRNLQLHFRSRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQG A+HVVL+D+N+GHVVTTGPE+ +KLDVVVLEGDFNNEDDD WTQE+FESHVVKE
Sbjct  121  EGEQGTAVHVVLLDANTGHVVTTGPEASVKLDVVVLEGDFNNEDDDGWTQEDFESHVVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGDLQVTL
Sbjct  181  REGKRPLLTGDLQVTL  196



>ref|XP_010536924.1| PREDICTED: uncharacterized protein LOC104811802 [Tarenaya hassleriana]
Length=646

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 173/186 (93%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            M+R N+M R KR+ +G+++ QPERKRPALASVIVEALKVDSLQK+CSSLEPILRRVVSEE
Sbjct  1    MDRANNMNRSKRNFDGNDDDQPERKRPALASVIVEALKVDSLQKICSSLEPILRRVVSEE  60

Query  280  VERALAKLGPARIA--ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            VERALAK+GPARIA  +RSSPKRIEGP GRN+QLHFRSRLSLPLFTGG+VEGEQGAAIHV
Sbjct  61   VERALAKIGPARIAGSSRSSPKRIEGPGGRNLQLHFRSRLSLPLFTGGRVEGEQGAAIHV  120

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            +LID+NSGH VT GPE+  KLDVVVLEGDFNNEDD+DWTQEEFESH+VKEREGKRPLL G
Sbjct  121  ILIDANSGHAVTFGPEASAKLDVVVLEGDFNNEDDEDWTQEEFESHIVKEREGKRPLLAG  180

Query  634  DLQVTL  651
            DLQVTL
Sbjct  181  DLQVTL  186



>ref|XP_007154785.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
 gb|ESW26779.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
Length=637

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKRSLEG E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  13   GKRSLEGGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  72

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PARI  RS PK IEGPDGRN+QLHF+SRLSLPLFTGGKVEGEQGA IHVVLIDSNSG VV
Sbjct  73   PARIGGRSPPKMIEGPDGRNLQLHFKSRLSLPLFTGGKVEGEQGAPIHVVLIDSNSGSVV  132

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            T+GPES +KLDVVVLEGDFNNEDD+DWTQ+ FESHVVKEREGKRPLLTGDLQVTL
Sbjct  133  TSGPESSVKLDVVVLEGDFNNEDDEDWTQDHFESHVVKEREGKRPLLTGDLQVTL  187



>ref|XP_010414641.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
 ref|XP_010414649.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
Length=624

 Score =   319 bits (818),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYMERTNSMR KR LE D  ++QQPERKRPALASVIVEALK+DSLQ+LCSSLEPILR
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPAR+  RSSPKRIEG DGRN+QL FRSRLS+PLFTGGK+EGEQGA
Sbjct  61   RVVSEEVERALAKLGPARLNDRSSPKRIEGIDGRNLQLQFRSRLSVPLFTGGKIEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D N+GHV+T GPE+  KLDVVVL+GDFN EDD+ WT+EEFE H+VKER+GKRP
Sbjct  121  AIHVVLLDMNTGHVLTVGPEASAKLDVVVLDGDFNTEDDEGWTEEEFEGHLVKERQGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGD+QVTL
Sbjct  181  LLTGDVQVTL  190



>ref|XP_008364144.1| PREDICTED: uncharacterized protein LOC103427840 isoform X2 [Malus 
domestica]
Length=637

 Score =   319 bits (818),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 177/191 (93%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KRSL+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRSLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPK+I GPDGR++QLHFRSRLSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKQIGGPDGRDLQLHFRSRLSLPLFTGGKVEGEWG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AI +VLID+N+ HVVT+GPES +KLDVVVLEGDFNNEDD++WT+EEFESHVVKEREGKR
Sbjct  121  SAIPIVLIDANTKHVVTSGPESAVKLDVVVLEGDFNNEDDENWTEEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_003549493.1| PREDICTED: uncharacterized protein LOC100803029 isoform X1 [Glycine 
max]
 ref|XP_006600498.1| PREDICTED: uncharacterized protein LOC100803029 isoform X2 [Glycine 
max]
Length=627

 Score =   319 bits (818),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKRSLEG E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  12   GKRSLEGGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  71

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RS PK IEGPDGR++QL FRSRLSLPLFTGGKVEGEQGA IHVVLID+NSG +V
Sbjct  72   PARLSGRSPPKMIEGPDGRSLQLKFRSRLSLPLFTGGKVEGEQGAPIHVVLIDANSGSIV  131

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            T+GPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  132  TSGPESCVKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  186



>gb|KHN17575.1| hypothetical protein glysoja_005772 [Glycine soja]
Length=627

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKRSLEG E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  12   GKRSLEGGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  71

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RS PK IEGPDGR++QL FRSRLSLPLFTGGKVEGEQGA IHVVLID+NSG +V
Sbjct  72   PARLSGRSPPKMIEGPDGRSLQLKFRSRLSLPLFTGGKVEGEQGAPIHVVLIDANSGSIV  131

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            T+GPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  132  TSGPESCVKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  186



>ref|XP_011457401.1| PREDICTED: uncharacterized protein LOC101314910 [Fragaria vesca 
subsp. vesca]
Length=639

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            ++ QTR MER NSMRGKR  EG EE+QPERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQRQTRLMERNNSMRGKRQAEGGEEEQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGP R+  RSSPKRIEG + RN+QL F+S L+LP+FTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKLGPPRLNGRSSPKRIEGSNERNLQLQFKSNLALPIFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            +IHVVL+D+NS  VVT+GPES +KLD+VVLEGDFNNEDD+ WTQEEFESHVVKEREGKRP
Sbjct  121  SIHVVLVDTNSRCVVTSGPESSIKLDIVVLEGDFNNEDDEGWTQEEFESHVVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGDLQVTL
Sbjct  181  LLTGDLQVTL  190



>gb|KEH36516.1| calmodulin-binding protein [Medicago truncatula]
Length=634

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 174/191 (91%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KR+L+    +E QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRTLDSTSTDEDQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKL P  ++ RSSPKRIE PDG N+QL FR+RLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLAPTNLSGRSSPKRIENPDGGNLQLKFRTRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
             AIH+VLID+N+GHVVT+GP SC++LDV+VLEGDFNNEDDD W+QEEF+SH+VKEREGKR
Sbjct  121  TAIHIVLIDANTGHVVTSGPASCVRLDVIVLEGDFNNEDDDTWSQEEFDSHIVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_004507834.1| PREDICTED: uncharacterized protein LOC101488801 isoform X4 [Cicer 
arietinum]
Length=625

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKR+LE  E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  2    GKRTLENGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  61

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RSSPK IEGPDGRN++L FRSRLSLPLFTGGKVEGEQGA IHVVLID+NS +VV
Sbjct  62   PARLSGRSSPKMIEGPDGRNLRLQFRSRLSLPLFTGGKVEGEQGAPIHVVLIDANSRNVV  121

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            TTGPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  122  TTGPESCIKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  176



>ref|XP_010489590.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489591.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489592.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
Length=624

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYMERTNSMR KR LE D  ++QQPERKRPALASVIVEALK+DSLQ+LCSSLEPILR
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQGA
Sbjct  61   RVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D N+GHV+T GPE+  KLDVVVL+GDFN EDD+ WT+EEFE H+VKER+GKRP
Sbjct  121  AIHVVLLDMNTGHVLTVGPEASAKLDVVVLDGDFNTEDDEGWTEEEFEGHLVKERQGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGD+QVTL
Sbjct  181  LLTGDVQVTL  190



>ref|XP_004507832.1| PREDICTED: uncharacterized protein LOC101488801 isoform X2 [Cicer 
arietinum]
 ref|XP_004507833.1| PREDICTED: uncharacterized protein LOC101488801 isoform X3 [Cicer 
arietinum]
Length=635

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKR+LE  E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  12   GKRTLENGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  71

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RSSPK IEGPDGRN++L FRSRLSLPLFTGGKVEGEQGA IHVVLID+NS +VV
Sbjct  72   PARLSGRSSPKMIEGPDGRNLRLQFRSRLSLPLFTGGKVEGEQGAPIHVVLIDANSRNVV  131

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            TTGPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  132  TTGPESCIKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  186



>ref|XP_004507831.1| PREDICTED: uncharacterized protein LOC101488801 isoform X1 [Cicer 
arietinum]
Length=694

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 172/187 (92%), Gaps = 3/187 (2%)
 Frame = +1

Query  100  YMERTNS---MRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV  270
            YM+R  +     GKR+LE  E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV
Sbjct  59   YMQRPTTDGISMGKRTLENGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV  118

Query  271  SEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            SEEVERALAKLGPAR++ RSSPK IEGPDGRN++L FRSRLSLPLFTGGKVEGEQGA IH
Sbjct  119  SEEVERALAKLGPARLSGRSSPKMIEGPDGRNLRLQFRSRLSLPLFTGGKVEGEQGAPIH  178

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+NS +VVTTGPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLT
Sbjct  179  VVLIDANSRNVVTTGPESCIKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLT  238

Query  631  GDLQVTL  651
            GDLQVTL
Sbjct  239  GDLQVTL  245



>ref|XP_007213593.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
 gb|EMJ14792.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
Length=638

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRGLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLG A++  RSSPK+I GPDGR++QLHFRSRLSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVERALAKLGSAKLTGRSSPKQIGGPDGRHLQLHFRSRLSLPLFTGGKVEGEWG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AI +VLID+N+ HVVT+GPES +KLDVVVLEGDFNNEDDD+WTQEEFESHVVKEREGKR
Sbjct  121  SAIPIVLIDANTKHVVTSGPESVVKLDVVVLEGDFNNEDDDNWTQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>gb|KHN22715.1| hypothetical protein glysoja_027603 [Glycine soja]
Length=631

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKRSLEG E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  12   GKRSLEGGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  71

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RS PK IEGPDGR++QL FRSRLSLPLFTGGKVEGEQGA IHVVL+D NSG VV
Sbjct  72   PARLSGRSPPKMIEGPDGRSLQLKFRSRLSLPLFTGGKVEGEQGAPIHVVLMDVNSGSVV  131

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            T+GPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  132  TSGPESCVKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  186



>ref|XP_003542171.1| PREDICTED: uncharacterized protein LOC100790087 isoform X1 [Glycine 
max]
 ref|XP_006593544.1| PREDICTED: uncharacterized protein LOC100790087 isoform X2 [Glycine 
max]
Length=631

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  127  GKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            GKRSLEG E+ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG
Sbjct  12   GKRSLEGGEDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  71

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
            PAR++ RS PK IEGPDGR++QL FRSRLSLPLFTGGKVEGEQGA IHVVL+D NSG VV
Sbjct  72   PARLSGRSPPKMIEGPDGRSLQLKFRSRLSLPLFTGGKVEGEQGAPIHVVLMDVNSGSVV  131

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            T+GPESC+KLDVVVLEGDFNNEDD+DWTQE+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  132  TSGPESCVKLDVVVLEGDFNNEDDEDWTQEDFESHVVKEREGKRPLLTGDLQVTL  186



>ref|XP_009375849.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375923.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375988.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KRSL+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRSLDSSSPEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARI-AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPA++  +RSSPK+IEGPDGRN+QLHFRSRLSLPLFTGGKVEGE 
Sbjct  61   RRVVSEEVERALAKLGPAKLTGSRSSPKQIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEW  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            G+AI +VLID+N+ +VVT+GPES +KLDVVVLEGDFNNEDD++WT+EEFESHVVKEREGK
Sbjct  121  GSAIPIVLIDANTKNVVTSGPESAVKLDVVVLEGDFNNEDDENWTEEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_008383819.1| PREDICTED: uncharacterized protein LOC103446473 [Malus domestica]
 ref|XP_008358694.1| PREDICTED: uncharacterized protein LOC103422407 [Malus domestica]
Length=636

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KRSL+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRSLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPA++  RSSPK+IEGP+GRN+QLHF S+LSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPKQIEGPNGRNLQLHFISKLSLPLFTGGKVEGEWG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AI +VLID+N+ HVVT+GPES +KLD+VVLEGDFNNEDD++WTQEEFESHVVKEREGKR
Sbjct  121  SAISIVLIDANTKHVVTSGPESAVKLDIVVLEGDFNNEDDENWTQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGD+QVTL
Sbjct  181  PLLTGDVQVTL  191



>ref|XP_010696620.1| PREDICTED: uncharacterized protein LOC104909117 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 176/196 (90%), Gaps = 8/196 (4%)
 Frame = +1

Query  88   MQTRYMERTNSMRG--KRSLEG----DEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MQTRYMER+NSM G  KRSL+     DE+ QP+RKRPALASVIVEALKVDSLQ+LCSSLE
Sbjct  1    MQTRYMERSNSMGGREKRSLDSNSNVDEDAQPDRKRPALASVIVEALKVDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAA--RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            PILRRVVSEEVERALAKLGPAR+    RSSPKRIE PDGRN+QL FRSRLSLPLFTGGKV
Sbjct  61   PILRRVVSEEVERALAKLGPARLVGNGRSSPKRIEAPDGRNLQLQFRSRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQG+AIH+VLID+N+G +V TGPES  KLD+VVLEGDFN+EDD DWTQE+FESHVVKE
Sbjct  121  EGEQGSAIHIVLIDANTGQLVATGPESSAKLDIVVLEGDFNDEDDADWTQEDFESHVVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGD+QVTL
Sbjct  181  REGKRPLLTGDVQVTL  196



>emb|CDP02958.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 172/189 (91%), Gaps = 11/189 (6%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQTR          KR L+G+++QQ ERKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQTR----------KRILDGEDDQQQERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  50

Query  268  VSEEVERALAKLGPARIAARSS-PKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VSEEVERALAKLGPA++  RSS PKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQGAA
Sbjct  51   VSEEVERALAKLGPAKLTGRSSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGAA  110

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVLID+N+GHVVT+GPESC+KLDV+VLEGDFN ED++ WTQEEFESHVVKEREGKRPL
Sbjct  111  IHVVLIDANTGHVVTSGPESCVKLDVIVLEGDFNTEDNESWTQEEFESHVVKEREGKRPL  170

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  171  LTGDLQVTL  179



>emb|CDO99627.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQ R  +++NSM R KRSL+     ++ QPERKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQARIFQKSNSMAREKRSLDQSTSSDDGQPERKRPALASVIVEALKVDSLQKLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPA+I  R+SPKRIEGPDGRN+QL FR++LSLPLFTGGKVEGEQ
Sbjct  61   LRRVVSEEVERALAKLGPAKINGRTSPKRIEGPDGRNLQLQFRTKLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIH+VL+D+ SGHVVT+GPES  KLD+VVLEGDFNNEDDD WTQEEF+SHVVKEREGK
Sbjct  121  GAAIHIVLVDAVSGHVVTSGPESSAKLDIVVLEGDFNNEDDDGWTQEEFDSHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_011096210.1| PREDICTED: uncharacterized protein LOC105175464 [Sesamum indicum]
Length=636

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 175/192 (91%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM--RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            M T Y+ER+N M  R KRSL+    +E QP+RKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MHTGYVERSNGMAAREKRSLDPSSSQEAQPDRKRPALASVIVEALKVDSLQKLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPA++  R SPKRIEGPDGRN+QL FRS+LSLPLFTGGKVEGEQ
Sbjct  61   LRRVVSEEVERALAKLGPAKLNGRVSPKRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIH+VLID+N+GHVVT+GPES +KLD+VVLEGDFNNEDD+ W+QEEFESH+V+EREGK
Sbjct  121  GAAIHIVLIDANTGHVVTSGPESSVKLDIVVLEGDFNNEDDEGWSQEEFESHIVREREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_008224946.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
 ref|XP_008224947.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
Length=638

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRGLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLG A++  RSSPK+IEGPDGR++QLHFRSRLSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVERALAKLGSAKLTGRSSPKQIEGPDGRHLQLHFRSRLSLPLFTGGKVEGEWG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AI +VLID+N+  VVT+GPES +KLDVVVLEGDFNNEDDD+WTQEEFESHVVKEREGKR
Sbjct  121  SAIPIVLIDANTKLVVTSGPESVVKLDVVVLEGDFNNEDDDNWTQEEFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>ref|XP_004293506.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460292.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
Length=636

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRGLDSAAAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSP-KRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPA++  RSSP K+IEGPDGRN+QLHFRSRLSLPLFTGGKVEGE 
Sbjct  61   RRVVSEEVERALAKLGPAKLTGRSSPPKQIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEW  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAI +VLID+N+  VVTTGPES  KLDV+VLEGDFNNEDDD+WT+EEF+SHVVKEREGK
Sbjct  121  GAAIPIVLIDANTNRVVTTGPESVAKLDVIVLEGDFNNEDDDNWTEEEFDSHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_006409114.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 ref|XP_006409115.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50567.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50568.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
Length=608

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDE-EQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRR  264
            MQTRYMERTNSMR KR LE D  +QQPERKRPALASVIVEALK+DSLQ+LCSSLEPILRR
Sbjct  1    MQTRYMERTNSMREKRKLEEDNNQQQPERKRPALASVIVEALKMDSLQRLCSSLEPILRR  60

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQGAA
Sbjct  61   VVSEEVERALAKLGPARLSERSSPKRIEGVGGRNLQLQFRSRLSVPLFTGGKIEGEQGAA  120

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D  +GHV+T GPE+  KLDVVVL+GDFNNEDD+ W+ EEF+ H+VKER+GKRPL
Sbjct  121  IHVVLLDVTTGHVLTVGPEASAKLDVVVLDGDFNNEDDEGWSGEEFDGHLVKERQGKRPL  180

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  181  LTGDLQVTL  189



>gb|AAD08944.2| putative calmodulin-binding protein [Arabidopsis thaliana]
Length=353

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQ----PERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMERTNSMR KR LE D+ QQ    PERKRPALASVIVEALK+DSLQ+LCSSLEPI
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQ
Sbjct  61   LRRVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D  +GHV+T GPE+  KLDVVVL+GDFN EDDD W+ EEFE H+VKER+GK
Sbjct  121  GAAIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDDGWSGEEFEGHLVKERQGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGD+QVTL
Sbjct  181  RPLLTGDVQVTL  192



>ref|XP_002270522.1| PREDICTED: uncharacterized protein LOC100264980 isoform X1 [Vitis 
vinifera]
Length=642

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = +1

Query  85   RMQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            R  TR MER+N+M RGKR+LEG+EE+QPERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  3    RPTTRLMERSNTMNRGKRTLEGEEEEQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  62

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPAR+  RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQGA
Sbjct  63   RVVSEEVERALAKLGPARLNGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQGA  122

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VL+D+NSG VVT+GPES +KLDVVVLEGDFNNED++ WTQEEF+SHVVKEREGKRP
Sbjct  123  AIHIVLVDANSGSVVTSGPESSVKLDVVVLEGDFNNEDEEGWTQEEFDSHVVKEREGKRP  182

Query  622  LLTGDLQVTL  651
            LLTGDLQVTL
Sbjct  183  LLTGDLQVTL  192



>ref|XP_008364142.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
 ref|XP_008364143.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
Length=638

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 178/192 (93%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KRSL+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRSLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARI-AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLGPA++  +RSSPK+I GPDGR++QLHFRSRLSLPLFTGGKVEGE 
Sbjct  61   RRVVSEEVERALAKLGPAKLTGSRSSPKQIGGPDGRDLQLHFRSRLSLPLFTGGKVEGEW  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            G+AI +VLID+N+ HVVT+GPES +KLDVVVLEGDFNNEDD++WT+EEFESHVVKEREGK
Sbjct  121  GSAIPIVLIDANTKHVVTSGPESAVKLDVVVLEGDFNNEDDENWTEEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_004146305.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 ref|XP_004165695.1| PREDICTED: uncharacterized LOC101216741 [Cucumis sativus]
 gb|KGN65434.1| hypothetical protein Csa_1G422430 [Cucumis sativus]
Length=636

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +1

Query  91   QTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV  270
            QTRYMERTNSMR KR LEG E++ PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV
Sbjct  3    QTRYMERTNSMREKRGLEGGEDELPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVV  62

Query  271  SEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            SEEVERALAK+GPARI+ RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQGAAIH
Sbjct  63   SEEVERALAKIGPARISGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGAAIH  122

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVL+DSN+GHVVT+G E+  KLD+VVLEGDFNNEDD+DWT+EEFESHVVKEREGKRPLLT
Sbjct  123  VVLVDSNTGHVVTSGQEALTKLDIVVLEGDFNNEDDEDWTEEEFESHVVKEREGKRPLLT  182

Query  631  GDLQVTL  651
            GDLQVTL
Sbjct  183  GDLQVTL  189



>emb|CDY29246.1| BnaA06g25110D [Brassica napus]
Length=625

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEE---QQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            M TRYMERTNSMR KR LE +++   QQPERKRPALASVIVEALK+DSLQ+LCSSLEPIL
Sbjct  1    MHTRYMERTNSMREKRKLEEEDDNNNQQPERKRPALASVIVEALKMDSLQRLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQG
Sbjct  61   RRVVSEEVERALAKLGPARVSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIHVVL+DS +G V+TTGPE+  KLDVVVL+GDFNNEDD+ W++EEFESH+VKER+GKR
Sbjct  121  AAIHVVLLDSTTGRVLTTGPEASAKLDVVVLDGDFNNEDDEGWSEEEFESHLVKERQGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGD+QVTL
Sbjct  181  PLLTGDVQVTL  191



>ref|XP_008453624.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453625.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453626.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
Length=637

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            ++ QTRYMERTNSMR KR LEG E++ PERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQRQTRYMERTNSMREKRGLEGGEDELPERKRPALASVIVEALKVDSLQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAK+GPARI+ RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKIGPARISGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D+N+GHVVT+G E+  KLD+VVLEGDFNNEDD+DWT+EEFESHVVKEREGKRP
Sbjct  121  AIHVVLVDANTGHVVTSGQEALTKLDIVVLEGDFNNEDDEDWTEEEFESHVVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGDLQVTL
Sbjct  181  LLTGDLQVTL  190



>ref|XP_011044001.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044002.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044003.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044004.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
Length=647

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 175/196 (89%), Gaps = 8/196 (4%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQ-------PERKRPALASVIVEALKVDSLQKLCSS  243
            M TRYMERTNSM R KR LEG   ++       PERKRPALASVIVEALKVDSLQKLCSS
Sbjct  1    MHTRYMERTNSMARRKRGLEGGGAEEEEQQQQQPERKRPALASVIVEALKVDSLQKLCSS  60

Query  244  LEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            LEPILRRVVSEEVERALAK+GPAR   RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKV
Sbjct  61   LEPILRRVVSEEVERALAKIGPARQIGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+++GHVVT+G E+ +KLDVVVLEGDFNNE D+ WTQEEFESHVVKE
Sbjct  121  EGEQGAAIHVVLVDASTGHVVTSGTEAFVKLDVVVLEGDFNNEADEGWTQEEFESHVVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGDLQVTL
Sbjct  181  REGKRPLLTGDLQVTL  196



>ref|XP_011018189.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018190.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018191.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018192.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
Length=647

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 175/196 (89%), Gaps = 8/196 (4%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQ-------PERKRPALASVIVEALKVDSLQKLCSS  243
            M TRYMERTNSM R KR LEG   ++       PERKRPALASVIVEALKVDSLQKLCSS
Sbjct  1    MHTRYMERTNSMARRKRGLEGGGAEEEEQQQQQPERKRPALASVIVEALKVDSLQKLCSS  60

Query  244  LEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            LEPILRRVVSEEVERALAK+GPAR   RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKV
Sbjct  61   LEPILRRVVSEEVERALAKIGPARQIGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+++GHVVT+G E+ +KLDVVVLEGDFNNE D+ WTQEEFESHVVKE
Sbjct  121  EGEQGAAIHVVLVDASTGHVVTSGTEAFVKLDVVVLEGDFNNEADEGWTQEEFESHVVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGDLQVTL
Sbjct  181  REGKRPLLTGDLQVTL  196



>ref|XP_009150716.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150718.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150719.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150720.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
Length=626

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEE---QQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            M TRYMERTNSMR KR LE +++   QQPERKRPALASVIVEALK+DSLQ+LCSSLEPIL
Sbjct  1    MHTRYMERTNSMREKRKLEEEDDNNNQQPERKRPALASVIVEALKMDSLQRLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQG
Sbjct  61   RRVVSEEVERALAKLGPARVSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIHVVL+DS +G V+TTGPE+  KLDVVVL+GDFNNEDD+ W++EEFESH+VKER+GKR
Sbjct  121  AAIHVVLLDSTTGRVLTTGPEASAKLDVVVLDGDFNNEDDEGWSEEEFESHLVKERQGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGD+QVTL
Sbjct  181  PLLTGDVQVTL  191



>ref|XP_010467708.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
 ref|XP_010467709.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
Length=629

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 7/195 (4%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQ-------PERKRPALASVIVEALKVDSLQKLCSSL  246
            MQTRYMERTNSMR KR LE D+ QQ       PERKRPALASVIVEALK+DSLQ+LCSSL
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQQQQQQPERKRPALASVIVEALKMDSLQRLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            EPILRRVVSEEVERALAKLGPAR++ RSSPKRIEG DGRN+QL FRSRLS+PLFTGGK+E
Sbjct  61   EPILRRVVSEEVERALAKLGPARLSERSSPKRIEGIDGRNLQLQFRSRLSVPLFTGGKIE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D N+GHV+T GPE+  KLDVVVL+GDFN EDD+ WT+EEFE H+VKER
Sbjct  121  GEQGAAIHVVLLDMNTGHVLTVGPEASAKLDVVVLDGDFNTEDDEGWTEEEFEGHLVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            +GKRPLLTGD+QVTL
Sbjct  181  QGKRPLLTGDVQVTL  195



>ref|XP_003610155.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES92352.1| calmodulin-binding protein [Medicago truncatula]
Length=636

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 169/176 (96%), Gaps = 1/176 (1%)
 Frame = +1

Query  127  GKRSLEGD-EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  303
            GKR+LEG  ++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL
Sbjct  13   GKRALEGGGDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  72

Query  304  GPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            GPARI+ RSSPKRIEGPDGRN++L FRSRL+LPLFTGGKVEGEQGA IHVVL+D+NSG+V
Sbjct  73   GPARISGRSSPKRIEGPDGRNLRLQFRSRLALPLFTGGKVEGEQGAPIHVVLVDANSGNV  132

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT+GPESC+KLDVVVLEGDFNNEDD+DW+QEEFESHVVKER+GKRPLL G+LQVTL
Sbjct  133  VTSGPESCIKLDVVVLEGDFNNEDDEDWSQEEFESHVVKERQGKRPLLNGELQVTL  188



>ref|XP_006297211.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
 gb|EOA30109.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
Length=624

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYMERTNSMR KR LE D  ++QQPERKRPALASVIVEALK+DSLQ+LCSSLEPILR
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQGA
Sbjct  61   RVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D  +GHV+T GPE+  KLDVVVL+GDFN EDD+ W+ EEFE H+VKER+GKRP
Sbjct  121  AIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDEGWSGEEFEGHLVKERQGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGD+QVTL
Sbjct  181  LLTGDVQVTL  190



>ref|XP_010057559.1| PREDICTED: uncharacterized protein LOC104445366 [Eucalyptus grandis]
 gb|KCW74752.1| hypothetical protein EUGRSUZ_E03474 [Eucalyptus grandis]
Length=621

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 173/191 (91%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMERTNSM RGKR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERTNSMSRGKRGLDSGSGEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVERALAKLGP +I  RSSPK +EG DGRN+QL FR+RLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVERALAKLGPFKITGRSSPKCLEGSDGRNLQLQFRTRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            AAIHVVL+++++G  VT+GPES +KLDVVVLEGDFNNEDDD WTQEEF+SHVVKEREGKR
Sbjct  121  AAIHVVLMNADTGCAVTSGPESSVKLDVVVLEGDFNNEDDDTWTQEEFDSHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTG+LQV L
Sbjct  181  PLLTGELQVVL  191



>ref|XP_008224944.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
 ref|XP_008224945.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
Length=639

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRYMER+NSM R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYMERSNSMAREKRGLDSSSAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARI-AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            RRVVSEEVERALAKLG A++  +RSSPK+IEGPDGR++QLHFRSRLSLPLFTGGKVEGE 
Sbjct  61   RRVVSEEVERALAKLGSAKLTGSRSSPKQIEGPDGRHLQLHFRSRLSLPLFTGGKVEGEW  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            G+AI +VLID+N+  VVT+GPES +KLDVVVLEGDFNNEDDD+WTQEEFESHVVKEREGK
Sbjct  121  GSAIPIVLIDANTKLVVTSGPESVVKLDVVVLEGDFNNEDDDNWTQEEFESHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  181  RPLLTGDLQVTL  192



>ref|XP_004232807.1| PREDICTED: uncharacterized protein LOC101255950 [Solanum lycopersicum]
Length=621

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 9/190 (5%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYME       KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQTRYME-------KRVLDPSSSEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILR  53

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPA++ AR SPKRIEGPDGRN+QL FRS+LSLPLFTGGKVEGEQG+
Sbjct  54   RVVSEEVERALAKLGPAKLNARVSPKRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGEQGS  113

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VLID N+ HVVT+GPES +KLDVVVLEGDFNNEDDD WTQEEFESH+VKEREGKRP
Sbjct  114  AIHIVLIDGNTNHVVTSGPESLVKLDVVVLEGDFNNEDDDGWTQEEFESHIVKEREGKRP  173

Query  622  LLTGDLQVTL  651
            LLTG+LQV L
Sbjct  174  LLTGELQVIL  183



>ref|XP_003608225.1| Calmodulin-binding protein [Medicago truncatula]
Length=373

 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            M  RY++   +   KRSL+    E+ QP+RKRPALASVIVEALKVDS+QKLCSSLEPILR
Sbjct  1    MHGRYVDHHVARAEKRSLDSTSAEDGQPDRKRPALASVIVEALKVDSMQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGP ++  RSSPKRIEGPD  N+QLHF++RLSLPLFTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKLGPTKLNGRSSPKRIEGPDDNNLQLHFKTRLSLPLFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VL+D+N+GH+VT+GPESC KLDV VLEGDFNNEDD++W++EEFESH+VKEREGKRP
Sbjct  121  AIHIVLVDANTGHIVTSGPESCAKLDVFVLEGDFNNEDDENWSEEEFESHIVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LL+GDLQV L
Sbjct  181  LLSGDLQVIL  190



>emb|CDY59605.1| BnaC03g74590D [Brassica napus]
Length=627

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 174/193 (90%), Gaps = 5/193 (3%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD-----EEQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            M TRYMERTNSMR KR LE D     ++QQPERKRPALASVIVEALK+DSLQ+LCSSLEP
Sbjct  1    MHTRYMERTNSMREKRKLEEDDNSNHQQQQPERKRPALASVIVEALKMDSLQRLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGE
Sbjct  61   ILRRVVSEEVERALAKLGPARVSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGE  120

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGAAIHVVL+DS +G V+TTGPE+  KLDVVVL+GDFN+EDD+ W++EEFESH+VKER+G
Sbjct  121  QGAAIHVVLLDSTTGRVLTTGPEASAKLDVVVLDGDFNSEDDEGWSEEEFESHLVKERQG  180

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGD+ VTL
Sbjct  181  KRPLLTGDVLVTL  193



>ref|XP_002316656.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97268.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=625

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 175/194 (90%), Gaps = 11/194 (6%)
 Frame = +1

Query  103  MERTNSM--------RGKRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MER++SM        RGKR L+   G +E QP+RKRPALASVIVEALKVDSLQ+LCSSLE
Sbjct  1    MERSDSMEAVLAAAARGKRVLDSSSGHDEGQPDRKRPALASVIVEALKVDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEG  429
            PILRRVVSEEVERALAKLGPA++  RSSPK+IEGPDGRN+QLHFRSR+SLPLFTGGKVEG
Sbjct  61   PILRRVVSEEVERALAKLGPAKLNGRSSPKQIEGPDGRNLQLHFRSRVSLPLFTGGKVEG  120

Query  430  EQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKERE  609
            EQGAAIH+VLID+N+G  VT+GPES +KLD++VLEGDFN+EDDD+WTQE+FESHVVKERE
Sbjct  121  EQGAAIHIVLIDANTGCAVTSGPESSVKLDLIVLEGDFNDEDDDNWTQEKFESHVVKERE  180

Query  610  GKRPLLTGDLQVTL  651
            GKRPLLTGDLQVTL
Sbjct  181  GKRPLLTGDLQVTL  194



>ref|XP_006347126.1| PREDICTED: uncharacterized protein LOC102591443 [Solanum tuberosum]
Length=621

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 168/190 (88%), Gaps = 9/190 (5%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYME       KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQTRYME-------KRVLDPSSSEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILR  53

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPA++ AR SPKRIEGPDGRN+QL FRS+LSLPLFTGGKVEGEQ +
Sbjct  54   RVVSEEVERALAKLGPAKLNARVSPKRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGEQSS  113

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VLID N+ HVVT+GPES +KLDVVVLEGDFNNEDDD WTQEEFESH+VKEREGKRP
Sbjct  114  AIHIVLIDGNTNHVVTSGPESLVKLDVVVLEGDFNNEDDDGWTQEEFESHIVKEREGKRP  173

Query  622  LLTGDLQVTL  651
            LLTG+LQV L
Sbjct  174  LLTGELQVIL  183



>gb|EPS64102.1| hypothetical protein M569_10679, partial [Genlisea aurea]
Length=306

 Score =   299 bits (765),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 6/195 (3%)
 Frame = +1

Query  85   RMQTRYMERTNSM--RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEP  252
            RMQTRYMERTNSM  RGKR+LE  G EE +P+RKRPALASVIVEALKVDSLQKLCSSLEP
Sbjct  9    RMQTRYMERTNSMKARGKRNLEDGGSEEPEPDRKRPALASVIVEALKVDSLQKLCSSLEP  68

Query  253  ILRRVVSEEVERALAKLGPARIAAR--SSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            ILRRVVSEEVERALAKLGPAR+  R  SSPKRIEGP+GRN+QL F+SRLSLPLFTGGKVE
Sbjct  69   ILRRVVSEEVERALAKLGPARLTGRFRSSPKRIEGPNGRNLQLQFKSRLSLPLFTGGKVE  128

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D N+G VVT+GP+S +KLDVVVLEGDFNNE+ + WT+EEFESH+VKER
Sbjct  129  GEQGAAIHVVLVDVNTGIVVTSGPKSSLKLDVVVLEGDFNNEEGEGWTEEEFESHIVKER  188

Query  607  EGKRPLLTGDLQVTL  651
            EGKRPLLTGDLQVTL
Sbjct  189  EGKRPLLTGDLQVTL  203



>ref|NP_565441.2| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001031372.1| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001189550.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAH30392.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06802.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06803.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06804.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=622

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQ----PERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMERTNSMR KR LE D+ QQ    PERKRPALASVIVEALK+DSLQ+LCSSLEPI
Sbjct  1    MQTRYMERTNSMREKRKLEEDDNQQQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQ
Sbjct  61   LRRVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D  +GHV+T GPE+  KLDVVVL+GDFN EDDD W+ EEFE H+VKER+GK
Sbjct  121  GAAIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDDGWSGEEFEGHLVKERQGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGD+QVTL
Sbjct  181  RPLLTGDVQVTL  192



>ref|XP_009794879.1| PREDICTED: uncharacterized protein LOC104241635 [Nicotiana sylvestris]
Length=621

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 170/190 (89%), Gaps = 9/190 (5%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRYM+       KR+L+    EE QPERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQTRYMD-------KRALDPSSSEEGQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  53

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPA++ AR SPKRIEGPDGRN+QL FRS+LSLPLFTGGKVEGEQG+
Sbjct  54   RVVSEEVERALAKLGPAKLNARVSPKRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGEQGS  113

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VLID N+ HVVT+GPES +KLD+VVLEGDFN+EDDD WTQE+FESH+VKEREGKRP
Sbjct  114  AIHIVLIDGNTNHVVTSGPESSVKLDIVVLEGDFNDEDDDGWTQEKFESHIVKEREGKRP  173

Query  622  LLTGDLQVTL  651
            LLTG+LQV L
Sbjct  174  LLTGELQVIL  183



>ref|XP_002325070.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF03635.1| calmodulin-binding family protein [Populus trichocarpa]
Length=648

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 9/197 (5%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQPE--------RKRPALASVIVEALKVDSLQKLCS  240
            M TRYMERTNSM R KR LEG   ++ E        RKRPALASVIVEALKVDSLQKLCS
Sbjct  1    MHTRYMERTNSMARRKRGLEGGGAEEGEQQQQQQPERKRPALASVIVEALKVDSLQKLCS  60

Query  241  SLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGK  420
            SLEPILRRVVSEEVERALAK+GPAR   RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGK
Sbjct  61   SLEPILRRVVSEEVERALAKIGPARQIGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGK  120

Query  421  VEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVK  600
            VEGEQGAAIHVVL+D+++GHVVT+G E+ +KLDVVVLEGDFNNE D+ WTQEEFESHVVK
Sbjct  121  VEGEQGAAIHVVLVDASTGHVVTSGTEASVKLDVVVLEGDFNNEADEGWTQEEFESHVVK  180

Query  601  EREGKRPLLTGDLQVTL  651
            EREGKRPLLTGDLQVTL
Sbjct  181  EREGKRPLLTGDLQVTL  197



>ref|XP_009589610.1| PREDICTED: uncharacterized protein LOC104086953 [Nicotiana tomentosiformis]
Length=619

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 170/190 (89%), Gaps = 9/190 (5%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            MQTRY++       KR+L+    EE QPERKRPALASVIVEALKVDSLQKLCSSLEPILR
Sbjct  1    MQTRYVD-------KRALDPSSSEEGQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  53

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPA++ AR SPKRIEGPDGRN+QL FRS+LSLPLFTGGKVEGEQG+
Sbjct  54   RVVSEEVERALAKLGPAKLNARVSPKRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGEQGS  113

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VLID N+ HVVT+GPES +KLD+VVLEGDFN+EDDD WTQE+FESH+VKEREGKRP
Sbjct  114  AIHIVLIDGNTNHVVTSGPESSVKLDIVVLEGDFNDEDDDGWTQEKFESHIVKEREGKRP  173

Query  622  LLTGDLQVTL  651
            LLTG+LQV L
Sbjct  174  LLTGELQVIL  183



>ref|XP_010913644.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913645.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913646.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
Length=651

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 6/190 (3%)
 Frame = +1

Query  100  YMERTNSM-RGKRSLE--GDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILR  261
            Y+ER+N+M R KR L    +E+  PE KR   PALASVI+EALKVDSLQK+CSSLEP+LR
Sbjct  7    YLERSNTMTREKRGLNPSNEEDLHPEPKRQKVPALASVIIEALKVDSLQKICSSLEPVLR  66

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPARIA RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQG 
Sbjct  67   RVVSEEVERALAKLGPARIAGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGV  126

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            A+HVVL+D+N+GHVVT+G ES  KLDVVVLEGDFNNEDD DWT+EEFESHVVKEREG+RP
Sbjct  127  AVHVVLLDANTGHVVTSGQESSAKLDVVVLEGDFNNEDDGDWTEEEFESHVVKEREGRRP  186

Query  622  LLTGDLQVTL  651
            LLTGDLQV+L
Sbjct  187  LLTGDLQVSL  196



>gb|KJB68601.1| hypothetical protein B456_010G254300 [Gossypium raimondii]
Length=621

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 176/192 (92%), Gaps = 6/192 (3%)
 Frame = +1

Query  88   MQTRYMERTNSMRG-KRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            M+T+Y+ER+N++   KR L+   GDE   P+RKRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    METKYIERSNNVASEKRCLDSSSGDE--GPDRKRPALASVIVEALKVDSLQKLCSSLEPI  58

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPA++  +SSPK+IEGP+GRN++LHFRS LSLPLFTGGKVEG+Q
Sbjct  59   LRRVVSEEVERALAKLGPAKLTTKSSPKQIEGPNGRNLRLHFRSGLSLPLFTGGKVEGQQ  118

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAI +VLID+N+GHVVT+GPES +KLDVVVLEGDFNNEDDD+WT+EEF+SHVVKER+GK
Sbjct  119  GAAIDIVLIDANTGHVVTSGPESSLKLDVVVLEGDFNNEDDDNWTEEEFDSHVVKERDGK  178

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQV L
Sbjct  179  RPLLTGDLQVVL  190



>ref|XP_010696621.1| PREDICTED: uncharacterized protein LOC104909117 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=634

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 171/191 (90%), Gaps = 8/191 (4%)
 Frame = +1

Query  103  MERTNSMRG--KRSLEG----DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRR  264
            MER+NSM G  KRSL+     DE+ QP+RKRPALASVIVEALKVDSLQ+LCSSLEPILRR
Sbjct  1    MERSNSMGGREKRSLDSNSNVDEDAQPDRKRPALASVIVEALKVDSLQRLCSSLEPILRR  60

Query  265  VVSEEVERALAKLGPARIAA--RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            VVSEEVERALAKLGPAR+    RSSPKRIE PDGRN+QL FRSRLSLPLFTGGKVEGEQG
Sbjct  61   VVSEEVERALAKLGPARLVGNGRSSPKRIEAPDGRNLQLQFRSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AIH+VLID+N+G +V TGPES  KLD+VVLEGDFN+EDD DWTQE+FESHVVKEREGKR
Sbjct  121  SAIHIVLIDANTGQLVATGPESSAKLDIVVLEGDFNDEDDADWTQEDFESHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGD+QVTL
Sbjct  181  PLLTGDVQVTL  191



>ref|XP_003608224.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES90421.1| calmodulin-binding protein [Medicago truncatula]
Length=629

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 2/190 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILR  261
            M  RY++   +   KRSL+    E+ QP+RKRPALASVIVEALKVDS+QKLCSSLEPILR
Sbjct  1    MHGRYVDHHVARAEKRSLDSTSAEDGQPDRKRPALASVIVEALKVDSMQKLCSSLEPILR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGP ++  RSSPKRIEGPD  N+QLHF++RLSLPLFTGGKVEGEQGA
Sbjct  61   RVVSEEVERALAKLGPTKLNGRSSPKRIEGPDDNNLQLHFKTRLSLPLFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIH+VL+D+N+GH+VT+GPESC KLDV VLEGDFNNEDD++W++EEFESH+VKEREGKRP
Sbjct  121  AIHIVLVDANTGHIVTSGPESCAKLDVFVLEGDFNNEDDENWSEEEFESHIVKEREGKRP  180

Query  622  LLTGDLQVTL  651
            LL+GDLQV L
Sbjct  181  LLSGDLQVIL  190



>ref|XP_002886266.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62525.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=621

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQ----PERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMERTNSMR KR L+ D+ QQ    PERKRPALASVIVEALK+DSLQ+LCSSLEPI
Sbjct  1    MQTRYMERTNSMREKRKLDEDDNQQQQQQPERKRPALASVIVEALKMDSLQRLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPAR++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+EGEQ
Sbjct  61   LRRVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIEGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVL+D  +GHV+T GPE+  KLDVVVL+GDFN EDD+ W+ EEFE H+VKER+GK
Sbjct  121  GAAIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDEGWSGEEFEGHLVKERQGK  180

Query  616  RPLLTGDLQVTL  651
            RPLLTGD+QVTL
Sbjct  181  RPLLTGDVQVTL  192



>ref|XP_004504984.1| PREDICTED: uncharacterized protein LOC101509425 [Cicer arietinum]
Length=627

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            M  RY++     R   S  G EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MHGRYVDVAREKRTLDSTSG-EEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  59

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGP+++  RSSPKRIEG DG+N+QLHF++RLSLPLFTGGKVEGEQGAAI
Sbjct  60   VSEEVERALAKLGPSKLNGRSSPKRIEGRDGKNLQLHFKTRLSLPLFTGGKVEGEQGAAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VL+D+NSGHVVT+GPESC KLDV VLEGDFNNED+D+W +EEFESH+VKEREGKRPLL
Sbjct  120  HIVLVDANSGHVVTSGPESCAKLDVFVLEGDFNNEDEDNWGEEEFESHIVKEREGKRPLL  179

Query  628  TGDLQVTL  651
            +GDLQV L
Sbjct  180  SGDLQVIL  187



>gb|KHG24590.1| eukaryotic translation initiation factor 3 subunit m [Gossypium 
arboreum]
Length=631

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQ +YM R    RG  S  GDE   P+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQMKYMAREK--RGLDSSSGDE--GPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  56

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLG A+++A+SSPK IEGPDGRN+QLHFRSRLSLPLFTGGKVEGEQG AI
Sbjct  57   VSEEVERALAKLGSAKLSAKSSPKWIEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGTAI  116

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VL+D+N+GHVVT GPES  KLDV VLEGDFNNEDDD+WT+EEF+SH+VKEREGKRPLL
Sbjct  117  HIVLVDANTGHVVTCGPESIAKLDVFVLEGDFNNEDDDNWTEEEFDSHIVKEREGKRPLL  176

Query  628  TGDLQVTL  651
            TGDLQV L
Sbjct  177  TGDLQVML  184



>emb|CBI17793.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  303
            RGKR+LEG+EE+QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL
Sbjct  3    RGKRTLEGEEEEQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  62

Query  304  GPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            GPAR+  RSSPKRIEGPDGRN+QL FRSRLSLPLFTGGKVEGEQGAAIH+VL+D+NSG V
Sbjct  63   GPARLNGRSSPKRIEGPDGRNLQLQFRSRLSLPLFTGGKVEGEQGAAIHIVLVDANSGSV  122

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT+GPES +KLDVVVLEGDFNNED++ WTQEEF+SHVVKEREGKRPLLTGDLQVTL
Sbjct  123  VTSGPESSVKLDVVVLEGDFNNEDEEGWTQEEFDSHVVKEREGKRPLLTGDLQVTL  178



>ref|XP_009112562.1| PREDICTED: uncharacterized protein LOC103837921 [Brassica rapa]
Length=624

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 176/195 (90%), Gaps = 7/195 (4%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE------GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MQTRYMERTNSMR KR LE        ++QQPERKRPALASVIVEALK+DSLQ+LCSSLE
Sbjct  1    MQTRYMERTNSMREKRKLEEDDDNNNQQQQQPERKRPALASVIVEALKMDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAA-RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            PILRRVVSEEVERALAKLGPAR+++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+E
Sbjct  61   PILRRVVSEEVERALAKLGPARLSSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D+ +GHV+T GPE+  KLDVVVL+GDFN+EDD+ WT+EEFESH+VKER
Sbjct  121  GEQGAAIHVVLLDATTGHVLTVGPEASAKLDVVVLDGDFNSEDDEGWTEEEFESHLVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            +GKRPLLTGD+QVTL
Sbjct  181  QGKRPLLTGDVQVTL  195



>ref|XP_010539448.1| PREDICTED: uncharacterized protein LOC104813528 [Tarenaya hassleriana]
Length=632

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  303
            R KR+ +G+++ QPERKRPALASVIVEALK+DSLQKLCSSLEPILRRVVSEEVERALAK+
Sbjct  3    RAKRNFDGNDDDQPERKRPALASVIVEALKLDSLQKLCSSLEPILRRVVSEEVERALAKI  62

Query  304  GPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSG  477
            GPA +  ++RSSPKRIEGPDGRN+QLHFRSRLSLPLFTGG+VEGEQGAAIHVVLID+NS 
Sbjct  63   GPASLTGSSRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGGRVEGEQGAAIHVVLIDANSR  122

Query  478  HVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            H+VT GPE+  KLDV VLEGDFNNED +DW  EEFESHVVKEREGKRPLLTGDLQVTL
Sbjct  123  HMVTFGPEASTKLDVCVLEGDFNNEDYEDWALEEFESHVVKEREGKRPLLTGDLQVTL  180



>ref|XP_011043290.1| PREDICTED: uncharacterized protein LOC105138780 isoform X3 [Populus 
euphratica]
Length=623

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 173/194 (89%), Gaps = 11/194 (6%)
 Frame = +1

Query  103  MERTNSM--------RGKRSLE---GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MER++SM        RGKR L+   G +E QP+RKRPALASVIVEALKVDSLQ+LCSSLE
Sbjct  1    MERSDSMEAVLAAAARGKRVLDSSSGRDEGQPDRKRPALASVIVEALKVDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEG  429
            PILRRVVSEEVERALAKLGPA++  RSSPK+IEGPDGRN+QLHFRSR+SLPLFTGGKVEG
Sbjct  61   PILRRVVSEEVERALAKLGPAKLNGRSSPKQIEGPDGRNLQLHFRSRVSLPLFTGGKVEG  120

Query  430  EQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKERE  609
            EQG AIH+VLID+N+G  VT+GPES +KLD++VLEGDFN+E DD+WT+E+FESHVVKERE
Sbjct  121  EQGTAIHIVLIDANTGCAVTSGPESSVKLDLIVLEGDFNDEGDDNWTREKFESHVVKERE  180

Query  610  GKRPLLTGDLQVTL  651
            GKRPLLTGDLQVTL
Sbjct  181  GKRPLLTGDLQVTL  194



>ref|XP_006401191.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
 gb|ESQ42644.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
Length=642

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            M+R N+M R KR+L+G+++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE
Sbjct  1    MDRGNNMNRAKRNLDGNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  60

Query  280  VERALAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            VERALAKLGPAR+  ++ SSPKRIEGPDGRN++L FRSRLSLPLFTGG+VEGEQGAAIHV
Sbjct  61   VERALAKLGPARLTGSSGSSPKRIEGPDGRNLRLQFRSRLSLPLFTGGRVEGEQGAAIHV  120

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VLID+N+G  V  GPE+  KL++VVLEGDFNNEDD+DW+QEEFESHVVKER+GKRPLLTG
Sbjct  121  VLIDANTGRAVVYGPEASAKLEIVVLEGDFNNEDDEDWSQEEFESHVVKERQGKRPLLTG  180

Query  634  DLQVTL  651
            DL VTL
Sbjct  181  DLFVTL  186



>ref|XP_009606927.1| PREDICTED: uncharacterized protein LOC104101191 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 167/185 (90%), Gaps = 2/185 (1%)
 Frame = +1

Query  103  MERTNSMRGKRSLEG--DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R+     KR+++   +EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MQRSYMSGEKRTIDASTNEESQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVV  456
            EVERALAKLGPA++ AR SP RIEGPDGRN+QL FRS+LSLPLFTGGKVEGE+G+AIH+V
Sbjct  61   EVERALAKLGPAKLNARVSPNRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGERGSAIHIV  120

Query  457  LIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGD  636
            LID N+GHVVT+GPES +KLDVVVL GDFNNEDDD WT+EEFESH+VKEREGKRPLLTGD
Sbjct  121  LIDGNTGHVVTSGPESAVKLDVVVLGGDFNNEDDDVWTREEFESHIVKEREGKRPLLTGD  180

Query  637  LQVTL  651
            LQV L
Sbjct  181  LQVIL  185



>emb|CDY30302.1| BnaA09g09750D [Brassica napus]
Length=624

 Score =   301 bits (770),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 175/195 (90%), Gaps = 7/195 (4%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE------GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MQTRYMERTNSMR KR LE        ++QQPERKRPALASVIVEALK+DSLQ+LCSSLE
Sbjct  1    MQTRYMERTNSMREKRKLEEDDDNNNQQQQQPERKRPALASVIVEALKMDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAA-RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            PILRRVVSEEVERALAKLGPA++++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+E
Sbjct  61   PILRRVVSEEVERALAKLGPAKLSSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D+ +GHV+T GPE+  KLDVVVL+GDFN+EDD+ WT+EEFESH+V ER
Sbjct  121  GEQGAAIHVVLLDATTGHVLTVGPEASAKLDVVVLDGDFNSEDDEGWTEEEFESHLVNER  180

Query  607  EGKRPLLTGDLQVTL  651
            +GKRPLLTGD+QVTL
Sbjct  181  QGKRPLLTGDVQVTL  195



>ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
 gb|ESW31250.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
Length=628

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTN-SMRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            M  RY ER++ + R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MHGRYGERSSGTAREKRGLDSASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVE ALAKL PA++A RSSPK IEGPDG N+QL F+SRLSLPLFTGGKVEGEQG
Sbjct  61   RRVVSEEVELALAKLCPAKLAGRSSPKPIEGPDGTNLQLQFKSRLSLPLFTGGKVEGEQG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AIH+VLID+N+G++VT+GPESC++LDV+VLEGDFNNEDDD+W++EEF+SHVVKEREGKR
Sbjct  121  SAIHIVLIDANTGNIVTSGPESCVRLDVIVLEGDFNNEDDDNWSEEEFDSHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGD QVTL
Sbjct  181  PLLTGDNQVTL  191



>ref|XP_009761691.1| PREDICTED: uncharacterized protein LOC104213840 isoform X1 [Nicotiana 
sylvestris]
Length=628

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 2/176 (1%)
 Frame = +1

Query  130  KRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  303
            KR+L+   +EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL
Sbjct  7    KRTLDVSTNEESQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  66

Query  304  GPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            GPA++ AR SP RIEGPDGRN+QL FRS+LSLPLFTGGKVEGE+G+AIH+VL+D N+GHV
Sbjct  67   GPAKLNARVSPNRIEGPDGRNLQLQFRSKLSLPLFTGGKVEGERGSAIHIVLLDGNTGHV  126

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT+GPES +KLDVVVL GDFNNEDDD WT+EEFESH+VKEREGKRPLLTGDLQV L
Sbjct  127  VTSGPESAVKLDVVVLGGDFNNEDDDGWTREEFESHIVKEREGKRPLLTGDLQVIL  182



>gb|KJB57646.1| hypothetical protein B456_009G173400 [Gossypium raimondii]
Length=631

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            MQ +Y+ R    RG  S  GDE   P+RKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MQMKYLAREK--RGLDSSSGDE--GPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRV  56

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLG A+++A+SSPK +EGPDGRN+QLHFRSRLSLPLFTGGKVEGEQG AI
Sbjct  57   VSEEVERALAKLGSAKLSAKSSPKWMEGPDGRNLQLHFRSRLSLPLFTGGKVEGEQGTAI  116

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VL+++N+GHVVT GPES  KLDV VLEGDFNNEDDD+WT+EEF+SH+VKEREGKRPLL
Sbjct  117  HIVLVNANTGHVVTCGPESVAKLDVFVLEGDFNNEDDDNWTEEEFDSHIVKEREGKRPLL  176

Query  628  TGDLQVTL  651
            TGDLQV L
Sbjct  177  TGDLQVML  184



>ref|XP_010929240.1| PREDICTED: uncharacterized protein LOC105050786 isoform X1 [Elaeis 
guineensis]
Length=653

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 170/192 (89%), Gaps = 6/192 (3%)
 Frame = +1

Query  94   TRYMERTNSM-RGKRSLEGDE--EQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPI  255
             R++ER+ +M R KR L+  E  E  PE KRP   ALASVIVEALKVDSLQKLCSSLEPI
Sbjct  5    ARHLERSGTMTREKRRLDPGEGAEPHPESKRPKVPALASVIVEALKVDSLQKLCSSLEPI  64

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVERALAKLGPAR+  RSSPKRIEGPDGRN+QLHFRS LSLPLFTG +VEGEQ
Sbjct  65   LRRVVSEEVERALAKLGPARLGGRSSPKRIEGPDGRNLQLHFRSSLSLPLFTGARVEGEQ  124

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            GAAIHVVLID+N+G VVT+GPES  KLDVVVLEGDFNNEDDD+WT+EEFE++VVKEREGK
Sbjct  125  GAAIHVVLIDTNTGLVVTSGPESSAKLDVVVLEGDFNNEDDDNWTEEEFENYVVKEREGK  184

Query  616  RPLLTGDLQVTL  651
            RPLLTGDLQVTL
Sbjct  185  RPLLTGDLQVTL  196



>ref|XP_003545838.1| PREDICTED: uncharacterized protein LOC100802994 isoform X1 [Glycine 
max]
 ref|XP_006597397.1| PREDICTED: uncharacterized protein LOC100802994 isoform X2 [Glycine 
max]
Length=635

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 171/191 (90%), Gaps = 3/191 (2%)
 Frame = +1

Query  88   MQTRYMERTNS-MRGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPIL  258
            MQTRY+ER++S  R KR+L+    +E QP+RKRPALASVIVEALKVDSLQKLCSSLEPIL
Sbjct  1    MQTRYIERSSSSAREKRALDSGSADEDQPQRKRPALASVIVEALKVDSLQKLCSSLEPIL  60

Query  259  RRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQG  438
            RRVVSEEVE ALAKL PA+++ RSSPK IEGPD  ++QL FR+RLSLPLFTGGKVEGE G
Sbjct  61   RRVVSEEVECALAKLVPAKLSGRSSPKGIEGPDDSSLQLQFRTRLSLPLFTGGKVEGEHG  120

Query  439  AAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKR  618
            +AIH+VLID+ +GHVVT GP SC+KLDV+VLEGDFNNEDDD+W++E F+SHVVKEREGKR
Sbjct  121  SAIHIVLIDTTTGHVVTCGPASCVKLDVIVLEGDFNNEDDDNWSEEYFDSHVVKEREGKR  180

Query  619  PLLTGDLQVTL  651
            PLLTGDLQVTL
Sbjct  181  PLLTGDLQVTL  191



>gb|KDP20890.1| hypothetical protein JCGZ_21361 [Jatropha curcas]
Length=623

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  303
            RG  S  GDE  QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL
Sbjct  6    RGLDSSSGDE-GQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL  64

Query  304  G-PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            G PA++  +SSPK I GPDGRN+QLHFRSR+SLPLFTGGKVEGEQGAAIH+VLID+N+GH
Sbjct  65   GGPAKLTGKSSPKCIGGPDGRNLQLHFRSRMSLPLFTGGKVEGEQGAAIHIVLIDANTGH  124

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VVT GPES +KLDV+VLEGDFNNED D+WTQEEF+SH+VKEREGKRPLLTGDLQVTL
Sbjct  125  VVTFGPESSVKLDVIVLEGDFNNEDVDNWTQEEFDSHIVKEREGKRPLLTGDLQVTL  181



>ref|XP_009398635.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398636.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 4/179 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG  + +GDE  QPE KRP   ALASVIVEALKVDSLQK+CSSLEPILRRVVSEEVERAL
Sbjct  20   RGMDTGDGDE-LQPEPKRPKVPALASVIVEALKVDSLQKICSSLEPILRRVVSEEVERAL  78

Query  295  AKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
            A+LGPARI  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGG+VEGEQGAAIHVVL D+NS
Sbjct  79   ARLGPARIGGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGRVEGEQGAAIHVVLFDANS  138

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GHVV++GPE+  KLDV+VLEGDFNNEDD++WT+EEFESHVVKEREGKRPLLTGDLQ++L
Sbjct  139  GHVVSSGPEASAKLDVLVLEGDFNNEDDENWTEEEFESHVVKEREGKRPLLTGDLQISL  197



>ref|XP_004248098.1| PREDICTED: uncharacterized protein LOC101268806 isoform X1 [Solanum 
lycopersicum]
Length=625

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            MER +  + +  +   EE QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV
Sbjct  1    MERPSGEKRRLDVSSSEEGQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  60

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERALAKLGP ++ AR SPKRIEGP+GRN+QL FRS+LSLPLFTGGKVEGEQG+ IHVVLI
Sbjct  61   ERALAKLGPTKLNARVSPKRIEGPNGRNLQLQFRSKLSLPLFTGGKVEGEQGSTIHVVLI  120

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            + N+GHVVT GPES +KLDVVVL GDFNNEDDD WT+EEFESH+VKER+GKRPLLTGDLQ
Sbjct  121  NGNTGHVVTVGPESSVKLDVVVLGGDFNNEDDDGWTEEEFESHIVKERDGKRPLLTGDLQ  180

Query  643  VTL  651
            V L
Sbjct  181  VIL  183



>ref|XP_006281432.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
 gb|EOA14330.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
Length=651

 Score =   299 bits (766),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSM--RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+   R KR+L+G+++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNNMNRAKRNLDGNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARIAARS--SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EVERALAKLGPAR++  S  SPKRIEGPDGR ++LHF+SRLSLPLFTGGKVEGEQGAAIH
Sbjct  61   EVERALAKLGPARLSGSSGSSPKRIEGPDGRKLRLHFKSRLSLPLFTGGKVEGEQGAAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G VV  GPE+  KL VVVLEGDFN+EDD+DWTQEEFESHVVKER GKRPLLT
Sbjct  121  VVLIDANTGRVVLYGPEASAKLQVVVLEGDFNSEDDEDWTQEEFESHVVKERAGKRPLLT  180

Query  631  GDLQVTL  651
            GD+ VTL
Sbjct  181  GDVYVTL  187



>ref|XP_007148242.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
 gb|ESW20236.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
Length=638

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMER--TNSMRGKRSLEG--DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPI  255
            MQTRYMER  T + RGKR L+    EE+QPE+KRPALASVIVEALKVDSLQKLCSSLEPI
Sbjct  1    MQTRYMERSTTTAARGKRGLDSASTEEEQPEKKRPALASVIVEALKVDSLQKLCSSLEPI  60

Query  256  LRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            LRRVVSEEVE ALAKL  A+ + RSSPK IEGPD   +QL FR+RLSLPLFTGGKV+GEQ
Sbjct  61   LRRVVSEEVECALAKLVTAKNSGRSSPKSIEGPDDSTLQLQFRNRLSLPLFTGGKVDGEQ  120

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            G AIH+VLID+ +GHVVT+GP SC+KLDV+VLEGDFNNEDD++W++E+F+SHVVKEREGK
Sbjct  121  GNAIHIVLIDTITGHVVTSGPASCVKLDVIVLEGDFNNEDDENWSEEDFDSHVVKEREGK  180

Query  616  RPLLTGDLQVTL  651
            RPLL GDLQVTL
Sbjct  181  RPLLAGDLQVTL  192



>ref|XP_010525739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803505 
[Tarenaya hassleriana]
Length=636

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  88   MQTRYMERTNSM-RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRR  264
            MQTRYMERTNSM RGKR  E +E  Q ERKRPALASVIVEALK+DSLQ++CSSLEPILRR
Sbjct  1    MQTRYMERTNSMSRGKRKSE-EENPQTERKRPALASVIVEALKMDSLQRICSSLEPILRR  59

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VVSEEVERALAKLGPA +  RSSPK+IEG DGRN+QL FRSRLS+PLFTGGKVEGEQGAA
Sbjct  60   VVSEEVERALAKLGPATLNGRSSPKQIEGLDGRNLQLQFRSRLSVPLFTGGKVEGEQGAA  119

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+DS +GHV+TTG E+  KLDVVVL+G+F+ EDD+ WT+EEFESH+VKE   KRPL
Sbjct  120  IHVVLVDSTTGHVLTTGSEASAKLDVVVLDGEFSKEDDEGWTEEEFESHLVKENSTKRPL  179

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  180  LTGDLQVTL  188



>ref|XP_006361013.1| PREDICTED: uncharacterized protein LOC102605248 [Solanum tuberosum]
Length=625

 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            MER +  + +  +   EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV
Sbjct  1    MERPSGEKRRLDVSSSEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  60

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERALAKLGP ++ AR SPKRIEGP+GRN+QL FRS+LSLPLFTGGKVEGEQG+AIH+VL+
Sbjct  61   ERALAKLGPTKLNARVSPKRIEGPNGRNLQLQFRSKLSLPLFTGGKVEGEQGSAIHIVLL  120

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            + N+GHVVT GPES +KLDVVVL GDFNNED+D WT+EEFESH+VKER+GKRPLLTGDLQ
Sbjct  121  NGNTGHVVTVGPESSVKLDVVVLGGDFNNEDEDGWTEEEFESHIVKERDGKRPLLTGDLQ  180

Query  643  VTL  651
            V L
Sbjct  181  VIL  183



>ref|XP_010323248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101245373 
[Solanum lycopersicum]
Length=632

 Score =   296 bits (758),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            MERT SM  KRSLEGD+EQ PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV
Sbjct  1    MERTKSM--KRSLEGDDEQPPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  58

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERALAKLGPARIA RSSPKRIEGPD              PLFTGGKVEGE GAAIHVVLI
Sbjct  59   ERALAKLGPARIAGRSSPKRIEGPDEVTCSFSLGLGYLXPLFTGGKVEGEHGAAIHVVLI  118

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D+ +GH+VT GPESC+KLDVVVLEGDFNNE+D+ WTQEEF+ HVVKEREGKRPLLTGDLQ
Sbjct  119  DTTTGHLVTAGPESCIKLDVVVLEGDFNNEEDEGWTQEEFDGHVVKEREGKRPLLTGDLQ  178

Query  643  VTL  651
            +TL
Sbjct  179  ITL  181



>ref|XP_002866219.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42478.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=646

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 167/187 (89%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSM--RGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+   R KR+L+G+++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNNMNRAKRNLDGNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EVERALAKLGPAR+  ++ SSPKRIEGPDGRN++LHF+SRLSLPLFTGGKVEGEQGAAIH
Sbjct  61   EVERALAKLGPARLTGSSGSSPKRIEGPDGRNLRLHFKSRLSLPLFTGGKVEGEQGAAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+   V  GPE+  KL VVVLEGDFN EDD+DWTQEEFESHVVKER GKRPLLT
Sbjct  121  VVLIDANTCRAVVHGPEASAKLQVVVLEGDFNTEDDEDWTQEEFESHVVKERSGKRPLLT  180

Query  631  GDLQVTL  651
            GD+ VTL
Sbjct  181  GDVYVTL  187



>ref|XP_010443447.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443448.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443449.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
Length=659

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 167/188 (89%), Gaps = 5/188 (3%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGD-EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+M R KR L+G+ ++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNMNRAKRILDGNNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI---AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            EVERALAKLGPAR+   +  SSPKRIEGPDGR ++LHF+SRLSLPLFTGGKVEGEQGAAI
Sbjct  61   EVERALAKLGPARLTGSSGSSSPKRIEGPDGRKLRLHFKSRLSLPLFTGGKVEGEQGAAI  120

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            HVVLID+NSG  V  GPE+  KL VVVLEGDFN+EDD+DWTQEEFESHVVKER GKRPLL
Sbjct  121  HVVLIDANSGRAVVYGPEASAKLQVVVLEGDFNSEDDEDWTQEEFESHVVKERAGKRPLL  180

Query  628  TGDLQVTL  651
            TGD+ VTL
Sbjct  181  TGDVYVTL  188



>ref|XP_009394895.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394896.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394897.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394898.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 3/180 (2%)
 Frame = +1

Query  121  MRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERA  291
            MR KR L   ++ QPE KR   PALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVERA
Sbjct  1    MREKRGLVPGDDLQPEPKRQKVPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVERA  60

Query  292  LAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            LAKLGPAR+  R+SPKRIEGPDGRN+QL FRS LSLPLFTGGKVEGEQG+ IHVVL+D+N
Sbjct  61   LAKLGPARVGGRASPKRIEGPDGRNLQLQFRSMLSLPLFTGGKVEGEQGSEIHVVLLDAN  120

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G VVT+GPES  KLDVVVLEGDFNNEDDD+WT+EEFESHVVKEREGKRPLLTGDLQV+L
Sbjct  121  TGFVVTSGPESSAKLDVVVLEGDFNNEDDDNWTEEEFESHVVKEREGKRPLLTGDLQVSL  180



>ref|XP_010452498.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
 ref|XP_010452506.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
Length=659

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 167/188 (89%), Gaps = 5/188 (3%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGD-EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+M R KR L+G+ ++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNMNRAKRILDGNNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI---AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            EVERALAKLGPAR+   +  SSPKRIEGPDGR ++LHF+SRLSLPLFTGGKVEGEQGAAI
Sbjct  61   EVERALAKLGPARLTGSSGSSSPKRIEGPDGRKLRLHFKSRLSLPLFTGGKVEGEQGAAI  120

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            HVVLID+N+G  V  GPE+  KL VVVLEGDFN+EDD+DWTQEEFESHVVKER GKRPLL
Sbjct  121  HVVLIDANTGRAVVYGPEASAKLQVVVLEGDFNSEDDEDWTQEEFESHVVKERAGKRPLL  180

Query  628  TGDLQVTL  651
            TGD+ VTL
Sbjct  181  TGDVYVTL  188



>ref|XP_010929241.1| PREDICTED: uncharacterized protein LOC105050786 isoform X2 [Elaeis 
guineensis]
Length=640

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 162/181 (90%), Gaps = 5/181 (3%)
 Frame = +1

Query  124  RGKRSLEGDE--EQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER  288
            R KR L+  E  E  PE KRP   ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER
Sbjct  3    REKRRLDPGEGAEPHPESKRPKVPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER  62

Query  289  ALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDS  468
            ALAKLGPAR+  RSSPKRIEGPDGRN+QLHFRS LSLPLFTG +VEGEQGAAIHVVLID+
Sbjct  63   ALAKLGPARLGGRSSPKRIEGPDGRNLQLHFRSSLSLPLFTGARVEGEQGAAIHVVLIDT  122

Query  469  NSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVT  648
            N+G VVT+GPES  KLDVVVLEGDFNNEDDD+WT+EEFE++VVKEREGKRPLLTGDLQVT
Sbjct  123  NTGLVVTSGPESSAKLDVVVLEGDFNNEDDDNWTEEEFENYVVKEREGKRPLLTGDLQVT  182

Query  649  L  651
            L
Sbjct  183  L  183



>ref|XP_006845603.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
 gb|ERN07278.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
Length=630

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 169/193 (88%), Gaps = 7/193 (4%)
 Frame = +1

Query  94   TRYMERTNSMR--GKRSLEGDE--EQQPERKR---PALASVIVEALKVDSLQKLCSSLEP  252
            TR +ER+N+M    KR L+  E  E+ PE K+   PALASVIVEALKVD+LQKLCSSLEP
Sbjct  5    TRLLERSNTMTRAEKRKLDAGEAEERPPEEKKQKVPALASVIVEALKVDNLQKLCSSLEP  64

Query  253  ILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGE  432
            ILRRVVSEEVERALAKLGP+R+  RSSPKRIEGPDGR++QL FRSRLSLPLFTGGKVEGE
Sbjct  65   ILRRVVSEEVERALAKLGPSRLGGRSSPKRIEGPDGRSLQLQFRSRLSLPLFTGGKVEGE  124

Query  433  QGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREG  612
            QGA IHVVLID+N+G V+T+G ES  KLDV+VLEGDFNN+D+D+WTQEEFESHVVKEREG
Sbjct  125  QGALIHVVLIDANTGQVITSGLESSAKLDVIVLEGDFNNDDEDNWTQEEFESHVVKEREG  184

Query  613  KRPLLTGDLQVTL  651
            KRPLLTGDL VTL
Sbjct  185  KRPLLTGDLLVTL  197



>gb|KHN00110.1| hypothetical protein glysoja_028638 [Glycine soja]
Length=624

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  LEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  318
            L   EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAK+GPA++
Sbjct  13   LASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKIGPAKL  72

Query  319  --AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTT  492
                RSSPK IEGPDG+ +QLHF++RLSLPLFTGGKVEGEQG +IH+VLID+N+GH+VT+
Sbjct  73   NNTGRSSPKWIEGPDGKILQLHFKTRLSLPLFTGGKVEGEQGTSIHIVLIDANTGHIVTS  132

Query  493  GPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GPESC++LDV+VLEGDFNNEDDD+W +E+F+SH+VKEREGKRPLLTGDLQVTL
Sbjct  133  GPESCVRLDVIVLEGDFNNEDDDNWDEEQFDSHIVKEREGKRPLLTGDLQVTL  185



>ref|XP_009414724.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414730.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 167/190 (88%), Gaps = 5/190 (3%)
 Frame = +1

Query  97   RYMERTNSMRGKRSLEGDEEQ--QPERKR---PALASVIVEALKVDSLQKLCSSLEPILR  261
            RY  +    R KR LE  +    QPE KR   PALASVIVEALKVDSLQK+CSSLEPILR
Sbjct  6    RYERQGTLPREKRGLEARDRDGLQPEPKRSKVPALASVIVEALKVDSLQKICSSLEPILR  65

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPARI  R SPK+IEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQGA
Sbjct  66   RVVSEEVERALAKLGPARIGGRCSPKQIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGA  125

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVL+D+NSGHVV++GPE+  KLDV+VLEGDFN+EDD++WT+E+FESHVVKEREGKRP
Sbjct  126  AIHVVLLDANSGHVVSSGPEASAKLDVLVLEGDFNDEDDENWTEEDFESHVVKEREGKRP  185

Query  622  LLTGDLQVTL  651
            LLTGD+QV+L
Sbjct  186  LLTGDVQVSL  195



>ref|XP_010483282.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483283.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483284.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483285.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483286.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483287.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
Length=659

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 166/188 (88%), Gaps = 5/188 (3%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGD-EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+M R KR L+G+ ++ QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNMNRAKRILDGNNDDDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI---AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            EVERALAKL PAR+   +  SSPKRIEGPDGR ++LHF+SRLSLPLFTGGKVEGEQGAAI
Sbjct  61   EVERALAKLAPARLTGSSGSSSPKRIEGPDGRKLRLHFKSRLSLPLFTGGKVEGEQGAAI  120

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            HVVLID+N+G  V  GPE+  KL VVVLEGDFN+EDD+DWTQEEFESHVVKER GKRPLL
Sbjct  121  HVVLIDANTGRAVVYGPEASAKLQVVVLEGDFNSEDDEDWTQEEFESHVVKERAGKRPLL  180

Query  628  TGDLQVTL  651
            TGD+ VTL
Sbjct  181  TGDVYVTL  188



>ref|NP_200566.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAB08793.1| calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAL07138.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAM14373.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AED96923.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=647

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  112  TNSMRGKRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERA  291
             N  R KR+L+G+++ QPERKRPA ASVIVEALKVDSLQKLCSSLEPILRRVVSEE+ERA
Sbjct  7    NNMNRAKRNLDGNDDDQPERKRPAFASVIVEALKVDSLQKLCSSLEPILRRVVSEELERA  66

Query  292  LAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLID  465
            LAKLGPAR+  ++ SSPKRIEGPDGR +QLHF+SRLSLPLFTGGKVEGEQGA IHVVLID
Sbjct  67   LAKLGPARLTGSSGSSPKRIEGPDGRKLQLHFKSRLSLPLFTGGKVEGEQGAVIHVVLID  126

Query  466  SNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQV  645
            +N+G  V  GPE+  KL +VVLEGDFN EDD+DWTQEEFESHVVKER GKRPLLTG++ V
Sbjct  127  ANTGRAVVYGPEASAKLHIVVLEGDFNTEDDEDWTQEEFESHVVKERSGKRPLLTGEVYV  186

Query  646  TL  651
            TL
Sbjct  187  TL  188



>ref|XP_008808337.1| PREDICTED: uncharacterized protein LOC103720426 [Phoenix dactylifera]
Length=641

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 163/181 (90%), Gaps = 5/181 (3%)
 Frame = +1

Query  124  RGKRSLEGDE--EQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER  288
            R KR L+ D+  E  PE KRP   ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER
Sbjct  3    REKRRLDLDDGDEPHPESKRPKVPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVER  62

Query  289  ALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDS  468
            ALAKLGPAR+  RSSPKRIEGPDGRN+QLHFRSRLSLPLFTG KVEGEQGAAIHVVLID+
Sbjct  63   ALAKLGPARLEGRSSPKRIEGPDGRNLQLHFRSRLSLPLFTGAKVEGEQGAAIHVVLIDA  122

Query  469  NSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVT  648
            N+G VVT+GPES  KLDV+VLEGDFN EDDD+WT+EEFE+++VKEREGKRPLLTG+LQVT
Sbjct  123  NTGLVVTSGPESSAKLDVIVLEGDFNIEDDDNWTEEEFENYIVKEREGKRPLLTGELQVT  182

Query  649  L  651
            L
Sbjct  183  L  183



>ref|XP_010914125.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
 ref|XP_010914126.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
Length=638

 Score =   291 bits (745),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 161/182 (88%), Gaps = 7/182 (4%)
 Frame = +1

Query  124  RGKRSLE---GDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  285
            R KR L+   GDE   PE KRP   ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE
Sbjct  3    REKRRLDPSDGDE-LHPEAKRPKVPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  61

Query  286  RALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLID  465
            RALAKLGPAR   RSSPK IEGPDGRN+QLHFRSRLSLPLFTG KVEGEQGAAIHVVLID
Sbjct  62   RALAKLGPARHGGRSSPKHIEGPDGRNLQLHFRSRLSLPLFTGAKVEGEQGAAIHVVLID  121

Query  466  SNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQV  645
            +N+G VVT+GPES  KLDVVVLEGDFN+EDDD WT+EEFES+VVKEREGKRPLLTGDLQV
Sbjct  122  TNTGCVVTSGPESSAKLDVVVLEGDFNDEDDDGWTEEEFESYVVKEREGKRPLLTGDLQV  181

Query  646  TL  651
            +L
Sbjct  182  SL  183



>emb|CDY69506.1| BnaCnng63910D [Brassica napus]
Length=654

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 165/194 (85%), Gaps = 11/194 (6%)
 Frame = +1

Query  103  MERTNSM--RGKRSLEG---DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  267
            M+R+N    R KRSL+G   D+  QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV
Sbjct  1    MDRSNHNMNRNKRSLDGNNGDDGDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRV  60

Query  268  VSEEVERALAKLGPARIAARSS------PKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEG  429
            VSEEVERALAKLGPAR+   S       PKRIEGPDGRN++L FRSRLSLPLFTGG+VEG
Sbjct  61   VSEEVERALAKLGPARLTGSSGSGSGSSPKRIEGPDGRNLRLQFRSRLSLPLFTGGRVEG  120

Query  430  EQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKERE  609
            EQGAAIHVVLID+N+G  V  GPE+  KL+VVVLEGDFNNEDD+ WTQEEFESHVVKER+
Sbjct  121  EQGAAIHVVLIDANTGRAVVYGPEASAKLEVVVLEGDFNNEDDEGWTQEEFESHVVKERQ  180

Query  610  GKRPLLTGDLQVTL  651
            GKRPLLTGDL VTL
Sbjct  181  GKRPLLTGDLYVTL  194



>ref|XP_009120276.1| PREDICTED: uncharacterized protein LOC103845193 [Brassica rapa]
Length=654

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  115  NSMRGKRSLEG---DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  285
            N  R KRSL+G   D+  QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE
Sbjct  7    NMNRNKRSLDGNNGDDGDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  66

Query  286  RALAKLGPARIAARSS------PKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            RALAKLGPAR+   S       PKRIEGPDGRN++L FRSRLSLPLFTGG+VEGEQGAAI
Sbjct  67   RALAKLGPARLTGSSGSVSGSSPKRIEGPDGRNLRLQFRSRLSLPLFTGGRVEGEQGAAI  126

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            HVVLID+N+G  V  GPE+  KL+VVVLEGDFNNEDD+ WTQEEFESHVVKER+GKRPLL
Sbjct  127  HVVLIDANTGRAVVYGPEASAKLEVVVLEGDFNNEDDEGWTQEEFESHVVKERQGKRPLL  186

Query  628  TGDLQVTL  651
            TGDL VTL
Sbjct  187  TGDLYVTL  194



>emb|CDY49721.1| BnaA10g11510D [Brassica napus]
Length=654

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = +1

Query  115  NSMRGKRSLEG---DEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  285
            N  R KRSL+G   D+  QPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE
Sbjct  7    NMNRNKRSLDGNNGDDGDQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  66

Query  286  RALAKLGPARIAARSS------PKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            RALAKLGPAR+   S       PKRIEGPDGRN++L FRSRLSLPLFTGG+VEGEQGAAI
Sbjct  67   RALAKLGPARLTGSSGSVSGSSPKRIEGPDGRNLRLQFRSRLSLPLFTGGRVEGEQGAAI  126

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            HVVLID+N+G  V  GPE+  KL+VVVLEGDFNNEDD+ WTQEEFESHVVKER+GKRPLL
Sbjct  127  HVVLIDANTGRAVVYGPEASAKLEVVVLEGDFNNEDDEGWTQEEFESHVVKERQGKRPLL  186

Query  628  TGDLQVTL  651
            TGDL VTL
Sbjct  187  TGDLYVTL  194



>ref|XP_002446536.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
 gb|EES10864.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
Length=652

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 6/196 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEP  252
            ++ Q R++ER+NS R      G ++     KRP   ALASVIVEALKVDSLQKLCSSLEP
Sbjct  1    MQRQGRHLERSNSKRALDHGAGGDDDDRPSKRPRVPALASVIVEALKVDSLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRRVVSEEVERALAKLGPA   RI  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGGKV
Sbjct  61   ILRRVVSEEVERALAKLGPAGPARIQGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+N+GHVVT+GPES +KLD++VLEGDFN E+D+ WT+E+FESH+VKE
Sbjct  121  EGEQGAAIHVVLLDANTGHVVTSGPESSVKLDILVLEGDFNKEEDEGWTEEDFESHIVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRPLLTGDLQ+TL
Sbjct  181  REGKRPLLTGDLQITL  196



>tpg|DAA37641.1| TPA: hypothetical protein ZEAMMB73_949812 [Zea mays]
Length=378

 Score =   281 bits (718),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 167/196 (85%), Gaps = 6/196 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEP  252
            ++ Q R++ER+NS R      G ++     KRP   ALASVIVEALKVD LQKLCSSLEP
Sbjct  1    MQRQGRHLERSNSKRALDHGGGGDDDDRPSKRPRVPALASVIVEALKVDCLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRR+VSEEVERALAKLGPA   RI  R SPKRIEGPDGR++QL FR+RLSLPLFTGGKV
Sbjct  61   ILRRIVSEEVERALAKLGPAGPARIQGRGSPKRIEGPDGRSLQLQFRTRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+N+GHVVT+GPES +KLD++VLEGDFN E+D+ WT+E+FESH+VKE
Sbjct  121  EGEQGAAIHVVLLDANTGHVVTSGPESSVKLDILVLEGDFNKEEDEGWTEEDFESHIVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRP+LTGDLQVTL
Sbjct  181  REGKRPILTGDLQVTL  196



>ref|NP_194310.3| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001078448.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAE98742.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85115.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85116.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=601

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KR+ E +++ +PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL P
Sbjct  2    KRNFERNDDDKPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLVP  61

Query  310  ARIAARS--SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
             R+   S  SPKRI GPDGRN+QLHF+SRLSLPLFTGG+VEGEQGA IHVVLID+N+G  
Sbjct  62   TRLTTSSVFSPKRIGGPDGRNLQLHFKSRLSLPLFTGGRVEGEQGATIHVVLIDANTGRP  121

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT GPE+ +KL+VVVL GDFNNEDD+DWTQEEFESHVVKEREGKRPLLTGDL V L
Sbjct  122  VTVGPEASLKLEVVVLGGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGDLFVVL  177



>ref|XP_004975725.1| PREDICTED: uncharacterized protein LOC101760764 isoform X2 [Setaria 
italica]
Length=659

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 8/198 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSMR----GKRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSL  246
            ++ Q R++ER+NS R    G      D+++ P+R R PALASVIVEALKVDSLQKLCSSL
Sbjct  1    MQRQGRHLERSNSKRVLDHGGGGGGDDDDRAPKRPRVPALASVIVEALKVDSLQKLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            EPILRRVVSEEVERAL KLGPA   RI  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGG
Sbjct  61   EPILRRVVSEEVERALTKLGPAGPARIQGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIHVVL+D+N+GH VT+GPES  KLDV+VLEGDFN E+D+ WT+E+FESH+V
Sbjct  121  KVEGEQGAAIHVVLLDANTGHAVTSGPESSAKLDVLVLEGDFNKEEDEGWTEEDFESHIV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>ref|XP_004975724.1| PREDICTED: uncharacterized protein LOC101760764 isoform X1 [Setaria 
italica]
Length=660

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 8/198 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSMR----GKRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSL  246
            ++ Q R++ER+NS R    G      D+++ P+R R PALASVIVEALKVDSLQKLCSSL
Sbjct  1    MQRQGRHLERSNSKRVLDHGGGGGGDDDDRAPKRPRVPALASVIVEALKVDSLQKLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            EPILRRVVSEEVERAL KLGPA   RI  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGG
Sbjct  61   EPILRRVVSEEVERALTKLGPAGPARIQGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIHVVL+D+N+GH VT+GPES  KLDV+VLEGDFN E+D+ WT+E+FESH+V
Sbjct  121  KVEGEQGAAIHVVLLDANTGHAVTSGPESSAKLDVLVLEGDFNKEEDEGWTEEDFESHIV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>emb|CDY02746.1| BnaC02g11430D [Brassica napus]
Length=624

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGDEE-QQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+M R KRS +G+ +  QP+RKRPALASVIVEALKV+SLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNMNRAKRSFDGNGDGDQPDRKRPALASVIVEALKVNSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EVERALAKLGPAR+  ++ SSPKRIEGPDGRN++L FRSRLSLPLFTGG+VEGEQG AIH
Sbjct  61   EVERALAKLGPARLTGSSGSSPKRIEGPDGRNLRLQFRSRLSLPLFTGGRVEGEQGTAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVL D+N+G  V  GPE+  KL+VV L+GDFN EDD+DWTQEEFESHVVKER+GKRPLLT
Sbjct  121  VVLFDANTGRAVLHGPEASAKLEVVALDGDFNAEDDEDWTQEEFESHVVKERQGKRPLLT  180

Query  631  GDLQVTL  651
            GDL VTL
Sbjct  181  GDLCVTL  187



>ref|XP_002869655.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45914.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KR+LEG+ + +PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL P
Sbjct  2    KRNLEGNGDDKPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLAP  61

Query  310  ARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            AR+  ++ SSPKRI G DGRN+QLHF+SRLSLPLFTGG+VEG+QGAAIHVVLID+N+   
Sbjct  62   ARLNTSSGSSPKRIRGLDGRNLQLHFKSRLSLPLFTGGRVEGDQGAAIHVVLIDANTRRP  121

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT GPE+ +KL+VVVL GDFNNEDD+DWTQEEFESHVVKEREGKRPLLTGDL V L
Sbjct  122  VTVGPEASLKLEVVVLGGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGDLCVVL  177



>ref|NP_001046071.1| Os02g0177800 [Oryza sativa Japonica Group]
 dbj|BAD27989.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF07985.1| Os02g0177800 [Oryza sativa Japonica Group]
Length=624

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 160/183 (87%), Gaps = 6/183 (3%)
 Frame = +1

Query  121  MRGKRSLE-----GDEEQQPERKRP-ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            M+ KR LE     GD   + +R RP ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEV
Sbjct  1    MKEKRGLEAAAAGGDGHPEAKRARPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEV  60

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL +LGPA I  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGGKVEGEQGAAIHVVL+
Sbjct  61   ERALGRLGPATITGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGGKVEGEQGAAIHVVLL  120

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D+ +G VV++GPESC KLD+VVLEGDFNNED++ W+ EEFESHVVKEREGKRPLLTGD+Q
Sbjct  121  DAGTGCVVSSGPESCAKLDIVVLEGDFNNEDEEGWSGEEFESHVVKEREGKRPLLTGDVQ  180

Query  643  VTL  651
            VTL
Sbjct  181  VTL  183



>ref|XP_010448367.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
 ref|XP_010448368.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
Length=624

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KR+LEG+++ +PERKRPAL SVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAK  P
Sbjct  2    KRNLEGNDDDKPERKRPALVSVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKFAP  61

Query  310  ARI---AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            AR+   ++ SSPKRI   DGRN+QLHF+SRLSLPLFTGG+VEGEQGAAIHVVLID+N+G 
Sbjct  62   ARLTTASSGSSPKRIGCTDGRNLQLHFKSRLSLPLFTGGRVEGEQGAAIHVVLIDANTGR  121

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
             VT GPE+ +KLDVVVL GDFNNE+D+DWTQEEFESHVVKEREGKRPLLTGD+ V L
Sbjct  122  PVTFGPEASLKLDVVVLGGDFNNENDEDWTQEEFESHVVKEREGKRPLLTGDMCVVL  178



>gb|EEC72606.1| hypothetical protein OsI_06079 [Oryza sativa Indica Group]
Length=669

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 6/184 (3%)
 Frame = +1

Query  118  SMRGKRSLE-----GDEEQQPERKRP-ALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            +M+ KR LE     GD   + +R RP ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEE
Sbjct  45   AMKEKRGLEAAAAGGDGRPEAKRARPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEE  104

Query  280  VERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVL  459
            VERAL +LGPA I  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGGKVEGEQGAAIHVVL
Sbjct  105  VERALGRLGPATITGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGGKVEGEQGAAIHVVL  164

Query  460  IDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDL  639
            +D+ +G VV++GPESC KLD+VVLEGDFNNED++ W+ EEFESHVVKEREGKRPLLTGD+
Sbjct  165  LDAGTGCVVSSGPESCAKLDIVVLEGDFNNEDEEGWSGEEFESHVVKEREGKRPLLTGDV  224

Query  640  QVTL  651
            QVTL
Sbjct  225  QVTL  228



>dbj|BAK04468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 16/203 (8%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLE--------GDEEQQPERKR-PALASVIVEALKVDSLQKL  234
            ++ Q R+MER+ S   KR+L+        GD+E+ P+R R PALASVIVEALK+DSLQKL
Sbjct  1    MQRQGRHMERSGS---KRALDPGGSGGGGGDDERDPKRPRVPALASVIVEALKLDSLQKL  57

Query  235  CSSLEPILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLP  402
            CSSLEPILRRVVSEEVERALAKLGPA    RI  R+SPKRIEGP+G N+QL FRSRL+LP
Sbjct  58   CSSLEPILRRVVSEEVERALAKLGPAAAPARIEGRTSPKRIEGPNGSNLQLQFRSRLALP  117

Query  403  LFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEF  582
            LFTGGKVEGEQGA+IHVVL+D+N+GHVVT+GP+S  KLDV+VLEGDFN E D+DWT+EEF
Sbjct  118  LFTGGKVEGEQGASIHVVLLDANTGHVVTSGPQSSAKLDVLVLEGDFNKEKDEDWTEEEF  177

Query  583  ESHVVKEREGKRPLLTGDLQVTL  651
            ESH+VKEREGKRPLL GD+ VTL
Sbjct  178  ESHIVKEREGKRPLLNGDIHVTL  200



>dbj|BAJ96828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 16/203 (8%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLE--------GDEEQQPERKR-PALASVIVEALKVDSLQKL  234
            ++ Q R+MER+ S   KR+L+        GD+E+ P+R R PALASVIVEALK+DSLQKL
Sbjct  1    MQRQGRHMERSGS---KRALDPGGSGGGGGDDERDPKRPRVPALASVIVEALKLDSLQKL  57

Query  235  CSSLEPILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLP  402
            CSSLEPILRRVVSEEVERALAKLGPA    RI  R+SPKRIEGP+G N+QL FRSRL+LP
Sbjct  58   CSSLEPILRRVVSEEVERALAKLGPAAAPARIEGRTSPKRIEGPNGSNLQLQFRSRLALP  117

Query  403  LFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEF  582
            LFTGGKVEGEQGA+IHVVL+D+N+GHVVT+GP+S  KLDV+VLEGDFN E D+DWT+EEF
Sbjct  118  LFTGGKVEGEQGASIHVVLLDANTGHVVTSGPQSSAKLDVLVLEGDFNKEKDEDWTEEEF  177

Query  583  ESHVVKEREGKRPLLTGDLQVTL  651
            ESH+VKEREGKRPLL GD+ VTL
Sbjct  178  ESHIVKEREGKRPLLNGDIHVTL  200



>gb|EAZ30858.1| hypothetical protein OsJ_14930 [Oryza sativa Japonica Group]
Length=610

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 167/198 (84%), Gaps = 8/198 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRG---KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLE  249
            ++ Q R++ER+ S R          D+++ P+R R PALASVIVEALKVDSLQKLCSSLE
Sbjct  1    MQRQGRHLERSGSKRALDAGGGGGDDDDRAPKRPRVPALASVIVEALKVDSLQKLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            PILRRVVSEEVERALAKLGPA    RI  RSSPKRIEGP G N+QL FRSRLSLPLFTGG
Sbjct  61   PILRRVVSEEVERALAKLGPAATPARIQGRSSPKRIEGPSGINLQLQFRSRLSLPLFTGG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIHVVL+D+N+G VVT+GPES  KLDV+VLEGDFN E D+DWT+EEFE+H+V
Sbjct  121  KVEGEQGAAIHVVLLDANTGRVVTSGPESFAKLDVLVLEGDFNKEQDEDWTEEEFENHIV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>ref|NP_001130446.1| uncharacterized protein LOC100191543 [Zea mays]
 gb|ACF78658.1| unknown [Zea mays]
Length=471

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 165/194 (85%), Gaps = 6/194 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEP  252
            ++ Q R++ER+NS R      G ++     KRP   ALASVIVEALKVD LQKLCSSLEP
Sbjct  1    MQRQGRHLERSNSKRALDHGGGGDDDDRPSKRPRVPALASVIVEALKVDCLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRR+VSEEVERALAKLGPA   RI  R SPKRIEGPDGR++QL FR+RLSLPLFTGGKV
Sbjct  61   ILRRIVSEEVERALAKLGPAGPARIQGRGSPKRIEGPDGRSLQLQFRTRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+N+GHVVT+GPES +KLD++VLEGDFN E+D+ WT+E+FESH+VKE
Sbjct  121  EGEQGAAIHVVLLDANTGHVVTSGPESSVKLDILVLEGDFNKEEDEGWTEEDFESHIVKE  180

Query  604  REGKRPLLTGDLQV  645
            REGKRP+LTGDLQV
Sbjct  181  REGKRPILTGDLQV  194



>ref|NP_001052891.1| Os04g0444200 [Oryza sativa Japonica Group]
 emb|CAE02429.1| OSJNBa0058G03.4 [Oryza sativa Japonica Group]
 dbj|BAF14805.1| Os04g0444200 [Oryza sativa Japonica Group]
Length=652

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 167/198 (84%), Gaps = 8/198 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRG---KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLE  249
            ++ Q R++ER+ S R          D+++ P+R R PALASVIVEALKVDSLQKLCSSLE
Sbjct  1    MQRQGRHLERSGSKRALDAGGGGGDDDDRAPKRPRVPALASVIVEALKVDSLQKLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            PILRRVVSEEVERALAKLGPA    RI  RSSPKRIEGP G N+QL FRSRLSLPLFTGG
Sbjct  61   PILRRVVSEEVERALAKLGPAATPARIQGRSSPKRIEGPSGINLQLQFRSRLSLPLFTGG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIHVVL+D+N+G VVT+GPES  KLDV+VLEGDFN E D+DWT+EEFE+H+V
Sbjct  121  KVEGEQGAAIHVVLLDANTGRVVTSGPESFAKLDVLVLEGDFNKEQDEDWTEEEFENHIV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>gb|EAY94271.1| hypothetical protein OsI_16040 [Oryza sativa Indica Group]
Length=652

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 167/198 (84%), Gaps = 8/198 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRG---KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLE  249
            ++ Q R++ER+ S R          D+++ P+R R PALASVIVEALKVDSLQKLCSSLE
Sbjct  1    MQRQGRHLERSGSKRALDAGGGGGDDDDRAPKRPRVPALASVIVEALKVDSLQKLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGG  417
            PILRRVVSEEVERALAKLGPA    RI  RSSPKRIEGP G N+QL FRSRLSLPLFTGG
Sbjct  61   PILRRVVSEEVERALAKLGPAATPARIQGRSSPKRIEGPSGINLQLQFRSRLSLPLFTGG  120

Query  418  KVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVV  597
            KVEGEQGAAIHVVL+D+N+G VVT+GPES  KLDV+VLEGDFN E D+DWT+EEFE+H+V
Sbjct  121  KVEGEQGAAIHVVLLDANTGRVVTSGPESFAKLDVLVLEGDFNKEQDEDWTEEEFENHIV  180

Query  598  KEREGKRPLLTGDLQVTL  651
            KEREGKRPLLTGDLQVTL
Sbjct  181  KEREGKRPLLTGDLQVTL  198



>ref|XP_003570530.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
 ref|XP_010233903.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
Length=614

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  121  MRGKRSLE-GDEEQQPERKRP-ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            M+ KR LE GD   + +R RP ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVERAL
Sbjct  1    MKEKRGLEAGDGHPEAKRSRPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVERAL  60

Query  295  AKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
             KLGPA I  RSSPKRIEGPDGRN+QL FR+RLSLPLFTGGKVEGEQGAAIHV+L+D+ +
Sbjct  61   GKLGPAAITGRSSPKRIEGPDGRNLQLQFRTRLSLPLFTGGKVEGEQGAAIHVILLDTGT  120

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            G VV++GPES  KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP++TGD+QVTL
Sbjct  121  GCVVSSGPESSAKLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPIITGDIQVTL  179



>ref|XP_008667039.1| PREDICTED: uncharacterized protein LOC100191543 isoform X1 [Zea 
mays]
Length=652

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 167/196 (85%), Gaps = 6/196 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEP  252
            ++ Q R++ER+NS R      G ++     KRP   ALASVIVEALKVD LQKLCSSLEP
Sbjct  1    MQRQGRHLERSNSKRALDHGGGGDDDDRPSKRPRVPALASVIVEALKVDCLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRR+VSEEVERALAKLGPA   RI  R SPKRIEGPDGR++QL FR+RLSLPLFTGGKV
Sbjct  61   ILRRIVSEEVERALAKLGPAGPARIQGRGSPKRIEGPDGRSLQLQFRTRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+N+GHVVT+GPES +KLD++VLEGDFN E+D+ WT+E+FESH+VKE
Sbjct  121  EGEQGAAIHVVLLDANTGHVVTSGPESSVKLDILVLEGDFNKEEDEGWTEEDFESHIVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRP+LTGDLQVTL
Sbjct  181  REGKRPILTGDLQVTL  196



>ref|XP_008667040.1| PREDICTED: uncharacterized protein LOC100191543 isoform X2 [Zea 
mays]
Length=653

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 167/196 (85%), Gaps = 6/196 (3%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEP  252
            ++ Q R++ER+NS R      G ++     KRP   ALASVIVEALKVD LQKLCSSLEP
Sbjct  1    MQRQGRHLERSNSKRALDHGGGGDDDDRPSKRPRVPALASVIVEALKVDCLQKLCSSLEP  60

Query  253  ILRRVVSEEVERALAKLGPA---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKV  423
            ILRR+VSEEVERALAKLGPA   RI  R SPKRIEGPDGR++QL FR+RLSLPLFTGGKV
Sbjct  61   ILRRIVSEEVERALAKLGPAGPARIQGRGSPKRIEGPDGRSLQLQFRTRLSLPLFTGGKV  120

Query  424  EGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKE  603
            EGEQGAAIHVVL+D+N+GHVVT+GPES +KLD++VLEGDFN E+D+ WT+E+FESH+VKE
Sbjct  121  EGEQGAAIHVVLLDANTGHVVTSGPESSVKLDILVLEGDFNKEEDEGWTEEDFESHIVKE  180

Query  604  REGKRPLLTGDLQVTL  651
            REGKRP+LTGDLQVTL
Sbjct  181  REGKRPILTGDLQVTL  196



>ref|XP_006646962.1| PREDICTED: uncharacterized protein LOC102709708 [Oryza brachyantha]
Length=606

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 158/182 (87%), Gaps = 5/182 (3%)
 Frame = +1

Query  121  MRGKRSLE----GDEEQQPERKRP-ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  285
            M+ KR LE    GD   + +R RP ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVE
Sbjct  1    MKEKRGLEAAAAGDGRPEAKRARPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVE  60

Query  286  RALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLID  465
            RAL +LGPA I  RSSPKRIEGPDGR +QL FR+RLSLPLFTGGKVEGEQGAAIHVVL+D
Sbjct  61   RALGRLGPATITGRSSPKRIEGPDGRTLQLQFRTRLSLPLFTGGKVEGEQGAAIHVVLLD  120

Query  466  SNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQV  645
              +G VV++GPESC KLD+VVLEGDFNNED++ W+ EEF+SHVVKEREGKRPLLTGD+QV
Sbjct  121  VGTGCVVSSGPESCAKLDIVVLEGDFNNEDEEGWSGEEFDSHVVKEREGKRPLLTGDVQV  180

Query  646  TL  651
            TL
Sbjct  181  TL  182



>gb|EMT33137.1| hypothetical protein F775_28653 [Aegilops tauschii]
Length=959

 Score =   287 bits (734),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 172/202 (85%), Gaps = 15/202 (7%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRGKRSLE-------GDEEQQPERKR-PALASVIVEALKVDSLQKLC  237
            ++ Q R+MER+ S   KR+L+       GD+E+ P+R R PALASVIVEALK+DSLQKLC
Sbjct  312  MQRQGRHMERSGS---KRALDPGGSGGGGDDERDPKRPRVPALASVIVEALKLDSLQKLC  368

Query  238  SSLEPILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLPL  405
            SSLEPILRRVVSEEVERALAKLGPA    RI  R+SPKRIEGP+G N+QL FRSRL+LPL
Sbjct  369  SSLEPILRRVVSEEVERALAKLGPAAAPARIEGRTSPKRIEGPNGSNLQLQFRSRLALPL  428

Query  406  FTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFE  585
            FTGGKVEGEQGAAIHVVL+D+N+GHVVT+GPES  KLDV+VLEGDFN E D+DWT+EEFE
Sbjct  429  FTGGKVEGEQGAAIHVVLLDANTGHVVTSGPESFAKLDVLVLEGDFNKEKDEDWTEEEFE  488

Query  586  SHVVKEREGKRPLLTGDLQVTL  651
            SH+VKEREGKRPLL GD+ VTL
Sbjct  489  SHIVKEREGKRPLLNGDIHVTL  510



>emb|CDY59992.1| BnaA02g35270D [Brassica napus]
Length=629

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 165/187 (88%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSM-RGKRSLEGDEE-QQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSE  276
            M+R N+M R KRS +G+ +  QP+RKRPALASVIVEALKV+SLQKLCSSLEPILRRVVSE
Sbjct  1    MDRGNNMNRAKRSFDGNGDGDQPDRKRPALASVIVEALKVNSLQKLCSSLEPILRRVVSE  60

Query  277  EVERALAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EVERALAKLGPAR+  ++ SSPKRIEGP+G N++L FRSRLSLPLFTGG+VEGEQGAAIH
Sbjct  61   EVERALAKLGPARLTGSSGSSPKRIEGPNGSNLRLQFRSRLSLPLFTGGRVEGEQGAAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            +VLID+N+   V  GPE+  KL+VV L+GDFN EDD+DWT+EEFESHVVKER+GKRPLLT
Sbjct  121  IVLIDANTRRAVLHGPEASAKLEVVALDGDFNAEDDEDWTKEEFESHVVKERQGKRPLLT  180

Query  631  GDLQVTL  651
            GDL VTL
Sbjct  181  GDLGVTL  187



>emb|CDY52577.1| BnaCnng22620D [Brassica napus]
Length=623

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 176/195 (90%), Gaps = 7/195 (4%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLE------GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLE  249
            MQTRYMERTNSMR KR LE        ++QQPERKRPALASVIVEALK+DSLQ+LCSSLE
Sbjct  1    MQTRYMERTNSMREKRKLEEDDDNNNQQQQQPERKRPALASVIVEALKMDSLQRLCSSLE  60

Query  250  PILRRVVSEEVERALAKLGPARIAA-RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            PILRRVVSEEVERALAKLGPAR+++ RSSPKRIEG  GRN+QL FRSRLS+PLFTGGK+E
Sbjct  61   PILRRVVSEEVERALAKLGPARLSSERSSPKRIEGIGGRNLQLQFRSRLSVPLFTGGKIE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D+ +GHV+T GPE+  KLDVVVL+GDFNNED++ WT+EEFESH+VKER
Sbjct  121  GEQGAAIHVVLLDATTGHVLTVGPEASAKLDVVVLDGDFNNEDEEGWTEEEFESHLVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            +GKRPLLTGD+QVTL
Sbjct  181  QGKRPLLTGDVQVTL  195



>gb|EMS55488.1| hypothetical protein TRIUR3_12862 [Triticum urartu]
Length=657

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 167/202 (83%), Gaps = 12/202 (6%)
 Frame = +1

Query  82   IRMQTRYMERTNSMRG-------KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLC  237
            ++ Q R+MER+ S R              D+E+ P+R R PALASVIVEALK+DSLQKLC
Sbjct  1    MQRQGRHMERSGSKRALDPGGSGGGGGGDDDERDPKRPRVPALASVIVEALKLDSLQKLC  60

Query  238  SSLEPILRRVVSEEVERALAKLGPA----RIAARSSPKRIEGPDGRNMQLHFRSRLSLPL  405
            SSLEPILRRVVSEEVERALAKLGPA    RI  R+SPKRIEGP+G N+QL FRSRL+LPL
Sbjct  61   SSLEPILRRVVSEEVERALAKLGPAAAPARIEGRTSPKRIEGPNGSNLQLQFRSRLALPL  120

Query  406  FTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFE  585
            FTGGKVEGEQGA+IHVVL+D+N+GHVVT+GPES  KLDV+VLEGDFN E D+DWT+EEFE
Sbjct  121  FTGGKVEGEQGASIHVVLLDANTGHVVTSGPESFAKLDVLVLEGDFNKEKDEDWTEEEFE  180

Query  586  SHVVKEREGKRPLLTGDLQVTL  651
            SH+VKEREGKRPLL GD+ VTL
Sbjct  181  SHIVKEREGKRPLLNGDIHVTL  202



>ref|XP_010433589.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
 ref|XP_010433590.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
Length=620

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KR+LEG++E +PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL P
Sbjct  2    KRNLEGNDEDKPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLAP  61

Query  310  ARIAARS--SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            A + A S  SPKRI  PD RN+QL F+SRLSLPLFTGG+VEGEQGAAIHVVLID+N G  
Sbjct  62   AGLTASSGSSPKRIGCPDARNLQLQFKSRLSLPLFTGGRVEGEQGAAIHVVLIDANIGRP  121

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT GPE+ +KLDVVVL GDFNNE+++DWTQEEFESHVVKEREGKRPLLTG + V L
Sbjct  122  VTFGPEASLKLDVVVLGGDFNNENNEDWTQEEFESHVVKEREGKRPLLTGYMCVVL  177



>ref|NP_001152440.1| LOC100286080 [Zea mays]
 gb|ACN34355.1| unknown [Zea mays]
 gb|AFW66305.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  121  MRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERA  291
            M+ KR LE   + +P+ KRP   ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVERA
Sbjct  1    MKDKRGLEDAGDGRPDAKRPRPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVERA  60

Query  292  LAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            L KLGPA I  R SPKRIEGP+GR +QL FR+RLSLPLFTGGKVEGEQGAAIHVVL D+ 
Sbjct  61   LGKLGPATIGGRPSPKRIEGPNGRTLQLEFRTRLSLPLFTGGKVEGEQGAAIHVVLFDAG  120

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G VV++GPES  KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP+LTGDLQVTL
Sbjct  121  TGCVVSSGPESSAKLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPILTGDLQVTL  180



>gb|ACG47634.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +1

Query  121  MRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERA  291
            M+ KR LE   + +P+ KRP   ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVERA
Sbjct  1    MKDKRGLEDAGDGRPDAKRPRPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVERA  60

Query  292  LAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            L KLGPA I  R SPKRIEGP+GR +QL FR+RLSLPLFTGGKVEGEQGAAIHVVL D+ 
Sbjct  61   LGKLGPATIGGRPSPKRIEGPNGRTLQLEFRTRLSLPLFTGGKVEGEQGAAIHVVLFDAG  120

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G VV++GPES  KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP+LTGDLQVTL
Sbjct  121  TGCVVSSGPESSAKLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPILTGDLQVTL  180



>ref|XP_010438831.1| PREDICTED: uncharacterized protein LOC104722380 [Camelina sativa]
Length=630

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 157/177 (89%), Gaps = 3/177 (2%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KR+LEG+++ +PERKRPALASVIVEALK+DSLQKLCSSLEPILRR+VSEEVERALAKL P
Sbjct  2    KRNLEGNDDDKPERKRPALASVIVEALKLDSLQKLCSSLEPILRRIVSEEVERALAKLVP  61

Query  310  A---RIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            A     ++ SSPKRI  PDGRN+QL F+SRLSLPLFTGG+VEGEQGAAIHVVLID+N G 
Sbjct  62   AAGLTASSGSSPKRIGCPDGRNLQLQFKSRLSLPLFTGGRVEGEQGAAIHVVLIDANIGR  121

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
             VT GPE+ +KLDVVVL GDFNNE+D DWTQEEFESHVVKEREGKRPLLTGD+ V L
Sbjct  122  PVTFGPEASLKLDVVVLGGDFNNENDQDWTQEEFESHVVKEREGKRPLLTGDMCVVL  178



>ref|XP_006282572.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
 gb|EOA15470.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
Length=619

 Score =   278 bits (710),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGP  309
            KRSLEG+++ + ERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKL P
Sbjct  2    KRSLEGNDDDKHERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLAP  61

Query  310  ARIAARS--SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHV  483
            A + A S  SPKRI   DGRN+QLHF+SRLSLPLFTGG+VEGEQGAA+HVVLID+NSG  
Sbjct  62   ASLTASSVSSPKRIGCSDGRNLQLHFKSRLSLPLFTGGRVEGEQGAAVHVVLIDANSGRP  121

Query  484  VTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VT G E+ +KLDVVVL GDF NE+D+DWTQEEF+SHVVKEREGKRPLLTGDL V L
Sbjct  122  VTFGLEASLKLDVVVLGGDFTNENDEDWTQEEFDSHVVKEREGKRPLLTGDLCVVL  177



>ref|XP_009126828.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
 ref|XP_009126829.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
Length=625

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 165/188 (88%), Gaps = 6/188 (3%)
 Frame = +1

Query  103  MERTNSM-RGKRSLE--GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            M+R N+M R KRS +  GD +Q P+RKRPALASVIVEALKV+SLQKLCSSLEPILRRVVS
Sbjct  1    MDRGNNMNRAKRSFDCNGDGDQ-PDRKRPALASVIVEALKVNSLQKLCSSLEPILRRVVS  59

Query  274  EEVERALAKLGPARI--AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            EEVERALAKLGPAR+  ++ SSPKRIEGP+G N++L FRSRLSLPLFTGG+VEGEQGAAI
Sbjct  60   EEVERALAKLGPARLTGSSGSSPKRIEGPNGSNLRLQFRSRLSLPLFTGGRVEGEQGAAI  119

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+   V  GPE+  KL+VV L+GDFN EDD+DWT+EEFESHVVKER+GKRPLL
Sbjct  120  HIVLIDANTRRAVLHGPEASAKLEVVALDGDFNAEDDEDWTKEEFESHVVKERQGKRPLL  179

Query  628  TGDLQVTL  651
            TGDL VTL
Sbjct  180  TGDLGVTL  187



>ref|XP_004951715.1| PREDICTED: uncharacterized protein LOC101768423 [Setaria italica]
Length=617

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 3/167 (2%)
 Frame = +1

Query  160  QPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARS  330
            +PE KR   PALASVIVEALK+DSLQ+LCSSLEPILRRVVSEEVERAL +LGPA I+ RS
Sbjct  19   RPEAKRARPPALASVIVEALKMDSLQRLCSSLEPILRRVVSEEVERALVRLGPATISGRS  78

Query  331  SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCM  510
            SPKRIEGPDGR +QL FR+RLSLPLFTGGKVEGEQGAAIHVVL+D+ SG VV++GPES  
Sbjct  79   SPKRIEGPDGRTLQLQFRTRLSLPLFTGGKVEGEQGAAIHVVLLDAGSGCVVSSGPESSA  138

Query  511  KLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP+LTGDLQVTL
Sbjct  139  KLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPILTGDLQVTL  185



>ref|XP_008800271.1| PREDICTED: uncharacterized protein LOC103714689 [Phoenix dactylifera]
Length=641

 Score =   276 bits (705),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 6/190 (3%)
 Frame = +1

Query  100  YMERTNSM-RGKRSLE--GDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILR  261
            Y+ER+N+M R KR L+    E+  PE KR   PALASVIVEALKVDSLQK+CSSLEPILR
Sbjct  7    YLERSNTMTREKRGLDPSDGEDVHPEPKRKKVPALASVIVEALKVDSLQKICSSLEPILR  66

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            RVVSEEVERALAKLGPARI  RSSPKRIEGPDGRN+QLHFRS LSLPLFTGGKVEGEQGA
Sbjct  67   RVVSEEVERALAKLGPARIGGRSSPKRIEGPDGRNLQLHFRSTLSLPLFTGGKVEGEQGA  126

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            A+HVVL+D+N+GHVVT+G ES  KLDVVVLEGDFNNEDDDDWT+EEFE HVVKEREGKRP
Sbjct  127  AVHVVLLDANTGHVVTSGQESSAKLDVVVLEGDFNNEDDDDWTEEEFEGHVVKEREGKRP  186

Query  622  LLTGDLQVTL  651
            LLTGDLQV+L
Sbjct  187  LLTGDLQVSL  196



>gb|AFW70388.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 157/184 (85%), Gaps = 7/184 (4%)
 Frame = +1

Query  121  MRGKRSLEGDEEQ----QPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            M+ KR LE         +P+ KR   PALASVIVEALK+DSLQ+LCSSLEPILRRVVSEE
Sbjct  1    MKEKRGLEDAGGGAGDGRPDAKRSRPPALASVIVEALKMDSLQRLCSSLEPILRRVVSEE  60

Query  280  VERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVL  459
            VERAL +LGPA I  RSSPKRIEGPDGR +QL FR+RLSLPLFTGGKVEGEQGAAIHVVL
Sbjct  61   VERALGRLGPATIGGRSSPKRIEGPDGRALQLQFRTRLSLPLFTGGKVEGEQGAAIHVVL  120

Query  460  IDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDL  639
            +D+ +G VV++GPES  KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP+LTGDL
Sbjct  121  LDAGTGGVVSSGPESSAKLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPILTGDL  180

Query  640  QVTL  651
            QVTL
Sbjct  181  QVTL  184



>ref|NP_001150045.1| calmodulin binding protein [Zea mays]
 gb|ACG37616.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 157/184 (85%), Gaps = 7/184 (4%)
 Frame = +1

Query  121  MRGKRSLEGDEEQ----QPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEE  279
            M+ KR LE         +P+ KR   PALASVIVEALK+DSLQ+LCSSLEPILRRVVSEE
Sbjct  1    MKEKRGLEDAGGGAGDGRPDAKRSRPPALASVIVEALKMDSLQRLCSSLEPILRRVVSEE  60

Query  280  VERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVL  459
            VERAL +LGPA I  RSSPKRIEGPDGR +QL FR+RLSLPLFTGGKVEG+QGAAIHVVL
Sbjct  61   VERALGRLGPATIGGRSSPKRIEGPDGRALQLQFRTRLSLPLFTGGKVEGDQGAAIHVVL  120

Query  460  IDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDL  639
            +D+ +G VV++GPES  KLD+VVLEGDFNNED++ WT EEF+SHVVKEREGKRP+LTGDL
Sbjct  121  LDAGTGGVVSSGPESSAKLDIVVLEGDFNNEDEEGWTGEEFDSHVVKEREGKRPILTGDL  180

Query  640  QVTL  651
            QVTL
Sbjct  181  QVTL  184



>dbj|BAJ96886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG ARI  RSSPKRIEGPD
Sbjct  44   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGSARIEGRSSPKRIEGPD  103

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            G N+QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPESC KLDV+VLEG
Sbjct  104  GTNLQLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESCAKLDVLVLEG  163

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFNNE+D+ WT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  164  DFNNEEDEGWTEEEFEGHIVKEREGKRPLLTGDLQVTL  201



>ref|XP_008805417.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805418.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805420.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
Length=654

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 173/197 (88%), Gaps = 8/197 (4%)
 Frame = +1

Query  82   IRMQTRYMERTNSM-RGKRSLE---GDEEQQPERKR---PALASVIVEALKVDSLQKLCS  240
            ++ QTR++ER+ +M R KR L+   GDE   PE KR   PALASVIVEALKVDSLQKLCS
Sbjct  1    MQRQTRHLERSGTMTREKRRLDPVDGDESH-PESKRQKVPALASVIVEALKVDSLQKLCS  59

Query  241  SLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGK  420
            SLEPILRRVVSEEVERALAKLGPAR   RSSPKR+EGPDGRN+QLHFRS LSLPLFTG K
Sbjct  60   SLEPILRRVVSEEVERALAKLGPARHGGRSSPKRLEGPDGRNLQLHFRSTLSLPLFTGAK  119

Query  421  VEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVK  600
            VEGEQGAAIHVVLID+N+G +VT+GPES  KLDVVVLEGDFNNEDDDDWT+EEFES+ VK
Sbjct  120  VEGEQGAAIHVVLIDTNTGLIVTSGPESSAKLDVVVLEGDFNNEDDDDWTEEEFESYAVK  179

Query  601  EREGKRPLLTGDLQVTL  651
            EREGKRPLLTGDLQV+L
Sbjct  180  EREGKRPLLTGDLQVSL  196



>ref|XP_002453396.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
 gb|EES06372.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
Length=622

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 149/166 (90%), Gaps = 3/166 (2%)
 Frame = +1

Query  163  PERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSS  333
            P+ KR   PALASVIVEALK+DSLQ+LCSSLEPILRRVVSEEVERAL +LGPA I  RSS
Sbjct  22   PDAKRARPPALASVIVEALKMDSLQRLCSSLEPILRRVVSEEVERALVRLGPAAIGGRSS  81

Query  334  PKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMK  513
            PKRIEGPDGR +QL FR+RLSLPLFTGGKVEGEQGA IHVVL+D+ +G VV++GPES  K
Sbjct  82   PKRIEGPDGRTLQLQFRTRLSLPLFTGGKVEGEQGAVIHVVLLDAGTGCVVSSGPESSAK  141

Query  514  LDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            LD+VVLEGDFNN+D++ WT EEF+SHVVKEREGKRP+LTGDLQVTL
Sbjct  142  LDIVVLEGDFNNKDEEGWTGEEFDSHVVKEREGKRPILTGDLQVTL  187



>gb|KJB69416.1| hypothetical protein B456_011G022600 [Gossypium raimondii]
Length=605

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 156/184 (85%), Gaps = 10/184 (5%)
 Frame = +1

Query  124  RGKRSLE----GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERA  291
            R KR L+    GDE   P  K+PALASVIVEALKVDSLQKLCSSLEPILR+VVSEEVERA
Sbjct  3    REKRCLDSMSSGDE--GPAMKKPALASVIVEALKVDSLQKLCSSLEPILRKVVSEEVERA  60

Query  292  LAKLGPARI----AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVL  459
            LAKLG  ++    ++ SSPKRI+G DGRN+QL F+S+LSLPLFTGGKVEGEQGAAIHV L
Sbjct  61   LAKLGHPKLNNAKSSSSSPKRIKGHDGRNLQLKFKSKLSLPLFTGGKVEGEQGAAIHVSL  120

Query  460  IDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDL  639
            ID+N+GHVVT  PES   LDVVVLEGDFNNED D+WTQEEF+SHVVKEREGKRPLLTGDL
Sbjct  121  IDANTGHVVTGSPESWATLDVVVLEGDFNNEDGDNWTQEEFDSHVVKEREGKRPLLTGDL  180

Query  640  QVTL  651
            QV L
Sbjct  181  QVIL  184



>emb|CDX94414.1| BnaC01g17700D [Brassica napus]
Length=576

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  KRSLE-GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            KR+L+  ++E+QPERKRPALASVIVEA+KVDSLQKLCSSLEPILRRVVSEEV+RALAK  
Sbjct  2    KRNLDKSNDEKQPERKRPALASVIVEAMKVDSLQKLCSSLEPILRRVVSEEVDRALAKFI  61

Query  307  PARIA--ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            P+R+A  + SSPKRI GPDGRN+QL FR+RLSLPLFTGG+VEGEQGA+IHVVLID+N+G 
Sbjct  62   PSRLAESSESSPKRISGPDGRNLQLRFRTRLSLPLFTGGRVEGEQGASIHVVLIDANTGR  121

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
             VT GPE+ +KL+VVVLEGDFN E   DW++EEFESHVVKER+GKRPLLTGDL V L
Sbjct  122  HVTFGPEASLKLEVVVLEGDFNKE---DWSREEFESHVVKERDGKRPLLTGDLCVVL  175



>ref|XP_003529298.1| PREDICTED: uncharacterized protein LOC100812605 [Glycine max]
Length=623

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = +1

Query  124  RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  297
            R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA
Sbjct  6    REKRGLDSASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  65

Query  298  KLGPARI-AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
            KLGPA++   RSSPKRIEGPDG+N+QLHF++RLSLPLFTGGKVEGEQG AIH+VLID+NS
Sbjct  66   KLGPAKLNTGRSSPKRIEGPDGKNLQLHFKTRLSLPLFTGGKVEGEQGTAIHIVLIDANS  125

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GH+VT+GPESC++LDV+VLEGDFNNEDDD+W +EEF+SH+VKEREGKRPLLTGDLQVTL
Sbjct  126  GHIVTSGPESCVRLDVIVLEGDFNNEDDDNWDEEEFDSHIVKEREGKRPLLTGDLQVTL  184



>ref|XP_009139545.1| PREDICTED: uncharacterized protein LOC103863555 [Brassica rapa]
Length=575

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  KRSLE-GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            KRSL+  ++E+QPERKRPALASVIVEA+KVDSLQKLCSSLEPILRRVVSEEVERALAK  
Sbjct  2    KRSLDKSNDEKQPERKRPALASVIVEAMKVDSLQKLCSSLEPILRRVVSEEVERALAKFI  61

Query  307  PARIA--ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            P+R+A  + SSPKRI GPDGRN+QL FR+RLSLPLFTGG+VEGEQGA+IHVVLID+N+G 
Sbjct  62   PSRLAESSESSPKRITGPDGRNLQLRFRTRLSLPLFTGGRVEGEQGASIHVVLIDANTGR  121

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
             V  GPE+ +KL+VVVLEGDFN E   DW++EEFESHVVKER GKRPLLTGDL V L
Sbjct  122  HVAFGPEASLKLEVVVLEGDFNKE---DWSREEFESHVVKERHGKRPLLTGDLCVVL  175



>dbj|BAJ94992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG ARI  RSSPKRIEGPD
Sbjct  44   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGSARIEGRSSPKRIEGPD  103

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            G N+QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPESC KLDV+VLEG
Sbjct  104  GTNLQLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESCAKLDVLVLEG  163

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFNNE+D+ WT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  164  DFNNEEDEGWTEEEFEGHIVKEREGKRPLLTGDLQVTL  201



>gb|EMT06125.1| hypothetical protein F775_27254 [Aegilops tauschii]
Length=699

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPAR+  RSSPKRIEGPD
Sbjct  39   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARVEGRSSPKRIEGPD  98

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            G N+QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPESC KLDV+VLEG
Sbjct  99   GTNLQLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESCAKLDVLVLEG  158

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFN E+D+ WT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  159  DFNKEEDEGWTEEEFEGHIVKEREGKRPLLTGDLQVTL  196



>gb|KHN07315.1| hypothetical protein glysoja_027405 [Glycine soja]
Length=623

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = +1

Query  124  RGKRSLEGD--EEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  297
            R KR L+    EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA
Sbjct  6    REKRGLDSASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  65

Query  298  KLGPARI-AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
            KLGPA++   RSSPKRIEGPDG+N+QLHF++RLSLPLFTGGKVEGEQG +IH+VLID+N+
Sbjct  66   KLGPAKLNTGRSSPKRIEGPDGKNLQLHFKTRLSLPLFTGGKVEGEQGTSIHIVLIDANT  125

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GH+VT+GPESC++LDV+VLEGDFNNEDDD+W +EEF+SH+VKEREGKRPLLTGDLQVTL
Sbjct  126  GHIVTSGPESCVRLDVIVLEGDFNNEDDDNWDEEEFDSHIVKEREGKRPLLTGDLQVTL  184



>emb|CDX89394.1| BnaA01g14990D [Brassica napus]
Length=575

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (89%), Gaps = 6/177 (3%)
 Frame = +1

Query  130  KRSLE-GDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            KR+L+  ++E+QPERKRPALASVIVEA+KVDSLQKLCSSLEPILRRVVSEEVERALAK  
Sbjct  2    KRNLDKSNDEKQPERKRPALASVIVEAMKVDSLQKLCSSLEPILRRVVSEEVERALAKFI  61

Query  307  PARIA--ARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            P+R+A  + SSPKRI GPDGRN+QL FR+RLSLPLFTGG+VEGEQGA+IHVVLID+++G 
Sbjct  62   PSRLAESSESSPKRISGPDGRNLQLRFRTRLSLPLFTGGRVEGEQGASIHVVLIDAHTGR  121

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
             V  GPE+ +KL+VVVLEGDFN E   DW++EEFESHVVKER+GKRPLLTGDL V L
Sbjct  122  HVAFGPEASLKLEVVVLEGDFNKE---DWSREEFESHVVKERDGKRPLLTGDLCVVL  175



>gb|EEC73417.1| hypothetical protein OsI_07682 [Oryza sativa Indica Group]
Length=652

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPKRIEGPD
Sbjct  38   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIQGRSSPKRIEGPD  97

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            GRN+QL F +RLSLPLFTGGKVEGEQGAAIHVVL+D+N+G  VT+GPESC KLDV+VLEG
Sbjct  98   GRNLQLKFTTRLSLPLFTGGKVEGEQGAAIHVVLLDANTGVAVTSGPESCAKLDVLVLEG  157

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFNNE+D+DWT+EEFESH+VKEREGKRPLLTGDLQVTL
Sbjct  158  DFNNEEDEDWTEEEFESHIVKEREGKRPLLTGDLQVTL  195



>ref|NP_001047151.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAD16554.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF09065.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAG93360.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57202.1| hypothetical protein OsJ_07158 [Oryza sativa Japonica Group]
Length=652

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPKRIEGPD
Sbjct  38   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIQGRSSPKRIEGPD  97

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            GRN+QL F +RLSLPLFTGGKVEGEQGAAIHVVL+D+N+G  VT+GPESC KLDV+VLEG
Sbjct  98   GRNLQLKFTTRLSLPLFTGGKVEGEQGAAIHVVLLDANTGVAVTSGPESCAKLDVLVLEG  157

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFNNE+D+DWT+EEFESH+VKEREGKRPLLTGDLQVTL
Sbjct  158  DFNNEEDEDWTEEEFESHIVKEREGKRPLLTGDLQVTL  195



>ref|XP_002452291.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
 gb|EES05267.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
Length=650

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 166/186 (89%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEG--DEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG     G  D+E  P+R R PALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLDPTGGGDDDEHAPKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKLGPARI  RSSPKRIEGPDGRN+QL FRS+L+LP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLGPARIQGRSSPKRIEGPDGRNLQLQFRSQLALPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDFN E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDILVLEGDFNKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>ref|XP_006647388.1| PREDICTED: uncharacterized protein LOC102720488 isoform X1 [Oryza 
brachyantha]
Length=655

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPKRIEGPD
Sbjct  40   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIQGRSSPKRIEGPD  99

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            GRN+QL F +RLSLPLFTGGKVEGEQGAAIHVVL+D+N+G  VT+GPESC KLDV+VLEG
Sbjct  100  GRNLQLKFTTRLSLPLFTGGKVEGEQGAAIHVVLLDANTGVAVTSGPESCAKLDVLVLEG  159

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFN E+++DWT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  160  DFNKEEEEDWTEEEFEGHIVKEREGKRPLLTGDLQVTL  197



>ref|XP_006647389.1| PREDICTED: uncharacterized protein LOC102720488 isoform X2 [Oryza 
brachyantha]
Length=654

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  178  PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPD  357
            PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPKRIEGPD
Sbjct  40   PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIQGRSSPKRIEGPD  99

Query  358  GRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEG  537
            GRN+QL F +RLSLPLFTGGKVEGEQGAAIHVVL+D+N+G  VT+GPESC KLDV+VLEG
Sbjct  100  GRNLQLKFTTRLSLPLFTGGKVEGEQGAAIHVVLLDANTGVAVTSGPESCAKLDVLVLEG  159

Query  538  DFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            DFN E+++DWT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  160  DFNKEEEEDWTEEEFEGHIVKEREGKRPLLTGDLQVTL  197



>ref|XP_003575160.1| PREDICTED: uncharacterized protein LOC100846328 isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   260 bits (664),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = +1

Query  163  PERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPK  339
            P+R R PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPK
Sbjct  33   PKRPRVPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIEGRSSPK  92

Query  340  RIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLD  519
            RIEGPDG+N+QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPES  KLD
Sbjct  93   RIEGPDGKNLQLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESFAKLD  152

Query  520  VVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            V+VLEGDFN E+D+DWT+EEFESH+VKEREGKRPLL GDLQVTL
Sbjct  153  VLVLEGDFNKEEDEDWTEEEFESHIVKEREGKRPLLHGDLQVTL  196



>ref|XP_010235560.1| PREDICTED: uncharacterized protein LOC100846328 isoform X1 [Brachypodium 
distachyon]
Length=650

 Score =   260 bits (664),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = +1

Query  163  PERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPK  339
            P+R R PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPK
Sbjct  33   PKRPRVPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIEGRSSPK  92

Query  340  RIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLD  519
            RIEGPDG+N+QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPES  KLD
Sbjct  93   RIEGPDGKNLQLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESFAKLD  152

Query  520  VVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            V+VLEGDFN E+D+DWT+EEFESH+VKEREGKRPLL GDLQVTL
Sbjct  153  VLVLEGDFNKEEDEDWTEEEFESHIVKEREGKRPLLHGDLQVTL  196



>ref|XP_008645829.1| PREDICTED: uncharacterized protein LOC103627307 isoform X2 [Zea 
mays]
Length=650

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 166/186 (89%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEG--DEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG     G  D++  P+R R PALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLEPTGGGDDDDHAPKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKLGPARI  RSSPKRIEGPDGRN+QL FRS+L+LP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLGPARIQGRSSPKRIEGPDGRNLQLQFRSQLALPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDF+ E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDILVLEGDFSKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>ref|XP_008645828.1| PREDICTED: uncharacterized protein LOC103627307 isoform X1 [Zea 
mays]
 gb|AFW71857.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=651

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 166/186 (89%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEG--DEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG     G  D++  P+R R PALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLEPTGGGDDDDHAPKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKLGPARI  RSSPKRIEGPDGRN+QL FRS+L+LP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLGPARIQGRSSPKRIEGPDGRNLQLQFRSQLALPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDF+ E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDILVLEGDFSKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>ref|XP_008678706.1| PREDICTED: uncharacterized protein LOC103653644 [Zea mays]
 gb|AFW62646.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=652

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 6/189 (3%)
 Frame = +1

Query  103  MERTNSMRG-----KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRR  264
            ++R+ S RG           +++  P+R R PALASVIVEALK+DSLQKLCSSLEPILRR
Sbjct  7    LQRSGSKRGLDPTGGGGGGDNDDHAPKRPRIPALASVIVEALKMDSLQKLCSSLEPILRR  66

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            VVSEEVERALAKLGPARI  RSSPKRIEGPDGRN+QL FRS+L+LP+FTGGKVEGEQGAA
Sbjct  67   VVSEEVERALAKLGPARIQGRSSPKRIEGPDGRNLQLQFRSQLALPIFTGGKVEGEQGAA  126

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+N+G VVT+GPES  KLD++VLEGDFN ++D+DWT+EEFES++VKEREGKRPL
Sbjct  127  IHVVLLDANTGCVVTSGPESFAKLDILVLEGDFNKDEDEDWTEEEFESNIVKEREGKRPL  186

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  187  LTGDLQVTL  195



>ref|XP_003532556.1| PREDICTED: uncharacterized protein LOC100806393 [Glycine max]
Length=624

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +1

Query  139  LEGDEEQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  318
            L   EE QP+RKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPA++
Sbjct  13   LASAEEGQPDRKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPAKL  72

Query  319  --AARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTT  492
                RSSPK IEGPDG+ +QLHF++RLSLPLFTGGKVEGEQG +IH+VLID+N+GH+VT+
Sbjct  73   NNTGRSSPKWIEGPDGKILQLHFKTRLSLPLFTGGKVEGEQGTSIHIVLIDANTGHIVTS  132

Query  493  GPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GPESC++LDV+VLEGDFNNEDDD+W +EEF+SH+VKEREGKRPLLTGDLQVTL
Sbjct  133  GPESCVRLDVIVLEGDFNNEDDDNWDEEEFDSHIVKEREGKRPLLTGDLQVTL  185



>ref|XP_002309326.2| calmodulin-binding protein 60-D [Populus trichocarpa]
 gb|EEE92849.2| calmodulin-binding protein 60-D [Populus trichocarpa]
Length=593

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 153/189 (81%), Gaps = 11/189 (6%)
 Frame = +1

Query  118  SMRGKR--------SLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRR  264
            S RG+R        S++ + +  PE K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR
Sbjct  3    SSRGRRVEKRGYDQSVDDEADNLPESKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRR  62

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            +VSEEVERAL +LGPA++A RSSP ++ GP+G N+QLHFR+R+   LFTGGKVEGEQGAA
Sbjct  63   IVSEEVERALTRLGPAKLAGRSSPPKLPGPEGNNLQLHFRTRMPPHLFTGGKVEGEQGAA  122

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+++G VV TGPES  KL+VVVLEGDFN E D+DW  E FESH VKEREGKRPL
Sbjct  123  IHVVLLDASTGTVVQTGPESAAKLNVVVLEGDFNEEADEDWAMEHFESHEVKEREGKRPL  182

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  183  LTGDLQVTL  191



>gb|EMS66476.1| hypothetical protein TRIUR3_28909 [Triticum urartu]
Length=774

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  190  SVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNM  369
            SVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI  RSSPKRIEGPDG N+
Sbjct  77   SVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIEGRSSPKRIEGPDGTNL  136

Query  370  QLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNN  549
            QL FRSRLSLPLFTGGKVEGEQGAAIHVVL+D+N+G VVT+GPESC KLDV+VLEGDFN 
Sbjct  137  QLQFRSRLSLPLFTGGKVEGEQGAAIHVVLLDTNTGCVVTSGPESCAKLDVLVLEGDFNK  196

Query  550  EDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            E+D+ WT+EEFE H+VKEREGKRPLLTGDLQVTL
Sbjct  197  EEDEGWTEEEFEGHIVKEREGKRPLLTGDLQVTL  230



>ref|XP_010448369.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
 ref|XP_010448370.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
Length=614

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 3/159 (2%)
 Frame = +1

Query  184  LASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI---AARSSPKRIEGP  354
            L  VIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAK  PAR+   ++ SSPKRI   
Sbjct  10   LLFVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKFAPARLTTASSGSSPKRIGCT  69

Query  355  DGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLE  534
            DGRN+QLHF+SRLSLPLFTGG+VEGEQGAAIHVVLID+N+G  VT GPE+ +KLDVVVL 
Sbjct  70   DGRNLQLHFKSRLSLPLFTGGRVEGEQGAAIHVVLIDANTGRPVTFGPEASLKLDVVVLG  129

Query  535  GDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GDFNNE+D+DWTQEEFESHVVKEREGKRPLLTGD+ V L
Sbjct  130  GDFNNENDEDWTQEEFESHVVKEREGKRPLLTGDMCVVL  168



>ref|XP_004952753.1| PREDICTED: uncharacterized protein LOC101756263 isoform X1 [Setaria 
italica]
 ref|XP_004952754.1| PREDICTED: uncharacterized protein LOC101756263 isoform X2 [Setaria 
italica]
Length=649

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 164/186 (88%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRG--KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG        D++  P+R R PALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLDPTGGGDDDDHAPKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKL PARI  RSSPKRIEGPDGRN+QL FRS+LSLP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLAPARIHGRSSPKRIEGPDGRNLQLQFRSQLSLPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDFN E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDIIVLEGDFNKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>ref|XP_004952755.1| PREDICTED: uncharacterized protein LOC101756263 isoform X3 [Setaria 
italica]
Length=648

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 164/186 (88%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRG--KRSLEGDEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG        D++  P+R R PALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLDPTGGGDDDDHAPKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKL PARI  RSSPKRIEGPDGRN+QL FRS+LSLP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLAPARIHGRSSPKRIEGPDGRNLQLQFRSQLSLPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDFN E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDIIVLEGDFNKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>gb|KDO59438.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=387

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLH+++R+   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHYKTRMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>gb|AGT16661.1| hypothetical protein SHCRBa_107_F16_R_30 [Saccharum hybrid cultivar 
R570]
Length=649

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ++R+ S RG     G ++     KRP   ALASVIVEALK+DSLQKLCSSLEPILRRVVS
Sbjct  7    LQRSGSKRGLDPTGGGDDDDHAAKRPRVPALASVIVEALKMDSLQKLCSSLEPILRRVVS  66

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERALAKLGPARI  RSSPKRIEGPDGRN+QL FRS+L+LP+FTGGKVEGEQGAAIHV
Sbjct  67   EEVERALAKLGPARIQGRSSPKRIEGPDGRNLQLQFRSQLALPIFTGGKVEGEQGAAIHV  126

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D+N+G VVT+GPES  KLD++VLEGDFN E+D+DWT+EEFES++VKEREGKRPLLTG
Sbjct  127  VLLDANTGCVVTSGPESFAKLDILVLEGDFNKEEDEDWTEEEFESNIVKEREGKRPLLTG  186

Query  634  DLQVTL  651
            DLQVTL
Sbjct  187  DLQVTL  192



>gb|EMT26442.1| hypothetical protein F775_27587 [Aegilops tauschii]
Length=613

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 5/182 (3%)
 Frame = +1

Query  121  MRGKRSLE----GDEEQQPERKRP-ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVE  285
            M  KR LE    GD   + +R RP ALASVIVEALKVDSLQ+LCSSLEPILRRVVSEEVE
Sbjct  1    MNEKRGLEAAAAGDGRPEAKRSRPPALASVIVEALKVDSLQRLCSSLEPILRRVVSEEVE  60

Query  286  RALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLID  465
            RAL KLGPA I  RSSPKRIEGP GRN+QL FR+RLSLPLFTGGKVEGEQGAAIHVVL+D
Sbjct  61   RALGKLGPAAITGRSSPKRIEGPGGRNLQLQFRTRLSLPLFTGGKVEGEQGAAIHVVLLD  120

Query  466  SNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQV  645
            + +G VV++G E+  KLD+VVLEGDFNNED++ WT+EEF+SH+VKEREGKRP++TGD+QV
Sbjct  121  TGNGCVVSSGLEASAKLDIVVLEGDFNNEDEEGWTEEEFDSHIVKEREGKRPIITGDIQV  180

Query  646  TL  651
            TL
Sbjct  181  TL  182



>ref|XP_006453638.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 ref|XP_006453640.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66878.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66880.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
Length=387

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLHF++ +   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHFKTSMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>ref|XP_006473988.1| PREDICTED: uncharacterized protein LOC102629839 [Citrus sinensis]
Length=607

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 152/183 (83%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLH+++R+   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHYKTRMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D+N+G VV TGPES  KL+VVVLEGDFN E+DDDWT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DTNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDDWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>ref|XP_011033469.1| PREDICTED: uncharacterized protein LOC105131940 [Populus euphratica]
Length=615

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 152/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  118  SMRGKR--------SLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRR  264
            S RG+R        S++ + +  PE K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR
Sbjct  3    SSRGRRVEKRGYEQSVDDEADNLPESKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRR  62

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            +VSEEVERAL +LGPA++A RSSP ++ GP+G N+QLHFR+R+   LFTGGKVEGEQG A
Sbjct  63   IVSEEVERALTRLGPAKLAGRSSPPKLPGPEGNNLQLHFRTRMPPHLFTGGKVEGEQGEA  122

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+++G VV TGPES  KL+VVVLEGDFN E D+DW  E F+SH VKEREGKRPL
Sbjct  123  IHVVLLDASTGTVVQTGPESAAKLNVVVLEGDFNEEADEDWAMEHFKSHEVKEREGKRPL  182

Query  625  LTGDLQVTL  651
            LTGDLQVTL
Sbjct  183  LTGDLQVTL  191



>ref|XP_010417180.1| PREDICTED: uncharacterized protein LOC104702946 isoform X2 [Camelina 
sativa]
 ref|XP_010417181.1| PREDICTED: uncharacterized protein LOC104702946 isoform X2 [Camelina 
sativa]
 ref|XP_010417182.1| PREDICTED: uncharacterized protein LOC104702946 isoform X2 [Camelina 
sativa]
Length=251

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ R++VS
Sbjct  1    MEGSMNKRGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRKIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL++LG  ++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSRLGNTKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV +
Sbjct  181  GDTQVMI  187



>ref|XP_010265653.1| PREDICTED: uncharacterized protein LOC104603341 [Nelumbo nucifera]
Length=607

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 152/190 (80%), Gaps = 7/190 (4%)
 Frame = +1

Query  103  MERTNSMRG-KRSLEGDEEQQPERKR------PALASVIVEALKVDSLQKLCSSLEPILR  261
            M+   SM G KRS E  EE + E  R      PALASVIVEALKVDSLQ+LCSSLEP+ R
Sbjct  1    MKSLRSMGGEKRSFERGEEDEDEASRAKKPRVPALASVIVEALKVDSLQRLCSSLEPLFR  60

Query  262  RVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGA  441
            R+VSEE+ERAL KLG A++A RS P+ IEGP+ R +QLHFR+RL   LFTGGKVEGEQGA
Sbjct  61   RIVSEEIERALTKLGHAKLAGRSPPQTIEGPEERKLQLHFRTRLPPHLFTGGKVEGEQGA  120

Query  442  AIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRP  621
            AIHVVLID N+G VV  GPES  K++VVVLEGDFN+E D++WT+E FES+ V+EREGKRP
Sbjct  121  AIHVVLIDGNTGFVVPEGPESAAKVNVVVLEGDFNDEADEEWTKEHFESYEVREREGKRP  180

Query  622  LLTGDLQVTL  651
            LLTGDLQVTL
Sbjct  181  LLTGDLQVTL  190



>ref|XP_006453635.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 ref|XP_006453641.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66875.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66881.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
Length=414

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLHF++ +   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHFKTSMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>ref|XP_006453637.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 ref|XP_006453639.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66877.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66879.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
Length=425

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLHF++ +   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHFKTSMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>emb|CBI18673.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG      D++  P  K+P   ALASVIVEALKVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  12   RGYEQSVEDQDDLPGSKKPKLPALASVIVEALKVDSLQRLCSSLEPLFRRIVSEEVERAL  71

Query  295  AKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
             +LG A++  RSSP RI+ P G+N+QLHF++R+   LFTGGKVEGEQGA+I VVL+D ++
Sbjct  72   TRLGHAKLVGRSSPPRIQAPGGKNLQLHFKTRMPPHLFTGGKVEGEQGASILVVLLDVDT  131

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              VV TGPES  KL+VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQVTL
Sbjct  132  SSVVQTGPESAAKLNVVVLEGDFNEESDDDWTKEHFESHEVKEREGKRPLLTGDLQVTL  190



>gb|KDO59436.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
 gb|KDO59437.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=607

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLH+++R+   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHYKTRMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>ref|XP_010417178.1| PREDICTED: uncharacterized protein LOC104702946 isoform X1 [Camelina 
sativa]
 ref|XP_010417179.1| PREDICTED: uncharacterized protein LOC104702946 isoform X1 [Camelina 
sativa]
Length=280

 Score =   239 bits (609),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 153/192 (80%), Gaps = 4/192 (2%)
 Frame = +1

Query  88   MQTRYMERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPIL  258
            MQ      + + RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ 
Sbjct  25   MQHMIAPGSMNKRGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLF  84

Query  259  RRVVSEEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQ  435
            R++VSEEVERAL++LG  ++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+
Sbjct  85   RKIVSEEVERALSRLGNTKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGER  144

Query  436  GAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGK  615
            G+AIHVVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGK
Sbjct  145  GSAIHVVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGK  204

Query  616  RPLLTGDLQVTL  651
            RP+LTGD QV +
Sbjct  205  RPILTGDTQVMI  216



>ref|XP_006453636.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 ref|XP_006453642.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66876.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
 gb|ESR66882.1| hypothetical protein CICLE_v10008603mg [Citrus clementina]
Length=607

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 4/183 (2%)
 Frame = +1

Query  115  NSMRG-KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            N  RG ++S+E + +  P  K+   PALASVIVEALK+DSLQ+LCSSLEP+LRR+VSEEV
Sbjct  6    NKKRGYEQSVEDEADGMPGSKKSKLPALASVIVEALKMDSLQRLCSSLEPLLRRIVSEEV  65

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERAL K G A++AARS P RI GP  +N+QLHF++ +   LFTGGKVEG+QGAAIHVVLI
Sbjct  66   ERALTKFGHAKLAARSPPPRIHGPGEKNLQLHFKTSMPPHLFTGGKVEGDQGAAIHVVLI  125

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D N+G VV TGPES  KL+VVVLEGDFN E+DD+WT+E FESH VKEREGKRP+LTGDL 
Sbjct  126  DMNTGDVVQTGPESSAKLNVVVLEGDFNEEEDDNWTKEHFESHEVKEREGKRPILTGDLL  185

Query  643  VTL  651
            VTL
Sbjct  186  VTL  188



>gb|KEH37860.1| calmodulin-binding protein [Medicago truncatula]
Length=593

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  157  QQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSP  336
            Q  + K P LASVIVEALKVDSLQ+LCSSLEP+LR++VSEEVERALAKL  A++  RSSP
Sbjct  25   QSKKPKLPGLASVIVEALKVDSLQRLCSSLEPLLRKIVSEEVERALAKLDHAKLGDRSSP  84

Query  337  KRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKL  516
             RIE P  +N+QLHFR+R+   LFTGGKVEGEQGA IHVVL+D N+G+VV  GPES  KL
Sbjct  85   ARIEAPGEKNLQLHFRTRMPPHLFTGGKVEGEQGAVIHVVLLDPNTGNVVQVGPESVAKL  144

Query  517  DVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQV+L
Sbjct  145  NVVVLEGDFNEEIDDDWTKEHFESHEVKEREGKRPLLTGDLQVSL  189



>ref|XP_002523509.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38848.1| calmodulin binding protein, putative [Ricinus communis]
Length=425

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 149/175 (85%), Gaps = 4/175 (2%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAK  300
            ++S+E ++   P+ K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR+VSEEVERAL +
Sbjct  15   EQSVEDEDNHLPDPKKAKMPALASVIVEALKVDSLQRLCSSLEPLFRRIVSEEVERALTR  74

Query  301  LGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            +G A++AA S PK I+GP+G+N+QLHFR+R+   LFTGGKVEGEQGAAIHVVLID+++G 
Sbjct  75   MGHAQLAAMSPPK-IQGPEGKNLQLHFRTRMPPHLFTGGKVEGEQGAAIHVVLIDASTGS  133

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQV  645
            VV TGPES  KL++VVLEGDFN E ++DWT E FESH VKEREGKRPLLTGDLQV
Sbjct  134  VVQTGPESGAKLNIVVLEGDFNEEAEEDWTLEHFESHEVKEREGKRPLLTGDLQV  188



>gb|KJB27327.1| hypothetical protein B456_004G291200 [Gossypium raimondii]
Length=610

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG      D     E K+P   ALASVIVEALKVDS+Q+LCSSLEP+LRR+VS
Sbjct  1    MENSRNKRGHEEGIEDATYITETKKPKLPALASVIVEALKVDSMQRLCSSLEPMLRRIVS  60

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERAL ++G A + AR+SP RI+  DGRN+QLHFR+R+   LFTGGKVEGEQGAAIHV
Sbjct  61   EEVERALTRIGNATLTARNSPPRIQSADGRNLQLHFRTRMPPHLFTGGKVEGEQGAAIHV  120

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D  SG VV TGPES +KL+VVVLEGDFN E D+DWT+E+FES+ VKEREGKRPLLTG
Sbjct  121  VLLDMISGTVVQTGPESALKLNVVVLEGDFNEEADEDWTKEQFESNEVKEREGKRPLLTG  180

Query  634  DLQVTL  651
            +LQVTL
Sbjct  181  ELQVTL  186



>ref|XP_011017983.1| PREDICTED: uncharacterized protein LOC105121148 [Populus euphratica]
Length=610

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 151/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  118  SMRGKR--------SLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRR  264
            S RG+R         ++ + +  PE K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR
Sbjct  3    SSRGRRVEKRGYEQGVDDEADNLPESKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRR  62

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            +VSEEVERAL +LGPA++A  SSP ++ GP+G N+QLHFR+R+   LFTGGKVEGEQGA 
Sbjct  63   IVSEEVERALTRLGPAKLAGGSSPPKLAGPNGNNLQLHFRTRMPPHLFTGGKVEGEQGAT  122

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+++G V+ TGPES  KL+VVVLEGDFN+E D+ WT E FESH VKEREGKRPL
Sbjct  123  IHVVLLDASTGTVMQTGPESAAKLNVVVLEGDFNDEADEGWTAEHFESHEVKEREGKRPL  182

Query  625  LTGDLQVTL  651
            LTGDLQV+L
Sbjct  183  LTGDLQVSL  191



>ref|XP_003533889.1| PREDICTED: uncharacterized protein LOC100808358 isoform X1 [Glycine 
max]
 gb|KHN03660.1| hypothetical protein glysoja_048463 [Glycine soja]
Length=613

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 5/175 (3%)
 Frame = +1

Query  142  EGDE-----EQQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            EGD+      Q  + K P LASVIVEALKVDS+Q+LCSSLEP+LR++VSEEVERALAKLG
Sbjct  19   EGDDVQHHLTQTKKPKLPVLASVIVEALKVDSMQRLCSSLEPLLRKIVSEEVERALAKLG  78

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
             A++A RS P R+EGP  +N+QL FR+R+   LFTGGKVEGEQG+AIHVVL+D N+G +V
Sbjct  79   HAKLAERSPPPRLEGPAAKNLQLQFRTRMPPHLFTGGKVEGEQGSAIHVVLMDPNTGSIV  138

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              GPES  KL+VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQV+L
Sbjct  139  QVGPESVAKLNVVVLEGDFNEEVDDDWTREHFESHEVKEREGKRPLLTGDLQVSL  193



>gb|KHG21283.1| pentafunctional arom polypeptide [Gossypium arboreum]
Length=610

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG      D     E K+P   ALASVIVEALKVDS+Q+LCSSLEP+LRR+VS
Sbjct  1    MENSRNKRGHEEGIEDATYITETKKPKLPALASVIVEALKVDSMQRLCSSLEPMLRRIVS  60

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERAL ++G A + AR+SP RI   DGRN+QLHFR+R+   LFTGGKVEGEQGAAIHV
Sbjct  61   EEVERALTRIGNATLTARNSPPRIRSADGRNLQLHFRTRMPPHLFTGGKVEGEQGAAIHV  120

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D  SG VV TGPES +KL+VVVLEGDFN E D+DWT+E+FES+ VKEREGKRPLLTG
Sbjct  121  VLLDLISGTVVQTGPESTLKLNVVVLEGDFNEEADEDWTKEQFESYEVKEREGKRPLLTG  180

Query  634  DLQVTL  651
            +LQVTL
Sbjct  181  ELQVTL  186



>ref|XP_004488927.1| PREDICTED: uncharacterized protein LOC101515712 isoform X1 [Cicer 
arietinum]
 ref|XP_004488928.1| PREDICTED: uncharacterized protein LOC101515712 isoform X2 [Cicer 
arietinum]
Length=609

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  157  QQPERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSP  336
            Q  + K P LASVIVEALKVDSLQ+LCSSLEP+LR++VSEEVERALAKL  A++A RSSP
Sbjct  29   QSKKPKLPGLASVIVEALKVDSLQRLCSSLEPLLRKIVSEEVERALAKLDHAKLAERSSP  88

Query  337  KRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKL  516
             RIE    +NMQLHFR+R+   LFTGGKVEGEQGAAIHV+L+D N+G+VV  GPES  KL
Sbjct  89   PRIEAAGEKNMQLHFRTRMPPHLFTGGKVEGEQGAAIHVILLDPNTGNVVQVGPESVAKL  148

Query  517  DVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +VVVLEGDFN E D+DWT++ FESH VKEREGKRPLLTGDLQV+L
Sbjct  149  NVVVLEGDFNEEADEDWTKDHFESHEVKEREGKRPLLTGDLQVSL  193



>ref|NP_001291237.1| uncharacterized LOC105121148 [Populus euphratica]
 gb|AEL95441.1| calmodulin-binding protein [Populus euphratica]
Length=610

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 11/188 (6%)
 Frame = +1

Query  118  SMRGKR--------SLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRR  264
            S RG+R         ++ + +  PE K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR
Sbjct  3    SSRGRRVEKRGYEQGVDDEADNLPESKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRR  62

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            +VSEEVERAL +LGPA++A  SSP ++ GP+G N+QLHFR+R+   LFTGGKVEGEQGA 
Sbjct  63   IVSEEVERALTRLGPAKLAGGSSPPKLAGPNGNNLQLHFRTRMPPHLFTGGKVEGEQGAT  122

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+++G V+ TGPES  KL+VVVLEGDFN+E D+ WT E FESH VKEREGKRPL
Sbjct  123  IHVVLLDASTGTVIQTGPESAAKLNVVVLEGDFNDEADEGWTAEHFESHEVKEREGKRPL  182

Query  625  LTGDLQVT  648
            LTGDLQV+
Sbjct  183  LTGDLQVS  190



>emb|CDY20299.1| BnaC04g36570D [Brassica napus]
Length=591

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D +   E KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VS
Sbjct  1    MESSMNKRGYECSQEDADNLAESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL+KLG +++ +RS  PKRI+G DGRN+QLHF++R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSKLGNSKLTSRSPEPKRIQGRDGRNLQLHFKTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV L
Sbjct  181  GDTQVVL  187



>ref|XP_002324557.1| calmodulin-binding protein 60-D [Populus trichocarpa]
 gb|EEF03122.1| calmodulin-binding protein 60-D [Populus trichocarpa]
Length=592

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 151/189 (80%), Gaps = 11/189 (6%)
 Frame = +1

Query  118  SMRGKR--------SLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRR  264
            S RG+R         ++ + +  PE K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR
Sbjct  3    SSRGRRVEKRGYEQGVDDEADNLPESKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRR  62

Query  265  VVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAA  444
            +VSEEVERAL +LGPA++A  SSP ++ GP+G ++QLHFR+R+   LFTGGKVEGEQGA 
Sbjct  63   IVSEEVERALTRLGPAKLAGGSSPPKLPGPNGNDLQLHFRTRMPPHLFTGGKVEGEQGAT  122

Query  445  IHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPL  624
            IHVVL+D+++G V+ TGPES  KL+VVVLEGDFN+E D+ WT E FESH VKEREGKRPL
Sbjct  123  IHVVLLDASTGTVMQTGPESAAKLNVVVLEGDFNDEADEGWTAEHFESHEVKEREGKRPL  182

Query  625  LTGDLQVTL  651
            LTGDLQV+L
Sbjct  183  LTGDLQVSL  191



>ref|XP_003546611.1| PREDICTED: uncharacterized protein LOC100775528 [Glycine max]
 gb|KHN15215.1| hypothetical protein glysoja_046742 [Glycine soja]
Length=613

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 5/175 (3%)
 Frame = +1

Query  142  EGDEEQQ-----PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            EGD+ Q       + K P LASVIVEALKVDS+Q+LCSSLEP+LR++VSEEVERALAKLG
Sbjct  19   EGDDAQHHLTQSKKPKLPGLASVIVEALKVDSMQRLCSSLEPLLRKIVSEEVERALAKLG  78

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
             A++  RS P R+EGP  +N+QL FR+R+   LFTGGKVEGEQG+AIHV+L+D N+G VV
Sbjct  79   HAKLTERSPPPRLEGPAAKNLQLQFRTRMPPHLFTGGKVEGEQGSAIHVMLMDPNTGSVV  138

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              GPES  KL+VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQV+L
Sbjct  139  QVGPESVAKLNVVVLEGDFNEEVDDDWTKEHFESHEVKEREGKRPLLTGDLQVSL  193



>ref|XP_009140532.1| PREDICTED: uncharacterized protein LOC103864534 isoform X1 [Brassica 
rapa]
Length=601

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D +   E KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VS
Sbjct  1    MESSMNKRGYECSQEDADNLAESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL+KLG +++ +RS  PKRI+G DGRN+QLHF++R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSKLGNSKLTSRSPEPKRIQGRDGRNLQLHFKTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV L
Sbjct  181  GDTQVVL  187



>ref|XP_003633161.1| PREDICTED: uncharacterized protein LOC100255894 [Vitis vinifera]
Length=618

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG      D++  P  K+P   ALASVIVEALKVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  12   RGYEQSVEDQDDLPGSKKPKLPALASVIVEALKVDSLQRLCSSLEPLFRRIVSEEVERAL  71

Query  295  AKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
             +LG A++  RSSP RI+ P G+N+QLHF++R+   LFTGGKVEGEQGA+I VVL+D ++
Sbjct  72   TRLGHAKLVGRSSPPRIQAPGGKNLQLHFKTRMPPHLFTGGKVEGEQGASILVVLLDVDT  131

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              VV TGPES  KL+VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQVTL
Sbjct  132  SSVVQTGPESAAKLNVVVLEGDFNEESDDDWTKEHFESHEVKEREGKRPLLTGDLQVTL  190



>ref|XP_010472432.1| PREDICTED: uncharacterized protein LOC104752066 [Camelina sativa]
 ref|XP_010472433.1| PREDICTED: uncharacterized protein LOC104752066 [Camelina sativa]
 ref|XP_010472434.1| PREDICTED: uncharacterized protein LOC104752066 [Camelina sativa]
Length=603

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG  S + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ R++VS
Sbjct  1    MEGSMNKRGYESSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRKIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL++LG  ++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSRLGNTKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD Q+ L
Sbjct  181  GDTQLML  187



>ref|XP_002878744.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55003.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=599

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  4    RGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVSEEVERAL  63

Query  295  AKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            ++LG A++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+G+AIHVVLID+N
Sbjct  64   SRLGNAKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIHVVLIDAN  123

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LTGD Q+ L
Sbjct  124  TGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILTGDTQIVL  183



>gb|KFK32663.1| hypothetical protein AALP_AA6G272300 [Arabis alpina]
Length=597

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D +  PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ R++VS
Sbjct  1    MESSMNKRGYECSQEDTDNLPESKRQKPPALASVIVEAVKVDSLQRLCSSLEPLFRKIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL++LG A++ +RS  PKRI+G DGRN+QLHFR+R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSRLGNAKLTSRSLEPKRIQGRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+ED++DW +E FE+  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDNEDWMREHFENFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV L
Sbjct  181  GDTQVIL  187



>ref|XP_009398637.1| PREDICTED: uncharacterized protein LOC103983172 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398638.1| PREDICTED: uncharacterized protein LOC103983172 [Musa acuminata 
subsp. malaccensis]
Length=574

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 149/183 (81%), Gaps = 7/183 (4%)
 Frame = +1

Query  124  RGKRSLEGD----EEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEV  282
            R KR L  D    ++  PE KR   PALA VI+EAL++D LQ++CSSLEPI+R VVSEEV
Sbjct  3    RDKRGLGSDTSEKDDLHPENKRLKVPALARVIIEALQMDGLQRICSSLEPIIRIVVSEEV  62

Query  283  ERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLI  462
            ERALAKLG  R   R  PK+IEGPDGRN+QLHF +RLSLP+ TGG++EGE GA IH+VL+
Sbjct  63   ERALAKLGAVRNGERCLPKQIEGPDGRNLQLHFTTRLSLPIITGGEIEGEDGAIIHIVLV  122

Query  463  DSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQ  642
            D+N+G VV +GPE+  KLDV+VL+GDFN ED+D+WT++EF+ H+VKER+GKRPLLTGDLQ
Sbjct  123  DANTGCVVNSGPEASAKLDVLVLDGDFNFEDNDNWTEDEFKRHIVKERKGKRPLLTGDLQ  182

Query  643  VTL  651
            V+L
Sbjct  183  VSL  185



>ref|XP_001761878.1| predicted protein [Physcomitrella patens]
 gb|EDQ73319.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKRP--ALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  297
            R KR  +G ++  PE KRP   LASVIVEA+K+D +QKLCS+LEP+LR++V EEVERAL 
Sbjct  3    REKRERDGSKDGMPEEKRPRPQLASVIVEAVKMDCMQKLCSTLEPLLRKMVGEEVERALT  62

Query  298  KLGPARIAA-RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNS  474
            K  P ++   RSSP++I+GPD +N++L FR++L+LPLFTG KVEGEQG+AIHVVL ++N+
Sbjct  63   KFAPPKVGGIRSSPRKIQGPDQQNLRLQFRNKLALPLFTGSKVEGEQGSAIHVVLQNTNT  122

Query  475  GHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            GHVVT+GPE+  KLD+VVLEGDF  +D+++WTQEEFE+++V+ER+GKRPLLTG+L VTL
Sbjct  123  GHVVTSGPEASAKLDIVVLEGDFTADDEENWTQEEFENYMVRERDGKRPLLTGELSVTL  181



>ref|XP_010429400.1| PREDICTED: uncharacterized protein LOC104713879 isoform X1 [Camelina 
sativa]
 ref|XP_010429401.1| PREDICTED: uncharacterized protein LOC104713879 isoform X1 [Camelina 
sativa]
 ref|XP_010429403.1| PREDICTED: uncharacterized protein LOC104713879 isoform X1 [Camelina 
sativa]
 ref|XP_010429404.1| PREDICTED: uncharacterized protein LOC104713879 isoform X1 [Camelina 
sativa]
 ref|XP_010429405.1| PREDICTED: uncharacterized protein LOC104713879 isoform X1 [Camelina 
sativa]
Length=602

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ R++VS
Sbjct  1    MEGSMNKRGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRKIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL++LG  ++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSRLGNTKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV L
Sbjct  181  GDTQVLL  187



>ref|XP_007138149.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
 gb|ESW10143.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
Length=614

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +1

Query  142  EGDEEQQ-----PERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLG  306
            EGD+ Q       + K P LASVIVEALKVDSLQ+LCSSLEP+LR++VSEEVERAL KL 
Sbjct  19   EGDDAQHHLTQSKKPKLPGLASVIVEALKVDSLQRLCSSLEPLLRKIVSEEVERALTKLD  78

Query  307  PARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVV  486
              ++A RS P R+EGP  +N+QLHFR+R+   LFTGGKVEGEQG+AIHVVL D N+G VV
Sbjct  79   YDKLAERSLPPRLEGPVAKNLQLHFRTRMPPHLFTGGKVEGEQGSAIHVVLTDPNTGSVV  138

Query  487  TTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              GPES  KL+VVVLEGDFN E DDDWT+E FESH VKEREGKRPLLTGDLQV+L
Sbjct  139  HVGPESVAKLNVVVLEGDFNEEVDDDWTKEHFESHEVKEREGKRPLLTGDLQVSL  193



>ref|XP_010265460.1| PREDICTED: uncharacterized protein LOC104603183 isoform X4 [Nelumbo 
nucifera]
Length=592

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = +1

Query  223  LQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLP  402
            L  L  SL P +   VSEEVERALAKLGPAR+  RSSPK+IEGPDGRN+QLHFRSRLSLP
Sbjct  3    LASLFVSLWPHIS--VSEEVERALAKLGPARLNGRSSPKQIEGPDGRNLQLHFRSRLSLP  60

Query  403  LFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEF  582
            LFTGGKVEGEQG A+HVVL+D+N+GHVVTTGPE+ +KLDVVVLEGDFNNEDDD WTQE+F
Sbjct  61   LFTGGKVEGEQGTAVHVVLLDANTGHVVTTGPEASVKLDVVVLEGDFNNEDDDGWTQEDF  120

Query  583  ESHVVKEREGKRPLLTGDLQVTL  651
            ESHVVKEREGKRPLLTGDLQVTL
Sbjct  121  ESHVVKEREGKRPLLTGDLQVTL  143



>ref|XP_007203768.1| hypothetical protein PRUPE_ppa002988mg [Prunus persica]
 gb|EMJ04967.1| hypothetical protein PRUPE_ppa002988mg [Prunus persica]
Length=614

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 150/195 (77%), Gaps = 12/195 (6%)
 Frame = +1

Query  103  MERTNSMR-GKRSLE--------GDEEQQPERKR---PALASVIVEALKVDSLQKLCSSL  246
            ME + SMR  KR  E         +E   PE K+   PALASVIVE+LKVDSLQ+LCSSL
Sbjct  1    MESSGSMRVEKRGYEEGVELDDDAEEGHSPEPKKQRLPALASVIVESLKVDSLQRLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            EP+LRR+VSEEVERAL KL  A +A RS P RI+GP+GR +QL F++R+   LFTG KVE
Sbjct  61   EPLLRRIVSEEVERALTKLDHAELAGRSPPPRIQGPEGRTLQLQFKTRMPPHLFTGAKVE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D ++G V+ TGPES  KL+VVVLEGDFN E DD WT+E FE+H VKER
Sbjct  121  GEQGAAIHVVLLDHSTGTVLQTGPESAAKLNVVVLEGDFNEEADDIWTKEHFENHEVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            EGKRPLLTGDLQ+TL
Sbjct  181  EGKRPLLTGDLQITL  195



>ref|XP_009140533.1| PREDICTED: uncharacterized protein LOC103864534 isoform X2 [Brassica 
rapa]
 ref|XP_009140534.1| PREDICTED: uncharacterized protein LOC103864534 isoform X2 [Brassica 
rapa]
Length=597

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG    + D +   E KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  4    RGYECSQEDADNLAESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVSEEVERAL  63

Query  295  AKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            +KLG +++ +RS  PKRI+G DGRN+QLHF++R+   LFTGGKVEGE+G+AIHVVLID+N
Sbjct  64   SKLGNSKLTSRSPEPKRIQGRDGRNLQLHFKTRMPPHLFTGGKVEGERGSAIHVVLIDAN  123

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LTGD QV L
Sbjct  124  TGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILTGDTQVVL  183



>ref|NP_973527.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC07559.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=599

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  4    RGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVSEEVERAL  63

Query  295  AKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            ++LG A++ +RS  PKRI+  +GRN+QLHFR+R+   LFTGGKVEGE+G+AIHVVLID+N
Sbjct  64   SRLGNAKLTSRSPEPKRIQDRNGRNLQLHFRTRMPPHLFTGGKVEGERGSAIHVVLIDAN  123

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LTGD Q+ L
Sbjct  124  TGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILTGDTQIVL  183



>emb|CDY46137.1| BnaA04g14250D [Brassica napus]
Length=601

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 4/187 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG    + D +   E KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VS
Sbjct  1    MESSMNKRGYECSQEDADNLAESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVS  60

Query  274  EEVERALAKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIH  450
            EEVERAL+KLG +++ +RS  PKRI+G DGRN+QL F++R+   LFTGGKVEGE+G+AIH
Sbjct  61   EEVERALSKLGNSKLTSRSPEPKRIQGRDGRNLQLQFKTRMPPHLFTGGKVEGERGSAIH  120

Query  451  VVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLT  630
            VVLID+N+G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LT
Sbjct  121  VVLIDANTGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILT  180

Query  631  GDLQVTL  651
            GD QV L
Sbjct  181  GDTQVVL  187



>ref|XP_007011981.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
 gb|EOY29600.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
Length=596

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = +1

Query  103  MERTNSMRGKRSLEGDEEQQPERKRP---ALASVIVEALKVDSLQKLCSSLEPILRRVVS  273
            ME + + RG     GD +   E K+P   ALASVIVEALKVDS+Q+LCSSLEP+LRR+VS
Sbjct  1    MESSRNKRGYEEGVGDADYLAEPKKPKLPALASVIVEALKVDSMQRLCSSLEPMLRRIVS  60

Query  274  EEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHV  453
            EEVERAL ++G A++  RSSP R++  DGRN+QL FR+R+   LFTGGKVEGEQGAAIHV
Sbjct  61   EEVERALTRIGNAKLTGRSSPPRLQSADGRNLQLQFRTRMPPHLFTGGKVEGEQGAAIHV  120

Query  454  VLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTG  633
            VL+D  +G VV TGPES  KL+VVVLEGDFN E D+DW++E FE++ VKER+GKRPLLTG
Sbjct  121  VLLDVITGTVVQTGPESAAKLNVVVLEGDFNEEADEDWSKEHFENYEVKERDGKRPLLTG  180

Query  634  DLQVTL  651
            +LQVTL
Sbjct  181  ELQVTL  186



>ref|XP_008796874.1| PREDICTED: uncharacterized protein LOC103712187 isoform X2 [Phoenix 
dactylifera]
Length=584

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +1

Query  172  KRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEG  351
            K PAL  VIVEALK+D LQ+LCS+LEP+LRR+VSEEVERAL KL  A++  RSSP+RI+G
Sbjct  38   KVPALTGVIVEALKMDGLQRLCSTLEPLLRRIVSEEVERALTKLSCAKLTGRSSPQRIDG  97

Query  352  PDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVL  531
            P GR +QLHFRSR+   LFTGGKVEGE+GAAIHVVL+D+N+G +V +GPES  KL+VVVL
Sbjct  98   PGGRKLQLHFRSRMPPHLFTGGKVEGERGAAIHVVLLDANTGMIV-SGPESMAKLNVVVL  156

Query  532  EGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            EGDFN+E DDDW+QE FES+ VKEREGKRPLLTGDLQVTL
Sbjct  157  EGDFNDEADDDWSQEHFESYEVKEREGKRPLLTGDLQVTL  196



>ref|XP_002964136.1| hypothetical protein SELMODRAFT_166784 [Selaginella moellendorffii]
 gb|EFJ34469.1| hypothetical protein SELMODRAFT_166784 [Selaginella moellendorffii]
Length=601

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = +1

Query  124  RGKRSLEGDEEQQP--ERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  297
            R KR L+   +  P  +R+RPALASVIVEALK+DSLQKLCS+LEP+LRRVV EEVERALA
Sbjct  3    REKRPLDSARDGLPNEKRQRPALASVIVEALKMDSLQKLCSTLEPLLRRVVGEEVERALA  62

Query  298  KLGPAR---IAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDS  468
            KL P+    +  +SSPKRI+G D R ++L FR++L+LPLFTG KVEGEQG+AIHVVL D+
Sbjct  63   KLAPSMKGGLTYKSSPKRIQGADTRALRLQFRNKLALPLFTGSKVEGEQGSAIHVVLQDA  122

Query  469  NSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVT  648
            N+G VVTTG E+  KLD+VVLEGDF+ +D++DW+ E+F+++VV+EREGKRPLLTGDL VT
Sbjct  123  NTGQVVTTGAEAGAKLDIVVLEGDFSADDEEDWSMEDFDTYVVREREGKRPLLTGDLSVT  182

Query  649  L  651
            L
Sbjct  183  L  183



>ref|XP_002993171.1| hypothetical protein SELMODRAFT_187271 [Selaginella moellendorffii]
 gb|EFJ05811.1| hypothetical protein SELMODRAFT_187271 [Selaginella moellendorffii]
Length=599

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = +1

Query  124  RGKRSLEGDEEQQP--ERKRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALA  297
            R KR L+   +  P  +R+RPALASVIVEALK+DSLQKLCS+LEP+LRRVV EEVERALA
Sbjct  3    REKRPLDSARDGLPNEKRQRPALASVIVEALKMDSLQKLCSTLEPLLRRVVGEEVERALA  62

Query  298  KLGPAR---IAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDS  468
            KL P+    +  +SSPKRI+G D R ++L FR++L+LPLFTG KVEGEQG+AIHVVL D+
Sbjct  63   KLAPSMKGGLTYKSSPKRIQGADTRALRLQFRNKLALPLFTGSKVEGEQGSAIHVVLQDA  122

Query  469  NSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVT  648
            N+G VVTTG E+  KLD+VVLEGDF+ +D++DW+ E+F+++VV+EREGKRPLLTGDL VT
Sbjct  123  NTGQVVTTGAEAGAKLDIVVLEGDFSADDEEDWSMEDFDTYVVREREGKRPLLTGDLSVT  182

Query  649  L  651
            L
Sbjct  183  L  183



>gb|KDO75734.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75735.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=588

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA++  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  20   VSEEVERALAKLGPAKLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  79

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  80   HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  139

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  140  SGDLQVTL  147



>ref|XP_010429406.1| PREDICTED: uncharacterized protein LOC104713879 isoform X2 [Camelina 
sativa]
Length=598

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ R++VSEEVERAL
Sbjct  4    RGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRKIVSEEVERAL  63

Query  295  AKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            ++LG  ++ +RS  PKRI+  DGRN+QLHFR+R+   LFTGGKVEGE+G+AIHVVLID+N
Sbjct  64   SRLGNTKLTSRSPEPKRIQDRDGRNLQLHFRTRMPPHLFTGGKVEGERGSAIHVVLIDAN  123

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G+VV TG ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LTGD QV L
Sbjct  124  TGNVVQTGEESASKLNVVVLEGDFNDEDDEDWTREHFESFEVKEREGKRPILTGDTQVLL  183



>gb|KDP38647.1| hypothetical protein JCGZ_04000 [Jatropha curcas]
Length=610

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = +1

Query  130  KRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAK  300
            ++S+E + +  P+ K+   PALASVIVEALKVDSLQ+LCSSLEP+ RR+VSEEVERAL +
Sbjct  15   EQSVEDESDHLPDPKKAKLPALASVIVEALKVDSLQRLCSSLEPLFRRIVSEEVERALTR  74

Query  301  LGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGH  480
            LG A++A RS PK I+GP+G+ +QLHFR+R+   LFTGGKV+GEQGAAIHVVL+D+++G 
Sbjct  75   LGHAKLATRSPPK-IQGPEGKRLQLHFRTRMPPHLFTGGKVDGEQGAAIHVVLLDASTGC  133

Query  481  VVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            VV  G ES  KL+VVVLEGDFN E D+DWT E FESH VKEREGKRPLLTG+LQVTL
Sbjct  134  VVQAGQESAAKLNVVVLEGDFNEEADEDWTLEHFESHEVKEREGKRPLLTGELQVTL  190



>gb|EMS66803.1| hypothetical protein TRIUR3_04882 [Triticum urartu]
Length=591

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +1

Query  193  VIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQ  372
            VIVEALKVDSLQ+LCSSLEPILRRVVSEEVERAL KLGPA I  RSSPKRIEGP GRN+Q
Sbjct  8    VIVEALKVDSLQRLCSSLEPILRRVVSEEVERALGKLGPAAITGRSSPKRIEGPGGRNLQ  67

Query  373  LHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNE  552
            L FR+RLSLPLFTGGKVEGEQGAAIHVVL+D+ +G VV++G ES  KLD+VVLEGDFNNE
Sbjct  68   LQFRTRLSLPLFTGGKVEGEQGAAIHVVLLDTGNGCVVSSGLESSAKLDIVVLEGDFNNE  127

Query  553  DDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            D++ WT+EEF+SH+VKEREGKRP++TGD+QVTL
Sbjct  128  DEEGWTEEEFDSHIVKEREGKRPIITGDIQVTL  160



>ref|XP_006295420.1| hypothetical protein CARUB_v10024519mg [Capsella rubella]
 gb|EOA28318.1| hypothetical protein CARUB_v10024519mg [Capsella rubella]
Length=632

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 4/180 (2%)
 Frame = +1

Query  124  RGKRSLEGDEEQQPERKR---PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERAL  294
            RG    + D ++ PE KR   PALASVIVEA+KVDSLQ+LCSSLEP+ RR+VSEEVERAL
Sbjct  37   RGYECSQEDTDKLPESKRQKVPALASVIVEAVKVDSLQRLCSSLEPLFRRIVSEEVERAL  96

Query  295  AKLGPARIAARS-SPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSN  471
            ++LG A++ +RS  PKRI+  +GRN+QLHFR+R+   LFTGGKVEGE+G+AIHVVLID+N
Sbjct  97   SRLGNAKLTSRSPEPKRIQDRNGRNLQLHFRTRMPPHLFTGGKVEGERGSAIHVVLIDAN  156

Query  472  SGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            +G+VV  G ES  KL+VVVLEGDFN+EDD+DWT+E FES  VKEREGKRP+LTGD QV L
Sbjct  157  TGNVVQIGEESASKLNVVVLEGDFNDEDDEDWTKEHFESFEVKEREGKRPILTGDTQVML  216



>ref|XP_008242948.1| PREDICTED: uncharacterized protein LOC103341237 [Prunus mume]
Length=614

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 153/195 (78%), Gaps = 12/195 (6%)
 Frame = +1

Query  103  MERTNSMRGKR-------SLEGDEEQ----QPERKR-PALASVIVEALKVDSLQKLCSSL  246
            ME + SMR ++        L+ D E+    +P+++R PALASVIVE+LKVDSLQ+LCSSL
Sbjct  1    MESSGSMRVEKRGYEEGVELDDDAEEGHPPEPKKQRLPALASVIVESLKVDSLQRLCSSL  60

Query  247  EPILRRVVSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVE  426
            EP+LRR+VSEEVERAL KL  A +A RS P RI+GP+GR +QL F++R+   LFTG KVE
Sbjct  61   EPLLRRIVSEEVERALTKLDHAELAGRSPPPRIQGPEGRTLQLQFKTRMPPHLFTGAKVE  120

Query  427  GEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKER  606
            GEQGAAIHVVL+D ++  V+ TGPES  KL+VVVLEGDFN E DD WT+E FE+H VKER
Sbjct  121  GEQGAAIHVVLLDHSTSTVLQTGPESAAKLNVVVLEGDFNEEADDIWTKEHFENHEVKER  180

Query  607  EGKRPLLTGDLQVTL  651
            EGKRPLLTGDLQ+TL
Sbjct  181  EGKRPLLTGDLQITL  195



>ref|XP_006449221.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62461.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=588

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  268  VSEEVERALAKLGPARIAARSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAI  447
            VSEEVERALAKLGPA +  RSSPKRIEGPDGRN+QLHFR+RLSLPLFTGGKVEGEQG AI
Sbjct  20   VSEEVERALAKLGPAMLTGRSSPKRIEGPDGRNLQLHFRTRLSLPLFTGGKVEGEQGTAI  79

Query  448  HVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLL  627
            H+VLID+N+GHVVTTGPES +KLDVVVLEGDFNNEDDD+WTQEEF SHVVKEREGKRPLL
Sbjct  80   HIVLIDANTGHVVTTGPESLVKLDVVVLEGDFNNEDDDNWTQEEFVSHVVKEREGKRPLL  139

Query  628  TGDLQVTL  651
            +GDLQVTL
Sbjct  140  SGDLQVTL  147



>ref|XP_009358482.1| PREDICTED: uncharacterized protein LOC103949109 [Pyrus x bretschneideri]
Length=608

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 1/169 (1%)
 Frame = +1

Query  148  DEEQQPERKR-PALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARIAA  324
            D   +P+++R PALASVIVE+LKVDSLQ+LCSSLEP+LRR+VSEEVERAL KL  A +A 
Sbjct  22   DHPPEPKKQRLPALASVIVESLKVDSLQRLCSSLEPLLRRIVSEEVERALTKLDHAELAG  81

Query  325  RSSPKRIEGPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPES  504
            RS P RI+GP+G+ +QL F++R+   LFTG KVEGEQGAAIHVVL+D ++G V+ TGPES
Sbjct  82   RSQPPRIQGPEGKTLQLQFKTRMPPHLFTGAKVEGEQGAAIHVVLVDLSTGSVMQTGPES  141

Query  505  CMKLDVVVLEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
              KL+VVVLEGDFN E +D+WT+E FE+H VKEREGKRPLLTGDLQV L
Sbjct  142  AAKLNVVVLEGDFNGEAEDNWTKEHFENHEVKEREGKRPLLTGDLQVVL  190



>ref|XP_008796866.1| PREDICTED: uncharacterized protein LOC103712187 isoform X1 [Phoenix 
dactylifera]
Length=585

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query  172  KRPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVERALAKLGPARI-AARSSPKRIE  348
            K PAL  VIVEALK+D LQ+LCS+LEP+LRR+VSEEVERAL KL  A++  +RSSP+RI+
Sbjct  38   KVPALTGVIVEALKMDGLQRLCSTLEPLLRRIVSEEVERALTKLSCAKLTGSRSSPQRID  97

Query  349  GPDGRNMQLHFRSRLSLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVV  528
            GP GR +QLHFRSR+   LFTGGKVEGE+GAAIHVVL+D+N+G +V+ GPES  KL+VVV
Sbjct  98   GPGGRKLQLHFRSRMPPHLFTGGKVEGERGAAIHVVLLDANTGMIVS-GPESMAKLNVVV  156

Query  529  LEGDFNNEDDDDWTQEEFESHVVKEREGKRPLLTGDLQVTL  651
            LEGDFN+E DDDW+QE FES+ VKEREGKRPLLTGDLQVTL
Sbjct  157  LEGDFNDEADDDWSQEHFESYEVKEREGKRPLLTGDLQVTL  197



>ref|XP_010265459.1| PREDICTED: uncharacterized protein LOC104603183 isoform X3 [Nelumbo 
nucifera]
Length=595

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 5/146 (3%)
 Frame = +1

Query  223  LQKLCSSLEPILRRVVSEEVERALAKLGPARIAAR---SSPKRIEGPDGRNMQLHFRSRL  393
            L  L  SL P +   VSEEVERALAKLGPAR+  R   SSPK+IEGPDGRN+QLHFRSRL
Sbjct  3    LASLFVSLWPHIS--VSEEVERALAKLGPARLNGRKCRSSPKQIEGPDGRNLQLHFRSRL  60

Query  394  SLPLFTGGKVEGEQGAAIHVVLIDSNSGHVVTTGPESCMKLDVVVLEGDFNNEDDDDWTQ  573
            SLPLFTGGKVEGEQG A+HVVL+D+N+GHVVTTGPE+ +KLDVVVLEGDFNNEDDD WTQ
Sbjct  61   SLPLFTGGKVEGEQGTAVHVVLLDANTGHVVTTGPEASVKLDVVVLEGDFNNEDDDGWTQ  120

Query  574  EEFESHVVKEREGKRPLLTGDLQVTL  651
            E+FESHVVKEREGKRPLLTGDLQVTL
Sbjct  121  EDFESHVVKEREGKRPLLTGDLQVTL  146



Lambda      K        H        a         alpha
   0.315    0.132    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250