BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022F23

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600020.1|  PREDICTED: solanesyl diphosphate synthase 3,...    118   2e-27   Nicotiana tomentosiformis
gb|AHL84161.1|  geranyl pyrophosphate synthase                          118   2e-27   Nicotiana tabacum [American tobacco]
ref|XP_009793550.1|  PREDICTED: solanesyl diphosphate synthase 3,...    112   2e-25   Nicotiana sylvestris
ref|XP_006364882.1|  PREDICTED: solanesyl diphosphate synthase 3,...  99.0    1e-20   Solanum tuberosum [potatoes]
ref|NP_001234089.1|  geranyl pyrophosphate synthase                   97.8    3e-20   Solanum lycopersicum
ref|XP_010324777.1|  PREDICTED: geranyl pyrophosphate synthase is...  97.8    4e-20   
ref|XP_009600023.1|  PREDICTED: solanesyl diphosphate synthase 3,...  90.5    7e-18   Nicotiana tomentosiformis
gb|AEZ55677.1|  geranyl diphosphate synthase                          90.5    1e-17   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011096618.1|  PREDICTED: solanesyl diphosphate synthase 3,...  90.1    2e-17   Sesamum indicum [beniseed]
gb|ACC77966.1|  geranyl pyrophosphate synthase                        87.8    1e-16   Catharanthus roseus [chatas]
ref|XP_009793552.1|  PREDICTED: solanesyl diphosphate synthase 3,...  84.7    8e-16   Nicotiana sylvestris
gb|AGL91647.1|  geranyl diphosphate synthase                          83.2    5e-15   Catharanthus roseus [chatas]
ref|XP_002268229.2|  PREDICTED: solanesyl diphosphate synthase 3,...  79.7    8e-14   Vitis vinifera
gb|AEM42978.1|  geranyl diphosphate synthase                          77.8    4e-13   Siraitia grosvenorii [arhat fruit]
ref|XP_004134571.1|  PREDICTED: solanesyl diphosphate synthase 3,...  75.5    2e-12   
ref|XP_008439594.1|  PREDICTED: solanesyl diphosphate synthase 3,...  75.1    2e-12   Cucumis melo [Oriental melon]
ref|XP_009793551.1|  PREDICTED: solanesyl diphosphate synthase 3,...  74.7    3e-12   Nicotiana sylvestris
ref|XP_009600021.1|  PREDICTED: solanesyl diphosphate synthase 3,...  74.7    3e-12   Nicotiana tomentosiformis
emb|CDP04262.1|  unnamed protein product                              74.7    4e-12   Coffea canephora [robusta coffee]
gb|EYU29662.1|  hypothetical protein MIMGU_mgv1a007049mg              73.2    1e-11   Erythranthe guttata [common monkey flower]
gb|AIG15448.1|  geranyl diphosphate synthase 2                        72.4    2e-11   Azadirachta indica [Indian-lilac]
emb|CAC20852.1|  geranyl diphosphat synthase                          69.7    2e-10   Quercus robur [English oak]
gb|EPS58436.1|  geranyl pyrophosphate synthase                        69.3    2e-10   Genlisea aurea
ref|XP_006468068.1|  PREDICTED: solanesyl diphosphate synthase 3,...  67.8    7e-10   Citrus sinensis [apfelsine]
ref|XP_006448989.1|  hypothetical protein CICLE_v10015336mg           67.8    7e-10   Citrus clementina [clementine]
gb|AFJ52721.1|  geranyl diphosphate synthase                          67.4    1e-09   Mangifera indica
ref|XP_004509097.1|  PREDICTED: solanesyl diphosphate synthase 3,...  67.4    1e-09   Cicer arietinum [garbanzo]
ref|XP_007024979.1|  Geranyl diphosphate synthase 1 isoform 1         65.1    6e-09   
ref|XP_002530137.1|  geranylgeranyl pyrophosphate synthase, putative  65.1    7e-09   Ricinus communis
gb|KDP37498.1|  hypothetical protein JCGZ_05937                       64.7    8e-09   Jatropha curcas
ref|XP_007211736.1|  hypothetical protein PRUPE_ppa006211mg           63.2    3e-08   Prunus persica
ref|XP_011009597.1|  PREDICTED: solanesyl diphosphate synthase 3,...  62.8    4e-08   Populus euphratica
ref|XP_008225576.1|  PREDICTED: solanesyl diphosphate synthase 3,...  62.4    5e-08   
gb|KDO75395.1|  hypothetical protein CISIN_1g014276mg                 61.6    7e-08   Citrus sinensis [apfelsine]
ref|XP_003550028.1|  PREDICTED: solanesyl diphosphate synthase 3,...  62.0    7e-08   Glycine max [soybeans]
ref|XP_006448991.1|  hypothetical protein CICLE_v10015336mg           62.0    7e-08   Citrus clementina [clementine]
gb|KDO75389.1|  hypothetical protein CISIN_1g014276mg                 61.6    8e-08   Citrus sinensis [apfelsine]
ref|XP_006468066.1|  PREDICTED: solanesyl diphosphate synthase 3,...  61.6    9e-08   Citrus sinensis [apfelsine]
ref|XP_007024981.1|  Geranyl diphosphate synthase 1 isoform 3         61.2    1e-07   
gb|KHN21417.1|  Solanesyl diphosphate synthase 3, chloroplastic/m...  61.2    1e-07   Glycine soja [wild soybean]
gb|AAN86061.1|  geranylgeranyl diphosphate synthase                   60.8    2e-07   Citrus unshiu [satsuma mandarin]
dbj|BAF98298.1|  geranyl-diphosphate synthase                         60.1    2e-07   Hevea brasiliensis [jebe]
dbj|BAF98299.1|  geranyl-diphosphate synthase                         60.1    2e-07   Hevea brasiliensis [jebe]
ref|XP_006448990.1|  hypothetical protein CICLE_v10015336mg           60.1    3e-07   
ref|XP_006468065.1|  PREDICTED: solanesyl diphosphate synthase 3,...  60.1    3e-07   Citrus sinensis [apfelsine]
ref|XP_006579912.1|  PREDICTED: solanesyl diphosphate synthase 3,...  60.1    3e-07   Glycine max [soybeans]
ref|XP_009360937.1|  PREDICTED: solanesyl diphosphate synthase 3,...  59.3    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_006448988.1|  hypothetical protein CICLE_v10015336mg           58.5    8e-07   Citrus clementina [clementine]
ref|XP_006468069.1|  PREDICTED: solanesyl diphosphate synthase 3,...  58.5    9e-07   Citrus sinensis [apfelsine]
ref|XP_008371630.1|  PREDICTED: solanesyl diphosphate synthase 3,...  58.2    1e-06   
ref|XP_007155874.1|  hypothetical protein PHAVU_003G239100g           57.8    2e-06   Phaseolus vulgaris [French bean]
ref|XP_010056940.1|  PREDICTED: solanesyl diphosphate synthase 3,...  56.2    7e-06   Eucalyptus grandis [rose gum]
gb|KCW73855.1|  hypothetical protein EUGRSUZ_E02451                   56.2    7e-06   Eucalyptus grandis [rose gum]
gb|KEH31511.1|  geranylgeranyl pyrophosphate synthase                 55.8    7e-06   Medicago truncatula
ref|XP_010056939.1|  PREDICTED: solanesyl diphosphate synthase 3,...  55.8    8e-06   
ref|XP_002314919.2|  hypothetical protein POPTR_0010s148602g          54.7    8e-06   
gb|KEH31512.1|  geranylgeranyl pyrophosphate synthase                 55.8    9e-06   Medicago truncatula
ref|XP_002308360.2|  hypothetical protein POPTR_0006s13760g           55.5    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010549511.1|  PREDICTED: solanesyl diphosphate synthase 3,...  55.5    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010090457.1|  Solanesyl diphosphate synthase 3                 55.5    1e-05   
ref|XP_011039903.1|  PREDICTED: solanesyl diphosphate synthase 3,...  55.1    1e-05   Populus euphratica
ref|XP_010275056.1|  PREDICTED: solanesyl-diphosphate synthase 1,...  55.1    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010275057.1|  PREDICTED: solanesyl-diphosphate synthase 1,...  54.7    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010275055.1|  PREDICTED: solanesyl diphosphate synthase 3,...  54.7    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006468064.1|  PREDICTED: solanesyl diphosphate synthase 3,...  53.9    3e-05   Citrus sinensis [apfelsine]
ref|XP_008787643.1|  PREDICTED: solanesyl-diphosphate synthase 1,...  53.1    6e-05   Phoenix dactylifera
ref|XP_004511880.1|  PREDICTED: solanesyl diphosphate synthase 3,...  52.8    8e-05   Cicer arietinum [garbanzo]
gb|KDP38011.1|  hypothetical protein JCGZ_04654                       52.4    1e-04   Jatropha curcas
ref|XP_008371790.1|  PREDICTED: solanesyl diphosphate synthase 3,...  51.6    2e-04   
ref|XP_006468067.1|  PREDICTED: solanesyl diphosphate synthase 3,...  51.2    3e-04   Citrus sinensis [apfelsine]
ref|XP_004293518.1|  PREDICTED: solanesyl diphosphate synthase 3,...  49.7    8e-04   Fragaria vesca subsp. vesca



>ref|XP_009600020.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=415

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 74/100 (74%), Gaps = 11/100 (11%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML +R LS+ISR + NR++WL   P +QQ HH +H         FP+P DAS +VLG R 
Sbjct  1    MLFARGLSQISRRSINRYQWLC--PQQQQFHHSNH---------FPSPIDASHKVLGCRV  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+HHQS+AVAEEQ+DPFSLVADELSL
Sbjct  50   IHSWVSNALSGIGQQIHHQSTAVAEEQVDPFSLVADELSL  89



>gb|AHL84161.1| geranyl pyrophosphate synthase [Nicotiana tabacum]
Length=415

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 74/100 (74%), Gaps = 11/100 (11%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML +R LS+ISR + NR++WL   P +QQ HH +H         FP+P DAS +VLG R 
Sbjct  1    MLFARGLSQISRRSINRYQWLC--PQQQQFHHSNH---------FPSPIDASHKVLGCRV  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+HHQS+AVAEEQ+DPFSLVADELSL
Sbjct  50   IHSWVSNALSGIGQQIHHQSTAVAEEQVDPFSLVADELSL  89



>ref|XP_009793550.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=415

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 72/100 (72%), Gaps = 11/100 (11%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML +R  S+ISR + NR RWL S   +QQ HH +H         FP+P DAS +VLG R 
Sbjct  1    MLFARGWSQISRRSINRCRWLRSQ--QQQFHHSNH---------FPSPIDASHKVLGCRV  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+HHQS+AVAEEQ+DPFSLVADELSL
Sbjct  50   IHSWVSNALSGIGQQIHHQSTAVAEEQVDPFSLVADELSL  89



>ref|XP_006364882.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=415

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 65/100 (65%), Gaps = 13/100 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M+ S+ LS+ISR  F+R RWL S    QQ H  +H+  P              +VLG R 
Sbjct  1    MIFSKGLSQISRNRFSRCRWLFSSRPIQQLHQSNHIHDPP-------------KVLGCRV  47

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+H QS+AVAEEQ+DPFSLVADELSL
Sbjct  48   IHSWVSNALSGIGQQIHQQSTAVAEEQVDPFSLVADELSL  87



>ref|NP_001234089.1| geranyl pyrophosphate synthase [Solanum lycopersicum]
 gb|ABB88703.1| geranyl pyrophosphate synthase [Solanum lycopersicum]
Length=415

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 13/100 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M+ S+ L++ISR  F+R RWL SL    Q H  +H+  P              +VLG R 
Sbjct  1    MIFSKGLAQISRNRFSRCRWLFSLRPIPQLHQSNHIHDPP-------------KVLGCRV  47

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+H QS+AVAEEQ+DPFSLVADELSL
Sbjct  48   IHSWVSNALSGIGQQIHQQSTAVAEEQVDPFSLVADELSL  87



>ref|XP_010324777.1| PREDICTED: geranyl pyrophosphate synthase isoform X1 [Solanum 
lycopersicum]
Length=431

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 13/100 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M+ S+ L++ISR  F+R RWL SL    Q H  +H+  P              +VLG R 
Sbjct  1    MIFSKGLAQISRNRFSRCRWLFSLRPIPQLHQSNHIHDPP-------------KVLGCRV  47

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+ WVSNA+  IGQQ+H QS+AVAEEQ+DPFSLVADELSL
Sbjct  48   IHSWVSNALSGIGQQIHQQSTAVAEEQVDPFSLVADELSL  87



>ref|XP_009600023.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X3 [Nicotiana tomentosiformis]
Length=364

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 11/85 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML +R LS+ISR + NR++WL   P +QQ HH +H         FP+P DAS +VLG R 
Sbjct  1    MLFARGLSQISRRSINRYQWLC--PQQQQFHHSNH---------FPSPIDASHKVLGCRV  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAE  645
            I+ WVSNA+  IGQQ+HHQS+AVAE
Sbjct  50   IHSWVSNALSGIGQQIHHQSTAVAE  74



>gb|AEZ55677.1| geranyl diphosphate synthase [Salvia miltiorrhiza]
 gb|AGE45642.1| solanesyl diphosphate synthase 2 [Salvia miltiorrhiza]
Length=424

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 18/107 (17%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLS-------LPVEQQQHHRHHLFSPTNSSIFPAPFDASQ  549
            M+  R L+R++R  + R RW+ S        P+ Q +H  H          F  P  +S+
Sbjct  1    MISVRGLARLARSGYARRRWVYSSLGCSGSAPL-QLEHSSH----------FRNPIQSSR  49

Query  550  QVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            +VLG R IY WVSNA+ ++GQQVH QSS+  EEQLDPFSLVADELS+
Sbjct  50   EVLGCRVIYSWVSNAISTVGQQVHLQSSSAVEEQLDPFSLVADELSI  96



>ref|XP_011096618.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Sesamum indicum]
Length=423

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 65/107 (61%), Gaps = 19/107 (18%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSL-------PVEQQQHHRHHLFSPTNSSIFPAPFDASQ  549
            M+  R L+R+SR    R RW+ S        P+ Q            NSS F +P  ASQ
Sbjct  1    MMSVRGLTRVSRSACARCRWVYSSLGTYADPPLLQ------------NSSHFRSPVQASQ  48

Query  550  QVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            +VLG R IY WVS+A+ S+GQQ H QSS+  EEQLDPFSLVADELS+
Sbjct  49   EVLGCRVIYSWVSSALSSVGQQAHIQSSSAVEEQLDPFSLVADELSI  95



>gb|ACC77966.1| geranyl pyrophosphate synthase [Catharanthus roseus]
 gb|AHA82035.1| geranyl pyrophosphate synthase [Catharanthus roseus]
Length=420

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 8/100 (8%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR L RI+R + NR R L   P++ Q       F       F +P  +SQ+V G R 
Sbjct  1    MLFSRGLYRIARTSLNRSRLLY--PLQSQSPELLQSFQ------FRSPIGSSQKVSGFRV  52

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            IY WVS+A+ ++GQQV  QS++VAEE LDPFSLVADELS+
Sbjct  53   IYSWVSSALANVGQQVQRQSNSVAEEPLDPFSLVADELSI  92



>ref|XP_009793552.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X3 [Nicotiana sylvestris]
Length=364

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 11/85 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML +R  S+ISR + NR RWL S   +QQ HH +H         FP+P DAS +VLG R 
Sbjct  1    MLFARGWSQISRRSINRCRWLRSQ--QQQFHHSNH---------FPSPIDASHKVLGCRV  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAE  645
            I+ WVSNA+  IGQQ+HHQS+AVAE
Sbjct  50   IHSWVSNALSGIGQQIHHQSTAVAE  74



>gb|AGL91647.1| geranyl diphosphate synthase [Catharanthus roseus]
Length=420

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 8/100 (8%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR L RI+R + NR R L   P++ Q       F       F +P  +SQ+V G R 
Sbjct  1    MLFSRGLYRIARTSLNRSRLLY--PLQSQSPELLQSFQ------FRSPIGSSQKVSGFRV  52

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            IY  VS+A+ ++GQQV  QS++VAEE LDPFSLVADELS+
Sbjct  53   IYSCVSSALANVGQQVQRQSNSVAEEPLDPFSLVADELSI  92



>ref|XP_002268229.2| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Vitis vinifera]
 emb|CBI40000.3| unnamed protein product [Vitis vinifera]
Length=422

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 61/106 (58%), Gaps = 18/106 (17%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSL-----PVEQQQHHRHHLFSPTNSSIFPAPFDASQQ  552
            ML SR  SR+ +  FNR  +WLLS      P +    HRH + SPT+            +
Sbjct  1    MLFSRGFSRLPKATFNRCSKWLLSHHRHPHPQDHHHRHRHFVLSPTH------------R  48

Query  553  VLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            VLG R  Y W S  +  +  Q+H +SS++AEEQLDPFSLVADELSL
Sbjct  49   VLGCRETYSWGSPFLSGVRHQIHQESSSLAEEQLDPFSLVADELSL  94



>gb|AEM42978.1| geranyl diphosphate synthase [Siraitia grosvenorii]
Length=423

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 61/107 (57%), Gaps = 19/107 (18%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF--RWLLSLPVEQQQHHRHHLFSPTNSSIFPA-----PFDASQ  549
            ML SR LSRISR   N +  RW LS        HR    S T   + P      P ++  
Sbjct  1    MLFSRGLSRISRIPRNSYCCRWFLS--------HR----SDTRPVLLPNVLSLHPSESDP  48

Query  550  QVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            Q LG R I Y   + +  +G+Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  49   QALGYREIMYLAYSNLHGLGRQIHHQSSSIVEEQLDPFSLVADELSL  95



>ref|XP_004134571.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 ref|XP_004158644.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN49423.1| hypothetical protein Csa_6G524610 [Cucumis sativus]
Length=423

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 60/105 (57%), Gaps = 15/105 (14%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNR--FRWLLSLPVEQQQHHRHH---LFSPTNSSIFPAPFDASQQV  555
            ML  R LSRISR + N    RW LS        HR     +  P   S+ P+  D  +Q 
Sbjct  1    MLFYRGLSRISRISRNSSCCRWFLS--------HRSDTRPVLIPNVPSLHPSESD--RQA  50

Query  556  LGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            LG R I Y  S A   +G+ +HHQSS+V EEQLDPFSLVADELSL
Sbjct  51   LGCREIMYLASPAFHGLGRHIHHQSSSVVEEQLDPFSLVADELSL  95



>ref|XP_008439594.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Cucumis melo]
Length=423

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 13/104 (13%)
 Frame = +1

Query  391  MLLSRELSRISR--GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPA--PFDASQQVL  558
            ML  R LSRISR   N +  RW LS        HR     P     FP+  P ++  Q L
Sbjct  1    MLFYRGLSRISRIPRNSSSCRWFLS--------HRSDT-RPVLIPNFPSLHPSESDLQAL  51

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            G R I Y  S A   +G Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  52   GCREIMYLASPAFHGLGHQIHHQSSSLVEEQLDPFSLVADELSL  95



>ref|XP_009793551.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=372

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  565  RAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            R I+ WVSNA+  IGQQ+HHQS+AVAEEQ+DPFSLVADELSL
Sbjct  5    RVIHSWVSNALSGIGQQIHHQSTAVAEEQVDPFSLVADELSL  46



>ref|XP_009600021.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=372

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  565  RAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            R I+ WVSNA+  IGQQ+HHQS+AVAEEQ+DPFSLVADELSL
Sbjct  5    RVIHSWVSNALSGIGQQIHHQSTAVAEEQVDPFSLVADELSL  46



>emb|CDP04262.1| unnamed protein product [Coffea canephora]
Length=428

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 5/102 (5%)
 Frame = +1

Query  391  MLLSRELSRISRGNF--NRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGR  564
            +L +R L RI+R +   +R +W  S     +      L S T+   + +P  +SQ+VLG 
Sbjct  2    VLFARGLYRIARASARASRCQWAFSSLQSPRNQPTQLLESATH---YYSPIHSSQKVLGC  58

Query  565  RAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            R  Y WVSNA+ ++G Q   QSS  AEE LDPFSLVADELSL
Sbjct  59   RVFYSWVSNALANVGHQTQRQSSPAAEETLDPFSLVADELSL  100



>gb|EYU29662.1| hypothetical protein MIMGU_mgv1a007049mg [Erythranthe guttata]
Length=421

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 24/108 (22%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLS-------LPV-EQQQHHRHHLFSPTNSSIFPAPFDAS  546
            M   R L+R+S+  + R RW+ S       +P+ E   H R HL               S
Sbjct  1    MFSVRGLTRLSKSGYARCRWVYSSLGSNSSVPLLEHPTHFRSHL-------------QPS  47

Query  547  QQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             +VLG R IY WVS+A+ S+GQQ  +QS    EEQ+DPFSLVADELSL
Sbjct  48   HEVLGCRVIYSWVSSALSSVGQQAQYQSR---EEQIDPFSLVADELSL  92



>gb|AIG15448.1| geranyl diphosphate synthase 2 [Azadirachta indica]
Length=420

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 61/103 (59%), Gaps = 14/103 (14%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF---RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLG  561
            ML SR LSRISR   N     RWL+S       +    + S ++ S+     D++Q+VLG
Sbjct  1    MLFSRGLSRISRIPRNSLIGCRWLVS-------YRPDTILSGSSHSVG----DSTQKVLG  49

Query  562  RRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             R  Y W   A+  I  Q+H QSS++ EE+LDPFSLVADELSL
Sbjct  50   CREAYLWSLPALHGIRHQIHQQSSSLIEEELDPFSLVADELSL  92



>emb|CAC20852.1| geranyl diphosphat synthase [Quercus robur]
Length=416

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 59/103 (57%), Gaps = 18/103 (17%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHL--FSPTNSSIFPA-PFDASQQVLG  561
            ML SR +SRI R   N FRW LS        H+ HL   +P      PA  + ++ +VLG
Sbjct  1    MLFSR-ISRIRRPGSNGFRWFLS--------HKTHLQFLNP------PAYSYSSTHKVLG  45

Query  562  RRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             R I+ W   A+      +HHQSS++ EEQ DPFSLVADELS+
Sbjct  46   CREIFSWGLPALHGFRHNIHHQSSSIVEEQNDPFSLVADELSM  88



>gb|EPS58436.1| geranyl pyrophosphate synthase [Genlisea aurea]
Length=393

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  532  PFDASQQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            P+++SQ+V GRR ++ WVSN V ++GQQ   QS+   E+ LDPFSLVADELSL
Sbjct  15   PYESSQRVSGRRVLFSWVSNVVSNVGQQPQFQSNLSVEDHLDPFSLVADELSL  67



>ref|XP_006468068.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X5 [Citrus sinensis]
 gb|KDO75387.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=421

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 61/104 (59%), Gaps = 15/104 (14%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V EEQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEEQLDPFSLVADELSI  93



>ref|XP_006448989.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62229.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=421

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 61/104 (59%), Gaps = 15/104 (14%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V EEQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEEQLDPFSLVADELSI  93



>gb|AFJ52721.1| geranyl diphosphate synthase [Mangifera indica]
Length=421

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 56/103 (54%), Gaps = 13/103 (13%)
 Frame = +1

Query  391  MLLSRELSRIS---RGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLG  561
            ML S  LSRIS   R +    RWLLS        H     SP+ SS      D+  +V G
Sbjct  1    MLFSYGLSRISINPRASLLTCRWLLS--------HLTGSLSPSTSS--HTISDSVHKVWG  50

Query  562  RRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             R  Y W   A+     Q+HHQSS++ E+QLDPFSLVADELSL
Sbjct  51   CREAYTWSVPALHGFRHQIHHQSSSLIEDQLDPFSLVADELSL  93



>ref|XP_004509097.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=416

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 63/100 (63%), Gaps = 13/100 (13%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +SR  RG+FN  RW LS+    + H+   L S +++       D+++QV+ RR 
Sbjct  1    MLFSR-ISRNLRGSFNGCRWFLSI----RDHNHRFLISHSST-------DSTEQVM-RRL  47

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I+     A+ S   Q+HH SS++ E++LDPFSLVADELSL
Sbjct  48   IFSKGMPALYSSRYQIHHHSSSLVEDELDPFSLVADELSL  87



>ref|XP_007024979.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY27601.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
Length=418

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = +1

Query  391  MLLSRELSRISRG-NFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            ML  R  SRISR        ++LS P             P+ S +     +++ +V   R
Sbjct  1    MLFCRGFSRISRNPRTILLGFILSRPT-----------GPSQSLLSNQYLNSTLKVCAGR  49

Query  568  AIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
              + W  +A   IG+Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  50   ETFSWSLSAFLGIGRQIHHQSSSIIEEQLDPFSLVADELSL  90



>ref|XP_002530137.1| geranylgeranyl pyrophosphate synthase, putative [Ricinus communis]
 gb|EEF32253.1| geranylgeranyl pyrophosphate synthase, putative [Ricinus communis]
Length=417

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 11/100 (11%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            MLLSR LSRISR  +      LS  +++        F  +N+S +     ++ +VL  R 
Sbjct  1    MLLSRGLSRISRNGYRH--CFLSRGLDRP-------FLLSNTSHYLGR--STPKVLNHRE  49

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             Y W  + +    QQ+HHQSS++ E+QLDPFSLVADELSL
Sbjct  50   TYSWSLSTLYGFKQQIHHQSSSLIEDQLDPFSLVADELSL  89



>gb|KDP37498.1| hypothetical protein JCGZ_05937 [Jatropha curcas]
Length=415

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 57/101 (56%), Gaps = 15/101 (15%)
 Frame = +1

Query  391  MLLSRELSRISR-GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            M  SR LSRISR G+F    W L          R H F  ++SS        +Q+++ R+
Sbjct  1    MFFSRGLSRISRSGSF----WFL----------RLHPFLLSSSSHSLGVGYPAQKIINRK  46

Query  568  AIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
                W S A+    Q VHHQSS++ EEQLDPFSLVADELSL
Sbjct  47   ETDSWNSPALYGFKQNVHHQSSSLIEEQLDPFSLVADELSL  87



>ref|XP_007211736.1| hypothetical protein PRUPE_ppa006211mg [Prunus persica]
 gb|EMJ12935.1| hypothetical protein PRUPE_ppa006211mg [Prunus persica]
Length=422

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 21/108 (19%)
 Frame = +1

Query  391  MLLSRELSRISRGNFN------RFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPF-DASQ  549
            ML SR  SRI R +FN      RFR +            H LF    SSI+     +++Q
Sbjct  1    MLFSRGFSRIGRNSFNGLCRCLRFRRM----------DAHQLFV---SSIYSQSLSESTQ  47

Query  550  QVLGRRAIYYW-VSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            ++LG R  + W +         Q+HHQSS++ EE LDPFSLV+DELSL
Sbjct  48   KILGCRDFFSWGLPPVFHGYRHQIHHQSSSIVEEPLDPFSLVSDELSL  95



>ref|XP_011009597.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=440

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 48/94 (51%), Gaps = 11/94 (12%)
 Frame = +1

Query  409  LSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIYYWVS  588
            LSRISR   N  RW LS     Q      L S  + S  P  F         R  Y W  
Sbjct  23   LSRISRITRNGSRWFLS----HQPSSYGFLLSNNSRSSTPKVFSC-------RETYSWTV  71

Query  589  NAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             ++     Q+HHQSS++ EEQLDPFSLVADELS+
Sbjct  72   PSLHVFKHQIHHQSSSLVEEQLDPFSLVADELSV  105



>ref|XP_008225576.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Prunus mume]
Length=455

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPF-DASQQVLGR  564
            ML SR  SRI R +FN   R LLS     ++   H LF    SSI+     +++Q++LG 
Sbjct  1    MLFSRGFSRIGRNSFNGLCRCLLS-----RRMDAHQLFV---SSIYSQSLSESTQKILGC  52

Query  565  RAIY-YWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            R  +   +         Q+HHQSS++ EE LDPFSLV+DELSL
Sbjct  53   RDFFSLGLPPVFHGYRHQIHHQSSSIVEEPLDPFSLVSDELSL  95



>gb|KDO75395.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=348

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 20/109 (18%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  98



>ref|XP_003550028.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Glycine max]
 gb|KHN27059.1| Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Glycine soja]
Length=419

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 10/100 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +S+  RG+FN  RW  S+       H H   SP N        D++QQV+  R+
Sbjct  1    MLFSR-ISKNLRGSFNSCRWFRSIG-----DHNHCFLSPHN--FHSRGGDSTQQVM--RS  50

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            + +    A+ S    +HHQSS++ E++ DPFSLVADELSL
Sbjct  51   LIFSKGPALHSSRYLIHHQSSSIVEDEHDPFSLVADELSL  90



>ref|XP_006448991.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62231.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=426

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 20/109 (18%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  98



>gb|KDO75389.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=427

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 20/109 (18%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  98



>ref|XP_006468066.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X3 [Citrus sinensis]
 gb|KDO75388.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=426

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 20/109 (18%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  98



>ref|XP_007024981.1| Geranyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY27603.1| Geranyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
Length=310

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  535  FDASQQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             +++ +V   R  + W  +A   IG+Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  4    LNSTLKVCAGRETFSWSLSAFLGIGRQIHHQSSSIIEEQLDPFSLVADELSL  55



>gb|KHN21417.1| Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Glycine soja]
Length=420

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 9/100 (9%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +SR  RG+FN  RW LS+     + H H   S  N        D++QQV+ R  
Sbjct  1    MLFSR-ISRNLRGSFNSCRWFLSI-----EDHNHRFLSLHN--FHSRGGDSTQQVM-RSL  51

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I      A+ S    +HHQSS++ E++ DPFSLVADELSL
Sbjct  52   IISKGLPALHSSRYLIHHQSSSIVEDEHDPFSLVADELSL  91



>gb|AAN86061.1| geranylgeranyl diphosphate synthase [Citrus unshiu]
Length=426

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 20/109 (18%)
 Frame = +1

Query  391  MLLSRELSRISRGN----FNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR +    F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTPFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  98



>dbj|BAF98298.1| geranyl-diphosphate synthase [Hevea brasiliensis]
Length=330

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 49/98 (50%), Gaps = 17/98 (17%)
 Frame = +1

Query  403  RELSRISRGNFNRF--RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIY  576
            R LS ISR     F  R L   PV              NSS      D++Q+V  RR  Y
Sbjct  5    RGLSPISRSGLRLFLSRQLYPFPV-------------ANSSQLLG--DSTQKVFNRRETY  49

Query  577  YWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             W         QQ+HHQSS ++EE LDPFSLVADELSL
Sbjct  50   SWSLVDSHGFKQQIHHQSSFLSEEPLDPFSLVADELSL  87



>dbj|BAF98299.1| geranyl-diphosphate synthase [Hevea brasiliensis]
Length=328

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 49/98 (50%), Gaps = 17/98 (17%)
 Frame = +1

Query  403  RELSRISRGNFNRF--RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIY  576
            R LS ISR     F  R L   PV              NSS      D++Q+V  RR  Y
Sbjct  5    RGLSPISRSGLRLFLSRQLYPFPV-------------ANSSQLLG--DSTQKVFNRRETY  49

Query  577  YWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             W         QQ+HHQSS ++EE LDPFSLVADELSL
Sbjct  50   SWSLVDSHGFKQQIHHQSSFLSEEPLDPFSLVADELSL  87



>ref|XP_006448990.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62230.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=427

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 56/104 (54%), Gaps = 9/104 (9%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S P+     H     +  +S         S+   
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPSHPLLSGASHSAAAAAADSSVKDSGNISLSKT--  57

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
              R  Y W   A+  I  Q+HHQSS+V EEQLDPFSLVADELS+
Sbjct  58   --REAYSWSLPALHGIRHQIHHQSSSVIEEQLDPFSLVADELSI  99



>ref|XP_006468065.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=427

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 56/104 (54%), Gaps = 9/104 (9%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S P+     H     +  +S         S+   
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPSHPLLSGASHSAAAAAADSSVKDSGNISLSKT--  57

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
              R  Y W   A+  I  Q+HHQSS+V EEQLDPFSLVADELS+
Sbjct  58   --REAYSWSLPALHGIRHQIHHQSSSVIEEQLDPFSLVADELSI  99



>ref|XP_006579912.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Glycine max]
Length=420

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +SR  RG+FN  RW LS+       H H   S  N        D++QQV+ R  
Sbjct  1    MLFSR-ISRNLRGSFNSCRWFLSIG-----DHNHRFLSLHN--FHSRGGDSTQQVM-RSL  51

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            I      A+ S    +HHQSS++ E++ DPFSLVADELSL
Sbjct  52   IISKGLPALHSSRYLIHHQSSSIVEDEHDPFSLVADELSL  91



>ref|XP_009360937.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Pyrus x bretschneideri]
Length=422

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 56/102 (55%), Gaps = 10/102 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            ML SR  SRI R +FN   R  LS       H R   F   ++       D++Q+++G R
Sbjct  1    MLFSRGFSRIQRSSFNGLCRCFLS-------HRRDPQFVAASAYSLSLS-DSTQKIMGCR  52

Query  568  AIYYWVSNAVKSIGQ-QVHHQSSAVAEEQLDPFSLVADELSL  690
              + W    V  + + Q+H QSS+V EE LDPFSLV+DELS+
Sbjct  53   EFFSWGLPPVFHVSKHQIHQQSSSVVEEPLDPFSLVSDELSI  94



>ref|XP_006448988.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62228.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=419

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 59/104 (57%), Gaps = 17/104 (16%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E  LDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIE--LDPFSLVADELSI  91



>ref|XP_006468069.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X6 [Citrus sinensis]
 gb|KDO75386.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=419

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 59/104 (57%), Gaps = 17/104 (16%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S          H L S  + S   A  D+S +VL
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPS----------HPLLSGASHSAAAAAADSSVKVL  49

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            G R  Y W   A+  I  Q+HHQSS+V E  LDPFSLVADELS+
Sbjct  50   GCREAYSWSLPALHGIRHQIHHQSSSVIE--LDPFSLVADELSI  91



>ref|XP_008371630.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=422

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            ML SR  SRI R +FN   R  LS       H R   F    S+   +  D++Q+++G R
Sbjct  1    MLFSRGFSRIQRSSFNGLCRCFLS-------HRRDPQFVAA-SAYSQSLSDSTQKIMGCR  52

Query  568  AIYYWVSNAVKSIGQ-QVHHQSSAVAEEQLDPFSLVADELSL  690
              + W    V  + + Q+H QSS++ EE LDPFSLV+DELS+
Sbjct  53   EFFSWGLPPVFHVSKHQIHQQSSSMVEEPLDPFSLVSDELSI  94



>ref|XP_007155874.1| hypothetical protein PHAVU_003G239100g [Phaseolus vulgaris]
 gb|ESW27868.1| hypothetical protein PHAVU_003G239100g [Phaseolus vulgaris]
Length=419

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 10/100 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +S+  RG+FN  RW LS+       H H   SP N   F +  D++ QV+ R  
Sbjct  1    MLFSR-ISKNLRGSFNSCRWFLSIG-----DHNHRFLSPHN---FHSLGDSTHQVM-RSL  50

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             +     A+ S    +H QS+++ E++ DPFSLVADELSL
Sbjct  51   NFSKGLPALHSSRYLIHQQSNSIVEDEHDPFSLVADELSL  90



>ref|XP_010056940.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=417

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 14/94 (15%)
 Frame = +1

Query  409  LSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIYYWVS  588
            +SR++R  FN +R L S          H L +   +    +P      VLG + IY W  
Sbjct  10   VSRLARRGFNGYRRLPS--------SDHRLPALIQTHFAGSPM----TVLGCKDIYSWCL  57

Query  589  NAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             +  SI  Q+HHQ++   EEQLDPFSLVADELS+
Sbjct  58   PSSYSIRHQIHHQTAV--EEQLDPFSLVADELSV  89



>gb|KCW73855.1| hypothetical protein EUGRSUZ_E02451 [Eucalyptus grandis]
Length=495

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 51/98 (52%), Gaps = 22/98 (22%)
 Frame = +1

Query  409  LSRISRGNFNRFRWLLS----LPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIY  576
            +SR++R  FN +R L S    LP   Q H      SP               VLG + IY
Sbjct  88   VSRLARRGFNGYRRLPSSDHRLPALIQTHFAG---SPMT-------------VLGCKDIY  131

Query  577  YWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             W   +  SI  Q+HHQ++   EEQLDPFSLVADELS+
Sbjct  132  SWCLPSSYSIRHQIHHQTAV--EEQLDPFSLVADELSV  167



>gb|KEH31511.1| geranylgeranyl pyrophosphate synthase [Medicago truncatula]
Length=417

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 14/100 (14%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +SR  RG FN +R  LS+     +++R  LFS +       P D+++QV+ R  
Sbjct  1    MLFSR-ISRNLRGAFNGYRRFLSIG----ENNRRFLFSHS-------PADSTEQVM-RSL  47

Query  571  IYYWVSNAVKSIGQQVHHQ-SSAVAEEQLDPFSLVADELS  687
            ++     A+ S    +HH  SS++ E++LDPFSLVADELS
Sbjct  48   VFSKGMPALYSSRYHIHHHTSSSLVEDELDPFSLVADELS  87



>ref|XP_010056939.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Eucalyptus grandis]
Length=418

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 13/94 (14%)
 Frame = +1

Query  409  LSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIYYWVS  588
            +SR++R  FN +R L S          H L +   +    +P      VLG + IY W  
Sbjct  10   VSRLARRGFNGYRRLPS--------SDHRLPALIQTHFAGSPM----TVLGCKDIYSWCL  57

Query  589  NAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             +  SI  Q+HHQ+ AV  EQLDPFSLVADELS+
Sbjct  58   PSSYSIRHQIHHQT-AVEVEQLDPFSLVADELSV  90



>ref|XP_002314919.2| hypothetical protein POPTR_0010s148602g, partial [Populus trichocarpa]
 gb|EEF01090.2| hypothetical protein POPTR_0010s148602g, partial [Populus trichocarpa]
Length=209

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  553  VLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            +L +R  Y W   ++     Q+HHQSS++ EEQLDPFSLVADELS+
Sbjct  24   LLLQRETYSWTVPSLHVFKHQIHHQSSSLVEEQLDPFSLVADELSV  69



>gb|KEH31512.1| geranylgeranyl pyrophosphate synthase [Medicago truncatula]
Length=490

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 14/100 (14%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML SR +SR  RG FN +R  LS+     +++R  LFS +       P D+++QV+ R  
Sbjct  1    MLFSR-ISRNLRGAFNGYRRFLSIG----ENNRRFLFSHS-------PADSTEQVM-RSL  47

Query  571  IYYWVSNAVKSIGQQVHH-QSSAVAEEQLDPFSLVADELS  687
            ++     A+ S    +HH  SS++ E++LDPFSLVADELS
Sbjct  48   VFSKGMPALYSSRYHIHHHTSSSLVEDELDPFSLVADELS  87



>ref|XP_002308360.2| hypothetical protein POPTR_0006s13760g [Populus trichocarpa]
 gb|EEE91883.2| hypothetical protein POPTR_0006s13760g [Populus trichocarpa]
Length=413

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  541  ASQQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            ++++V   R  Y W   +      Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  36   STRKVFNCRETYSWTVPSFHVFKHQIHHQSSSLVEEQLDPFSLVADELSL  85



>ref|XP_010549511.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=414

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            ML  R  SRIS  NF R R     P     H   HL         P    ++Q+  G R 
Sbjct  1    MLFCRGFSRIS-SNFPRKRSFFLCPSFLGSHR--HLVVLDQDHSRPG---SAQEGFGCRE  54

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             Y W S    +   Q++HQSS++ EE+LDPF LVADELSL
Sbjct  55   TYSWRSPVFGNFRHQLYHQSSSLVEEELDPFLLVADELSL  94



>ref|XP_010090457.1| Solanesyl diphosphate synthase 3 [Morus notabilis]
 gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis]
Length=670

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 51/101 (50%), Gaps = 12/101 (12%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            ML SR   +I R +     RWLL    EQ Q     L    +  IF    + S       
Sbjct  1    MLFSRGFRQIPRSSLTGISRWLLPHRPEQSQTSPQCLRESAHK-IFGGYGEPS-------  52

Query  568  AIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
               YW   A+ S   QVHHQSS++ EE+LDPFSLV+DELSL
Sbjct  53   ---YWGLPALHSSRYQVHHQSSSIVEEELDPFSLVSDELSL  90



>ref|XP_011039903.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=413

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  541  ASQQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            ++++V   R  Y W   +      Q+HHQSS++ EEQLDPFSLVADELSL
Sbjct  36   STRKVFNCRETYSWTVPSFHVFKHQIHHQSSSLVEEQLDPFSLVADELSL  85



>ref|XP_010275056.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=369

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 10/100 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M  SR  SR SR +    R +++ P E              S+ F +   ++ +V G R 
Sbjct  1    MFASRLFSRFSRNSLTLCRSVVNSPQEIL----------VLSTYFHSFCGSTTKVFGYRE  50

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             Y W   A+     Q+HH S ++ EEQLDPFSLVADELS+
Sbjct  51   HYSWGLCALHGARYQIHHDSRSMVEEQLDPFSLVADELSI  90



>ref|XP_010275057.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X3 [Nelumbo nucifera]
Length=361

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 10/100 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M  SR  SR SR +    R +++ P E              S+ F +   ++ +V G R 
Sbjct  1    MFASRLFSRFSRNSLTLCRSVVNSPQEIL----------VLSTYFHSFCGSTTKVFGYRE  50

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             Y W   A+     Q+HH S ++ EEQLDPFSLVADELS+
Sbjct  51   HYSWGLCALHGARYQIHHDSRSMVEEQLDPFSLVADELSI  90



>ref|XP_010275055.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=418

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 10/100 (10%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRA  570
            M  SR  SR SR +    R +++ P E              S+ F +   ++ +V G R 
Sbjct  1    MFASRLFSRFSRNSLTLCRSVVNSPQEIL----------VLSTYFHSFCGSTTKVFGYRE  50

Query  571  IYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
             Y W   A+     Q+HH S ++ EEQLDPFSLVADELS+
Sbjct  51   HYSWGLCALHGARYQIHHDSRSMVEEQLDPFSLVADELSI  90



>ref|XP_006468064.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=432

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 14/109 (13%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S P+     H     +  +S         S+   
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPSHPLLSGASHSAAAAAADSSVKDSGNISLSKT--  57

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAE-----EQLDPFSLVADELSL  690
              R  Y W   A+  I  Q+HHQSS+V E     EQLDPFSLVADELS+
Sbjct  58   --REAYSWSLPALHGIRHQIHHQSSSVIEDTDSQEQLDPFSLVADELSI  104



>ref|XP_008787643.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=419

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  532  PFDASQQVLGRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            P +   +VLG R  + W S  +  I  Q+H   S+ AEE LDPFSLVADELS+
Sbjct  39   PSEIRSKVLGCREAFLWGSRGLHDIRYQIHQDRSSAAEEPLDPFSLVADELSI  91



>ref|XP_004511880.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=425

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 11/98 (11%)
 Frame = +1

Query  397  LSRELSRISRGNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIY  576
            +SR L ++SR + N  RW         Q  RH      +S  +  P D++ +V+    I+
Sbjct  10   ISRNL-KLSRSS-NGCRWF--------QSGRHQNRQFLSSHDYQLPTDSTAKVMAS-LIF  58

Query  577  YWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
                 A+ S   Q+HHQSS+++EE+LDPFSLVADELSL
Sbjct  59   SKGLPALHSSRYQIHHQSSSISEEELDPFSLVADELSL  96



>gb|KDP38011.1| hypothetical protein JCGZ_04654 [Jatropha curcas]
Length=411

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 47/102 (46%), Gaps = 21/102 (21%)
 Frame = +1

Query  391  MLLSRELSRISR--GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGR  564
            M L REL RISR  G F   R L SL             SP  +         +Q V   
Sbjct  1    MSLYRELLRISRNGGLFGCRRILASLQ------------SPHGNC-------TTQMVSSS  41

Query  565  RAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
            +  Y W   A     QQVHHQS+   EE  DPFSLVADELSL
Sbjct  42   KETYSWSVPAFHIFKQQVHHQSTTFVEEHNDPFSLVADELSL  83



>ref|XP_008371790.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Malus domestica]
Length=419

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query  412  SRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRRAIYYW-V  585
            SRI R +FN   R LLS   + QQ      +S + +       D++Q+++G      W +
Sbjct  4    SRIQRSSFNGLCRCLLSHRRDPQQFVAAXTYSQSLN-------DSTQKIMGCGEFISWGL  56

Query  586  SNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
                     Q+HHQSS++ EE LDPFSLV+DELS+
Sbjct  57   PPVFHGSRHQIHHQSSSIVEEPLDPFSLVSDELSI  91



>ref|XP_006468067.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X4 [Citrus sinensis]
Length=425

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 54/104 (52%), Gaps = 11/104 (11%)
 Frame = +1

Query  391  MLLSRELSRISR----GNFNRFRWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVL  558
            ML+ R LSRISR     +F R RWL S P+     H     +  +S         S+   
Sbjct  1    MLIYRGLSRISRISKKTSFGR-RWLPSHPLLSGASHSAAAAAADSSVKDSGNISLSKT--  57

Query  559  GRRAIYYWVSNAVKSIGQQVHHQSSAVAEEQLDPFSLVADELSL  690
              R  Y W   A+  I  Q+HHQSS+V E  LDPFSLVADELS+
Sbjct  58   --REAYSWSLPALHGIRHQIHHQSSSVIE--LDPFSLVADELSI  97



>ref|XP_004293518.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Fragaria vesca subsp. vesca]
Length=430

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 15/106 (14%)
 Frame = +1

Query  391  MLLSRELSRISRGNFNRF-RWLLSLPVEQQQHHRHHLFSPTNSSIFPAPFDASQQVLGRR  567
            M+ SR  SR+ R +FN   R LLS    +Q  H+       + S+     D++Q++LG R
Sbjct  1    MIFSRGFSRLPRTSFNGLCRCLLS---NRQDPHQFLASKACSQSLG----DSTQKILGCR  53

Query  568  AIYYWVSNAVKSIGQ-----QVHHQSSAVAEEQLDPFSLVADELSL  690
               +W S      G      Q+H+Q S++ EE  DPFSLV+DELSL
Sbjct  54   E--FWSSGLPTFPGSLTSRHQIHNQISSIVEEPQDPFSLVSDELSL  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520