BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022F15

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073026.1|  PREDICTED: uncharacterized protein LOC105158...    350   9e-112   Sesamum indicum [beniseed]
ref|XP_011073024.1|  PREDICTED: uncharacterized protein LOC105158...    350   1e-111   Sesamum indicum [beniseed]
ref|XP_010319061.1|  PREDICTED: uncharacterized protein LOC101264...    345   7e-111   
ref|XP_008811803.1|  PREDICTED: uncharacterized protein LOC103722...    342   2e-110   
ref|XP_006581877.1|  PREDICTED: uncharacterized protein LOC100779...    346   2e-110   Glycine max [soybeans]
ref|XP_009595697.1|  PREDICTED: uncharacterized protein LOC104091...    346   2e-110   Nicotiana tomentosiformis
ref|XP_002511207.1|  conserved hypothetical protein                     347   2e-110   
ref|XP_009595689.1|  PREDICTED: uncharacterized protein LOC104091...    347   3e-110   
ref|XP_002279798.1|  PREDICTED: uncharacterized protein LOC100268...    346   4e-110   Vitis vinifera
ref|XP_006581876.1|  PREDICTED: uncharacterized protein LOC100779...    346   4e-110   Glycine max [soybeans]
ref|XP_009774848.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    346   4e-110   Nicotiana sylvestris
gb|KHN23276.1|  Ribonuclease J                                          346   4e-110   Glycine soja [wild soybean]
ref|XP_006578697.1|  PREDICTED: uncharacterized protein LOC100783...    346   6e-110   Glycine max [soybeans]
ref|XP_010319060.1|  PREDICTED: uncharacterized protein LOC101264...    345   6e-110   Solanum lycopersicum
ref|XP_003522430.1|  PREDICTED: uncharacterized protein LOC100783...    345   7e-110   Glycine max [soybeans]
ref|XP_010319059.1|  PREDICTED: uncharacterized protein LOC101264...    345   8e-110   Solanum lycopersicum
ref|XP_010319058.1|  PREDICTED: uncharacterized protein LOC101264...    345   9e-110   
gb|KHN31905.1|  Ribonuclease J                                          345   9e-110   Glycine soja [wild soybean]
ref|XP_010250772.1|  PREDICTED: uncharacterized protein LOC104592...    344   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_006351477.1|  PREDICTED: uncharacterized protein LOC102586834    343   2e-109   Solanum tuberosum [potatoes]
ref|XP_010250771.1|  PREDICTED: uncharacterized protein LOC104592...    344   2e-109   Nelumbo nucifera [Indian lotus]
emb|CDP10033.1|  unnamed protein product                                343   4e-109   Coffea canephora [robusta coffee]
ref|XP_008811801.1|  PREDICTED: uncharacterized protein LOC103722...    343   5e-109   Phoenix dactylifera
ref|XP_010105237.1|  Ribonuclease J                                     343   7e-109   
gb|EPS67461.1|  hypothetical protein M569_07313                         341   7e-109   Genlisea aurea
ref|XP_006477010.1|  PREDICTED: uncharacterized protein LOC102606...    342   2e-108   
ref|XP_007137930.1|  hypothetical protein PHAVU_009G167400g             341   2e-108   Phaseolus vulgaris [French bean]
gb|EMS68688.1|  Ribonuclease J                                          325   8e-108   Triticum urartu
ref|XP_006827615.1|  hypothetical protein AMTR_s00009p00241540          339   1e-107   Amborella trichopoda
ref|XP_002318122.2|  hypothetical protein POPTR_0012s09780g             340   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006440090.1|  hypothetical protein CICLE_v10018763mg             339   2e-107   Citrus clementina [clementine]
ref|XP_011044175.1|  PREDICTED: uncharacterized protein LOC105139...    339   2e-107   Populus euphratica
dbj|BAD28842.1|  putative metallo beta subunit lactamase                328   3e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011024044.1|  PREDICTED: uncharacterized protein LOC105125338    339   3e-107   Populus euphratica
gb|AES72341.2|  RNA-metabolising metallo-beta-lactamase                 338   3e-107   Medicago truncatula
ref|XP_009346516.1|  PREDICTED: uncharacterized protein LOC103938240    339   5e-107   Pyrus x bretschneideri [bai li]
emb|CBI15641.3|  unnamed protein product                                347   6e-107   Vitis vinifera
emb|CAN81787.1|  hypothetical protein VITISV_026006                     346   6e-107   Vitis vinifera
ref|XP_008374252.1|  PREDICTED: uncharacterized protein LOC103437...    338   6e-107   
gb|AES91056.2|  RNA-metabolising metallo-beta-lactamase                 333   7e-107   Medicago truncatula
gb|KHN14093.1|  Ribonuclease J                                          336   8e-107   Glycine soja [wild soybean]
gb|KJB08022.1|  hypothetical protein B456_001G059600                    337   8e-107   Gossypium raimondii
ref|XP_009375227.1|  PREDICTED: uncharacterized protein LOC103964...    338   9e-107   Pyrus x bretschneideri [bai li]
ref|XP_008464474.1|  PREDICTED: uncharacterized protein LOC103502...    338   1e-106   Cucumis melo [Oriental melon]
ref|XP_008464473.1|  PREDICTED: uncharacterized protein LOC103502...    337   1e-106   Cucumis melo [Oriental melon]
ref|XP_003608859.1|  Ribonuclease J                                     333   2e-106   
gb|KHG17441.1|  Ribonuclease J                                          337   2e-106   Gossypium arboreum [tree cotton]
ref|XP_003602090.1|  Ribonuclease J                                     338   2e-106   
ref|XP_007037950.1|  RNA-metabolising metallo-beta-lactamase fami...    338   3e-106   
gb|KDP30936.1|  hypothetical protein JCGZ_11312                         336   3e-106   Jatropha curcas
ref|XP_007210499.1|  hypothetical protein PRUPE_ppa001238mg             336   3e-106   
ref|XP_008392826.1|  PREDICTED: uncharacterized protein LOC103455...    337   3e-106   
ref|XP_007210498.1|  hypothetical protein PRUPE_ppa001238mg             335   4e-106   
ref|XP_009359453.1|  PREDICTED: uncharacterized protein LOC103950...    337   4e-106   Pyrus x bretschneideri [bai li]
ref|XP_004161356.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease...    336   5e-106   
ref|XP_004138055.1|  PREDICTED: ribonuclease J-like                     336   5e-106   Cucumis sativus [cucumbers]
gb|KGN63492.1|  hypothetical protein Csa_1G002120                       336   5e-106   Cucumis sativus [cucumbers]
ref|XP_010677898.1|  PREDICTED: uncharacterized protein LOC104893...    335   6e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008239449.1|  PREDICTED: uncharacterized protein LOC103338047    335   6e-106   Prunus mume [ume]
ref|XP_006600800.1|  PREDICTED: uncharacterized protein LOC100814...    335   8e-106   Glycine max [soybeans]
ref|XP_004500652.1|  PREDICTED: ribonuclease J-like isoform X1          334   9e-106   Cicer arietinum [garbanzo]
ref|XP_002321691.2|  hypothetical protein POPTR_0015s10570g             335   9e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006600801.1|  PREDICTED: uncharacterized protein LOC100814...    334   1e-105   Glycine max [soybeans]
ref|XP_010519514.1|  PREDICTED: uncharacterized protein LOC104798...    335   1e-105   Tarenaya hassleriana [spider flower]
gb|KCW83176.1|  hypothetical protein EUGRSUZ_B00129                     334   1e-105   Eucalyptus grandis [rose gum]
ref|XP_010045503.1|  PREDICTED: uncharacterized protein LOC104434227    333   2e-105   
ref|XP_010519515.1|  PREDICTED: uncharacterized protein LOC104798...    334   2e-105   Tarenaya hassleriana [spider flower]
gb|KHG13818.1|  Ribonuclease J                                          332   2e-105   Gossypium arboreum [tree cotton]
ref|XP_010909137.1|  PREDICTED: uncharacterized protein LOC105035...    334   2e-105   Elaeis guineensis
ref|XP_007155529.1|  hypothetical protein PHAVU_003G209600g             333   2e-105   Phaseolus vulgaris [French bean]
ref|XP_007155530.1|  hypothetical protein PHAVU_003G209600g             333   2e-105   Phaseolus vulgaris [French bean]
gb|KJB19806.1|  hypothetical protein B456_003G119600                    333   3e-105   Gossypium raimondii
ref|XP_010235506.1|  PREDICTED: uncharacterized protein LOC100825...    333   4e-105   Brachypodium distachyon [annual false brome]
gb|AFW66257.2|  hypothetical protein ZEAMMB73_692349                    315   6e-105   
ref|XP_004297533.1|  PREDICTED: uncharacterized protein LOC101299666    332   1e-104   Fragaria vesca subsp. vesca
ref|XP_006647352.1|  PREDICTED: uncharacterized protein LOC102710...    329   1e-104   
gb|EEE57142.1|  hypothetical protein OsJ_07047                          330   3e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73354.1|  hypothetical protein OsI_07566                          330   6e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_002451689.1|  hypothetical protein SORBIDRAFT_04g005900          329   9e-104   Sorghum bicolor [broomcorn]
gb|EMT12329.1|  Ribonuclease J                                          329   9e-104   
ref|XP_004952679.1|  PREDICTED: uncharacterized protein LOC101761...    329   9e-104   Setaria italica
ref|XP_009419382.1|  PREDICTED: uncharacterized protein LOC103999...    329   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645344.1|  PREDICTED: uncharacterized protein LOC103626...    328   2e-103   Zea mays [maize]
dbj|BAB08807.1|  unnamed protein product                                318   9e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84407.1|  BnaC03g50930D                                          321   1e-100   
ref|XP_009150395.1|  PREDICTED: uncharacterized protein LOC103873754    320   3e-100   Brassica rapa
ref|XP_010909140.1|  PREDICTED: uncharacterized protein LOC105035...    315   6e-100   
ref|XP_002864846.1|  EMB2746                                            319   2e-99    
ref|XP_010484076.1|  PREDICTED: uncharacterized protein LOC104762480    318   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010444239.1|  PREDICTED: uncharacterized protein LOC104726958    318   2e-99    Camelina sativa [gold-of-pleasure]
ref|NP_201147.2|  RNase J                                               318   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460357.1|  PREDICTED: uncharacterized protein LOC104741250    318   2e-99    
gb|KFK28054.1|  hypothetical protein AALP_AA8G465700                    318   3e-99    Arabis alpina [alpine rockcress]
emb|CDY41516.1|  BnaA06g22690D                                          322   3e-99    Brassica napus [oilseed rape]
ref|XP_006279731.1|  hypothetical protein CARUB_v10027519mg             317   5e-99    Capsella rubella
ref|XP_010909138.1|  PREDICTED: uncharacterized protein LOC105035...    315   2e-98    
ref|XP_010909136.1|  PREDICTED: uncharacterized protein LOC105035...    315   2e-98    
dbj|BAD44310.1|  putative protein                                       315   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394279.1|  hypothetical protein EUTSA_v10003624mg             310   4e-96    Eutrema salsugineum [saltwater cress]
ref|XP_001775526.1|  predicted protein                                  294   6e-93    
ref|XP_002977440.1|  hypothetical protein SELMODRAFT_107166             284   8e-87    
ref|XP_002975019.1|  hypothetical protein SELMODRAFT_102611             282   2e-86    
ref|XP_011073027.1|  PREDICTED: uncharacterized protein LOC105158...    272   4e-83    
ref|XP_001419620.1|  predicted protein                                  263   5e-83    Ostreococcus lucimarinus CCE9901
ref|XP_009595703.1|  PREDICTED: uncharacterized protein LOC104091...    271   5e-83    Nicotiana tomentosiformis
ref|XP_008811802.1|  PREDICTED: uncharacterized protein LOC103722...    269   4e-82    
ref|XP_006578698.1|  PREDICTED: uncharacterized protein LOC100783...    269   7e-82    Glycine max [soybeans]
ref|XP_001692070.1|  hypothetical protein CHLREDRAFT_115745             259   1e-81    Chlamydomonas reinhardtii
ref|XP_002505947.1|  predicted protein                                  269   2e-81    Micromonas commoda
ref|XP_010663736.1|  PREDICTED: uncharacterized protein LOC100268...    268   2e-81    Vitis vinifera
ref|XP_005646511.1|  Metallo-hydrolase/oxidoreductase                   266   2e-81    Coccomyxa subellipsoidea C-169
ref|XP_010250773.1|  PREDICTED: uncharacterized protein LOC104592...    267   2e-81    Nelumbo nucifera [Indian lotus]
ref|XP_011044176.1|  PREDICTED: uncharacterized protein LOC105139...    266   8e-81    Populus euphratica
gb|ACD36970.1|  chloroplast RNase J variant 2                           265   4e-80    Chlamydomonas reinhardtii
ref|XP_006477011.1|  PREDICTED: uncharacterized protein LOC102606...    264   5e-80    Citrus sinensis [apfelsine]
ref|XP_007510671.1|  predicted protein                                  264   2e-79    Bathycoccus prasinos
ref|XP_008464475.1|  PREDICTED: uncharacterized protein LOC103502...    262   3e-79    
ref|XP_008374253.1|  PREDICTED: uncharacterized protein LOC103437...    262   3e-79    
ref|XP_009375228.1|  PREDICTED: uncharacterized protein LOC103964...    262   4e-79    Pyrus x bretschneideri [bai li]
ref|XP_002949431.1|  hypothetical protein VOLCADRAFT_59321              253   2e-78    Volvox carteri f. nagariensis
gb|ACD36969.1|  chloroplast RNase J variant 1                           263   2e-78    Chlamydomonas reinhardtii
ref|XP_004500653.1|  PREDICTED: ribonuclease J-like isoform X2          259   2e-78    
emb|CEF99170.1|  Beta-lactamase-like                                    259   3e-78    Ostreococcus tauri
ref|XP_009359454.1|  PREDICTED: uncharacterized protein LOC103950...    259   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_008392827.1|  PREDICTED: uncharacterized protein LOC103455...    259   4e-78    
ref|XP_010677899.1|  PREDICTED: uncharacterized protein LOC104893...    258   5e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010909139.1|  PREDICTED: uncharacterized protein LOC105035...    258   9e-78    Elaeis guineensis
ref|XP_011400344.1|  Ribonuclease J                                     257   1e-77    Auxenochlorella protothecoides
ref|XP_003575091.2|  PREDICTED: uncharacterized protein LOC100825...    255   8e-77    Brachypodium distachyon [annual false brome]
ref|XP_009419383.1|  PREDICTED: uncharacterized protein LOC103999...    254   1e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005846864.1|  hypothetical protein CHLNCDRAFT_35723              254   5e-76    Chlorella variabilis
ref|XP_003057206.1|  predicted protein                                  253   1e-75    Micromonas pusilla CCMP1545
ref|XP_004952680.1|  PREDICTED: uncharacterized protein LOC101761...    252   1e-75    Setaria italica
ref|XP_006647353.1|  PREDICTED: uncharacterized protein LOC102710...    251   2e-75    Oryza brachyantha
ref|XP_008645345.1|  PREDICTED: uncharacterized protein LOC103626...    250   9e-75    Zea mays [maize]
gb|EYU23119.1|  hypothetical protein MIMGU_mgv1a0011951mg               234   5e-69    Erythranthe guttata [common monkey flower]
gb|AFW70510.1|  hypothetical protein ZEAMMB73_470070                    219   2e-68    
ref|XP_001712914.1|  regulator of transcription that contains myb...    210   2e-60    Bigelowiella natans
ref|XP_003081348.1|  putative metallo beta subunit lactamase (ISS)      205   2e-60    
gb|ACF24513.1|  myb domain containing transcription regulator           193   1e-54    Gymnochlora stellata
gb|AIB09652.1|  myb domain-containing regulator of transcription        194   1e-54    Lotharella oceanica
ref|WP_041970296.1|  ribonuclease J                                     166   1e-44    Geobacter sp. OR-1
ref|WP_022188780.1|  uncharacterized protein                            164   4e-44    
ref|WP_031514459.1|  ribonuclease J                                     164   5e-44    Desulfohalotomaculum alkaliphilum
ref|WP_035148932.1|  ribonuclease J                                     164   5e-44    Clostridium tetanomorphum
ref|WP_040329937.1|  ribonuclease J                                     163   1e-43    Clostridium ihumii
ref|WP_013780905.1|  ribonuclease J                                     162   2e-43    Mahella australiensis
ref|WP_007908681.1|  ribonuclease J                                     162   3e-43    Ktedonobacter racemifer
ref|WP_013175208.1|  ribonuclease J                                     161   6e-43    Syntrophothermus lipocalidus
ref|WP_003541273.1|  MULTISPECIES: ribonuclease J                       160   9e-43    Desulfotomaculum nigrificans
ref|WP_004512338.1|  ribonuclease J                                     160   1e-42    Geobacter metallireducens
ref|WP_006722641.1|  beta-lactamase                                     159   2e-42    Collinsella intestinalis
ref|WP_027098291.1|  ribonuclease J                                     159   2e-42    Clostridium paraputrificum
ref|WP_041774969.1|  ribonuclease J                                     159   3e-42    
dbj|BAM07398.1|  metallo-beta-lactamase family protein                  159   3e-42    Leptospirillum ferrooxidans C2-3
ref|WP_013361695.1|  ribonuclease J [                                   159   3e-42    Acetoanaerobium sticklandii
gb|EAY57343.1|  Metallo-beta-lactamase family protein                   159   3e-42    Leptospirillum rubarum
ref|WP_038506823.1|  MULTISPECIES: ribonuclease J                       159   4e-42    
ref|WP_006721181.1|  beta-lactamase                                     159   4e-42    Collinsella stercoris
ref|WP_041670664.1|  ribonuclease J                                     158   5e-42    
ref|WP_025209063.1|  ribonuclease J                                     158   8e-42    Hippea sp. KM1
gb|EDZ38560.1|  Metallo-beta-lactamase family protein                   158   8e-42    Leptospirillum sp. Group II '5-way CG'
ref|WP_028307303.1|  ribonuclease J                                     158   9e-42    Desulfitibacter alkalitolerans
ref|WP_036083188.1|  ribonuclease J                                     157   9e-42    
ref|WP_022408182.1|  hypothetical protein                               158   9e-42    
ref|WP_034132436.1|  ribonuclease J                                     157   1e-41    
ref|WP_035377430.1|  ribonuclease J                                     157   2e-41    Fervidicella metallireducens
ref|WP_021776294.1|  Lipid-A-disaccharide synthase protein              157   2e-41    Candidatus Micropelagos thuwalensis
ref|WP_027363779.1|  ribonuclease J                                     157   2e-41    Desulfallas alcoholivorax
ref|WP_038144516.1|  ribonuclease J                                     157   2e-41    
dbj|GAF26815.1|  predicted hydrolase of the metallo-beta-lactamas...    157   2e-41    Moorella thermoacetica Y72
ref|WP_025774532.1|  ribonuclease J                                     157   2e-41    Moorella thermoacetica
ref|WP_011392583.1|  ribonuclease J                                     157   2e-41    Moorella thermoacetica
ref|WP_012532397.1|  ribonuclease J                                     157   2e-41    Geobacter bemidjiensis
ref|WP_022193582.1|  uncharacterized protein                            157   2e-41    
ref|WP_026841106.1|  ribonuclease J                                     157   2e-41    Geobacter bremensis
gb|AFA47776.1|  ribonuclease J                                          156   3e-41    Acetobacterium woodii DSM 1030
ref|WP_011878267.1|  ribonuclease J                                     156   4e-41    Desulfotomaculum reducens
ref|WP_012032459.1|  ribonuclease J                                     156   4e-41    
ref|WP_013681062.1|  ribonuclease J                                     156   4e-41    Hippea maritima
ref|WP_013823559.1|  ribonuclease J                                     156   4e-41    
ref|WP_035356824.1|  ribonuclease J                                     156   4e-41    
ref|WP_008413417.1|  Ribonuclease J 1                                   155   5e-41    Desulfotomaculum hydrothermale
ref|WP_013841942.1|  ribonuclease J                                     155   6e-41    Desulfotomaculum ruminis
ref|WP_020717484.1|  hypothetical protein                               155   6e-41    Acidobacteriaceae bacterium KBS 96
gb|EKD92655.1|  hypothetical protein ACD_28C00372G0009                  156   6e-41    uncultured bacterium
ref|WP_022487813.1|  rNA-metabolising metallo-beta-lactamase            155   7e-41    
ref|WP_034107548.1|  ribonuclease J                                     155   8e-41    
ref|WP_011698454.1|  ribonuclease J                                     155   9e-41    Syntrophobacter fumaroxidans
gb|EGS38404.1|  hypothetical protein HMPREF9200_0908                    155   9e-41    Veillonella sp. oral taxon 780 str. F0422
ref|WP_015839245.1|  ribonuclease J                                     155   9e-41    Geobacter sp. M21
ref|WP_035311834.1|  ribonuclease J                                     155   9e-41    
ref|WP_027308309.1|  ribonuclease J                                     155   1e-40    Caloramator sp. ALD01
ref|WP_038268157.1|  ribonuclease J [                                   155   1e-40    Peptoclostridium litorale
ref|WP_022370752.1|  hypothetical protein                               155   1e-40    
ref|WP_033045158.1|  ribonuclease J                                     155   1e-40    
ref|WP_006716055.1|  ribonuclease J                                     155   1e-40    Desulfitobacterium metallireducens
ref|WP_022744617.1|  ribonuclease J 1                                   154   1e-40    Clostridium saccharobutylicum
ref|WP_041350115.1|  ribonuclease J                                     154   1e-40    
ref|WP_012938379.1|  ribonuclease J                                     154   1e-40    Acidaminococcus fermentans
ref|WP_021951059.1|  uncharacterized protein                            155   1e-40    
ref|WP_041537920.1|  ribonuclease J                                     154   1e-40    
gb|ABB14068.1|  metallo-beta-lactamase family protein                   154   1e-40    Carboxydothermus hydrogenoformans Z-2901
ref|WP_020735078.1|  hypothetical protein                               154   1e-40    
ref|WP_012047895.1|  ribonuclease J                                     154   1e-40    Clostridium botulinum
ref|WP_003385808.1|  ribonuclease J                                     154   1e-40    Clostridium botulinum
ref|WP_035348753.1|  ribonuclease J                                     154   1e-40    Edaphobacter aggregans
ref|WP_017416977.1|  ribonuclease J                                     154   1e-40    Clostridium tunisiense
ref|WP_040193915.1|  ribonuclease J                                     154   2e-40    Clostridium sp. CL-6
ref|WP_021766116.1|  ribonuclease J 1                                   154   2e-40    Leptotrichia sp. oral taxon 215
ref|WP_012159512.1|  ribonuclease J                                     154   2e-40    Alkaliphilus oremlandii
ref|WP_034541882.1|  ribonuclease J                                     154   2e-40    
ref|WP_022259045.1|  uncharacterized protein                            154   2e-40    
ref|WP_042277904.1|  ribonuclease J                                     154   2e-40    [Clostridium] dakarense
ref|WP_020715164.1|  ribonuclease J                                     154   2e-40    Acidobacteriaceae bacterium KBS 89
gb|EES51279.1|  metallo-beta-lactamase superfamily protein              154   3e-40    Clostridium botulinum E1 str. 'BoNT E Beluga'
ref|WP_022366975.1|  uncharacterized protein                            154   3e-40    
ref|WP_042394749.1|  ribonuclease J                                     154   3e-40    Clostridium
ref|WP_018662152.1|  Zn-dependent hydrolase, RNA-metabolising, CP...    154   3e-40    Thermobrachium celere
gb|ACD51285.1|  metallo-beta-lactamase superfamily protein              154   3e-40    Clostridium botulinum E3 str. Alaska E43
ref|WP_012874748.1|  ribonuclease J                                     153   3e-40    Thermobaculum terrenum
ref|WP_013120276.1|  ribonuclease J                                     153   4e-40    Thermincola
ref|WP_029452639.1|  ribonuclease J                                     153   4e-40    Clostridium algidicarnis
ref|WP_033052533.1|  ribonuclease J                                     153   4e-40    
ref|WP_006315221.1|  Zn-dependent hydrolase, RNA-metabolising           153   5e-40    Caldisalinibacter kiritimatiensis
ref|WP_010247550.1|  ribonuclease J                                     153   5e-40    Hungateiclostridium cellulolyticum
ref|WP_009169049.1|  ribonuclease J                                     153   5e-40    Clostridium sp. DL-VIII
ref|WP_008517411.1|  beta-lactamase                                     153   5e-40    alpha proteobacterium IMCC14465
gb|ABS41668.1|  RNA-metabolizing metallo-beta-lactamase family pr...    153   5e-40    Clostridium botulinum F str. Langeland
ref|WP_038113552.1|  ribonuclease J                                     152   6e-40    
ref|WP_032884098.1|  MULTISPECIES: ribonuclease J                       152   6e-40    
ref|WP_027718227.1|  ribonuclease J                                     152   6e-40    Desulfovirgula thermocuniculi
ref|WP_026902059.1|  ribonuclease J                                     152   6e-40    Peptostreptococcaceae bacterium VA2
ref|WP_043013619.1|  ribonuclease J                                     152   6e-40    
ref|WP_021802207.1|  RNA-metabolising metallo-beta-lactamase fami...    152   6e-40    Clostridium intestinale
ref|WP_033063182.1|  ribonuclease J                                     152   6e-40    
ref|WP_028464850.1|  RNA-metabolising metallo-beta-lactamase            152   7e-40    Nisaea denitrificans
gb|EDT86188.1|  RNA-metabolizing metallo-beta-lactamase family pr...    152   7e-40    Clostridium botulinum Bf
gb|EDU36282.1|  hypothetical protein CLOSPO_02450                       152   7e-40    Clostridium sporogenes ATCC 15579
ref|WP_021726953.1|  hypothetical protein                               152   7e-40    Olsenella profusa
ref|WP_021169514.1|  ribonuclease J 1                                   152   7e-40    Sporomusa
dbj|GAE02997.1|  Zn-dependent hydrolase, RNA-metabolising, CPSF 1...    152   8e-40    Clostridium botulinum B str. Osaka05
gb|EHN14088.1|  RNA-metabolizing metallo-beta-lactamase family pr...    152   8e-40    Clostridium sporogenes PA 3679
ref|WP_044566217.1|  ribonuclease J                                     152   8e-40    Anaerococcus provencensis
ref|WP_042384628.1|  MULTISPECIES: ribonuclease J                       152   8e-40    Clostridium
ref|WP_036734249.1|  ribonuclease J                                     152   8e-40    
ref|WP_025435545.1|  ribonuclease J                                     152   8e-40    Peptoclostridium acidaminophilum
ref|WP_012859663.1|  ribonuclease J                                     152   9e-40    Sebaldella termitidis
ref|WP_015651527.1|  hydrolase of metallo-BETA-lactamase superfam...    153   9e-40    Corynebacterium callunae
ref|WP_021875718.1|  Putative RNA-metabolising metallo-beta-lacta...    152   9e-40    Clostridium chauvoei
ref|WP_021283425.1|  ribonuclease J                                     152   9e-40    Clostridium sp. BL8
ref|WP_021866080.1|  hypothetical protein                               152   1e-39    
ref|WP_026882249.1|  ribonuclease J                                     152   1e-39    Clostridium akagii
gb|KFX54949.1|  ribonuclease J                                          152   1e-39    Clostridium botulinum
ref|WP_041173552.1|  ribonuclease J                                     152   1e-39    
ref|WP_012101716.1|  ribonuclease J                                     152   1e-39    Clostridium kluyveri
ref|WP_022423490.1|  rNA-metabolising metallo-beta-lactamase            152   1e-39    
ref|WP_032122717.1|  ribonuclease J                                     151   2e-39    Clostridium amazonitimonense
ref|WP_044823953.1|  ribonuclease J                                     151   2e-39    
ref|WP_028829649.1|  ribonuclease J                                     151   2e-39    Proteocatella sphenisci
ref|WP_022297480.1|  rNA-metabolising metallo-beta-lactamase            152   2e-39    
ref|WP_027097447.1|  ribonuclease J                                     151   2e-39    Clostridium paraputrificum
ref|WP_010943734.1|  ribonuclease J                                     151   2e-39    Geobacter sulfurreducens
ref|WP_035135789.1|  ribonuclease J                                     151   2e-39    Clostridium sulfidigenes
gb|ACA55400.1|  RNA-metabolizing metallo-beta-lactamase family pr...    151   2e-39    Clostridium botulinum A3 str. Loch Maree
ref|WP_022211580.1|  beta-lactamase domain-containing protein           151   2e-39    
ref|WP_034545560.1|  ribonuclease J                                     151   2e-39    Tissierellia bacterium S7-1-4
ref|WP_027355427.1|  ribonuclease J                                     151   2e-39    Desulfofundulus thermocisternus
ref|WP_039772325.1|  ribonuclease J                                     151   2e-39    
ref|WP_008859762.1|  beta-lactamase                                     151   2e-39    Dialister succinatiphilus
ref|WP_039646908.1|  ribonuclease J                                     151   2e-39    Geobacter
ref|WP_008869780.1|  ribonuclease J                                     151   2e-39    Desulfonatronospira thiodismutans
ref|WP_028277222.1|  ribonuclease                                       151   2e-39    Arthrobacter sp. I3
ref|WP_022671195.1|  ribonuclease J                                     151   2e-39    Hippea alviniae
ref|WP_022167986.1|  beta-lactamase domain-containing protein           151   2e-39    
ref|WP_035129432.1|  ribonuclease J                                     151   2e-39    Clostridium sulfidigenes
ref|WP_038153008.1|  ribonuclease J                                     151   2e-39    
ref|WP_041899263.1|  ribonuclease J                                     151   3e-39    Clostridium beijerinckii
ref|WP_023973122.1|  MULTISPECIES: ribonuclease J                       151   3e-39    Clostridium
ref|WP_009607243.1|  ribonuclease J                                     151   3e-39    
ref|WP_004455173.1|  RNA-metabolising metallo-beta-lactamase            151   3e-39    
ref|WP_006784486.1|  ribonuclease J                                     151   3e-39    
ref|WP_012739020.1|  beta-lactamase [                                   151   3e-39    
ref|WP_026888458.1|  ribonuclease J                                     151   3e-39    
ref|WP_012060290.1|  ribonuclease J                                     151   3e-39    
ref|WP_022335061.1|  hypothetical protein                               151   3e-39    
ref|WP_016206456.1|  RNA-metabolising metallo-beta-lactamase fami...    150   3e-39    
ref|WP_015758597.1|  ribonuclease J                                     150   3e-39    
ref|WP_014255453.1|  ribonuclease J [                                   150   3e-39    
ref|WP_018774464.1|  MULTISPECIES: ribonuclease                         150   3e-39    
ref|WP_018085723.1|  ribonuclease J                                     150   3e-39    
gb|EEW49517.1|  hypothetical protein HMPREF0290_1895                    150   3e-39    
ref|WP_013297748.1|  ribonuclease J                                     150   3e-39    
ref|WP_019191580.1|  ribonuclease J                                     150   3e-39    
ref|WP_026388559.1|  ribonuclease J                                     150   4e-39    
ref|WP_017209111.1|  ribonuclease J                                     150   4e-39    
ref|WP_011878153.1|  ribonuclease J                                     150   4e-39    
ref|WP_022097852.1|  hypothetical protein                               150   4e-39    
ref|WP_008678274.1|  ribonuclease J                                     150   4e-39    
ref|WP_014553175.1|  ribonuclease J                                     150   4e-39    
ref|WP_042501474.1|  ribonuclease J                                     150   4e-39    
ref|WP_015311511.1|  hypothetical protein                               150   4e-39    
ref|WP_011195685.1|  ribonuclease J                                     150   4e-39    
ref|WP_015359290.1|  ribonuclease J 1 [                                 150   4e-39    
ref|WP_041746568.1|  ribonuclease J [                                   150   4e-39    
ref|WP_034843718.1|  ribonuclease J [                                   150   4e-39    
ref|WP_026446432.1|  ribonuclease J                                     150   4e-39    
ref|WP_019174880.1|  ribonuclease                                       150   5e-39    
ref|WP_021997816.1|  beta-lactamase domain protein                      150   5e-39    
gb|AGA69866.1|  LOW QUALITY PROTEIN: hypothetical protein Desdi_2442    150   5e-39    
ref|WP_011014791.1|  ribonuclease J                                     151   5e-39    
ref|WP_003857476.1|  MULTISPECIES: ribonuclease J                       151   5e-39    
ref|WP_040967540.1|  ribonuclease J                                     151   5e-39    
ref|WP_039740121.1|  ribonuclease J                                     150   5e-39    
ref|WP_022746403.1|  ribonuclease J 1                                   150   5e-39    
ref|WP_034145695.1|  ribonuclease J                                     150   5e-39    
ref|WP_026072180.1|  ribonuclease J                                     150   5e-39    
ref|WP_007063583.1|  ribonuclease J                                     150   5e-39    
ref|WP_034376707.1|  ribonuclease J                                     150   5e-39    
ref|WP_043487108.1|  hypothetical protein                               150   6e-39    
ref|WP_014367221.1|  ribonuclease J                                     150   6e-39    
ref|WP_022342513.1|  beta-lactamase domain protein                      150   6e-39    
ref|WP_011897391.1|  ribonuclease J                                     151   6e-39    
ref|WP_024047933.1|  Metallo-beta-lactamase family protein              146   6e-39    
ref|WP_012881709.1|  ribonuclease J                                     150   6e-39    
ref|WP_022176657.1|  ribonuclease J                                     150   6e-39    
ref|WP_012984193.1|  ribonuclease J                                     150   6e-39    
ref|WP_022368757.1|  metallo-beta-lactamase family protein              150   6e-39    
ref|WP_010936215.1|  ribonuclease J                                     150   6e-39    
ref|WP_013242122.1|  ribonuclease J                                     150   6e-39    
ref|WP_012235244.1|  hypothetical protein                               150   6e-39    
ref|WP_041341370.1|  ribonuclease J                                     150   6e-39    
ref|WP_027626261.1|  ribonuclease J                                     150   6e-39    
ref|WP_011968449.1|  MULTISPECIES: ribonuclease J                       150   6e-39    
ref|WP_032119619.1|  ribonuclease J                                     150   6e-39    
gb|AJC14005.1|  Ribonuclease j Rv2752c                                  150   6e-39    
gb|EKD57039.1|  hypothetical protein ACD_58C00017G0005                  150   6e-39    
ref|WP_014300762.1|  ribonuclease J                                     150   7e-39    
ref|WP_022211656.1|  uncharacterized protein                            150   7e-39    
ref|WP_011308960.1|  ribonuclease J                                     150   7e-39    
ref|WP_014523406.1|  ribonuclease J                                     150   7e-39    
ref|WP_022264722.1|  uncharacterized protein                            150   7e-39    
ref|WP_038673121.1|  ribonuclease J                                     149   7e-39    
ref|WP_024038910.1|  Beta-lactamase protein                             149   7e-39    
ref|WP_026347302.1|  ribonuclease J [                                   149   7e-39    
ref|WP_011075647.1|  ribonuclease J                                     150   7e-39    
ref|WP_015944632.1|  ribonuclease J                                     149   8e-39    
ref|WP_009603683.1|  beta-lactamase                                     149   8e-39    
ref|WP_022363702.1|  predicted hydrolase of the metallo-beta-lact...    150   8e-39    
ref|WP_032077728.1|  ribonuclease J                                     149   8e-39    
ref|WP_022383046.1|  hypothetical protein                               149   8e-39    
ref|WP_014525921.1|  ribonuclease J                                     150   8e-39    
ref|WP_028254417.1|  ribonuclease J                                     149   8e-39    
ref|WP_021429876.1|  hypothetical protein [                             149   8e-39    
ref|WP_022842172.1|  ribonuclease J                                     149   8e-39    
ref|WP_014836513.1|  ribonuclease J                                     150   8e-39    
ref|WP_014758831.1|  MULTISPECIES: ribonuclease J                       149   9e-39    
ref|WP_013787921.1|  ribonuclease J                                     149   9e-39    
ref|WP_015407585.1|  beta-lactamase domain-containing protein           149   9e-39    
ref|WP_021735558.1|  metallo-beta-lactamase domain protein              145   9e-39    
ref|WP_035774828.1|  ribonuclease J                                     149   9e-39    
ref|WP_023635875.1|  ribonuclease J                                     150   9e-39    
ref|WP_003409977.1|  ribonuclease J                                     149   9e-39    
gb|EET86726.1|  beta-lactamase domain protein                           149   9e-39    
ref|WP_012731758.1|  ribonuclease J                                     150   1e-38    
ref|WP_013911733.1|  ribonuclease J                                     150   1e-38    
ref|WP_035781355.1|  ribonuclease J                                     149   1e-38    
ref|WP_017825609.1|  ribonuclease J                                     149   1e-38    
ref|WP_044038846.1|  ribonuclease J                                     149   1e-38    
ref|WP_022127229.1|  rNA-metabolising metallo-beta-lactamase            150   1e-38    
ref|WP_002579542.1|  hypothetical protein                               149   1e-38    
ref|WP_035114362.1|  ribonuclease J                                     149   1e-38    
ref|WP_026736967.1|  ribonuclease J                                     149   1e-38    
ref|WP_006808345.1|  ribonuclease J                                     149   1e-38    
ref|WP_022695493.1|  beta-lactamase                                     149   1e-38    
ref|WP_024038453.1|  hypothetical protein                               149   1e-38    
gb|EKP93622.1|  hypothetical protein ThesuDRAFT_00216                   149   1e-38    
ref|WP_034811709.1|  ribonuclease J [                                   149   1e-38    
ref|WP_011025575.1|  ribonuclease J                                     149   1e-38    
ref|WP_022588214.1|  ribonuclease J                                     149   1e-38    
ref|WP_022167783.1|  beta-lactamase domain protein                      149   1e-38    
ref|WP_011640679.1|  ribonuclease J                                     149   1e-38    
ref|WP_007285959.1|  ribonuclease J                                     149   1e-38    
ref|WP_017209348.1|  ribonuclease J                                     149   1e-38    
ref|WP_041894896.1|  ribonuclease J                                     149   1e-38    
ref|WP_023651985.1|  metallo-beta-lactamase                             149   1e-38    
ref|WP_040827805.1|  ribonuclease J                                     149   1e-38    
ref|WP_022211737.1|  beta-lactamase domain protein                      149   1e-38    
ref|WP_039315662.1|  ribonuclease J                                     149   1e-38    
ref|WP_027012113.1|  ribonuclease J                                     149   1e-38    
ref|WP_007779954.1|  ribonuclease J                                     149   1e-38    
ref|WP_040099806.1|  ribonuclease J                                     149   1e-38    
ref|WP_010292899.1|  ribonuclease J                                     149   1e-38    
ref|WP_026942084.1|  beta-lactamase                                     149   1e-38    
ref|WP_034601061.1|  ribonuclease J                                     149   1e-38    
ref|WP_021956524.1|  uncharacterized protein                            149   1e-38    
ref|WP_018211211.1|  ribonuclease J                                     149   1e-38    
ref|WP_026900525.1|  ribonuclease J                                     149   2e-38    
ref|WP_040770927.1|  ribonuclease J                                     149   2e-38    
ref|WP_003441978.1|  metal-dependent hydrolase of metallo-beta-la...    149   2e-38    
ref|WP_028576826.1|  ribonuclease J                                     149   2e-38    
ref|WP_021911816.1|  uncharacterized protein                            149   2e-38    
ref|WP_038670747.1|  ribonuclease J                                     148   2e-38    
ref|WP_035213816.1|  ribonuclease J                                     148   2e-38    
ref|WP_012424345.1|  ribonuclease J                                     148   2e-38    
ref|WP_013489390.1|  ribonuclease J                                     148   2e-38    
ref|WP_035587339.1|  ribonuclease J                                     148   2e-38    
ref|WP_022028412.1|  hypothetical protein                               149   2e-38    
ref|WP_015613983.1|  hypothetical protein                               148   2e-38    
ref|WP_035787443.1|  ribonuclease J                                     148   2e-38    
ref|WP_036766784.1|  ribonuclease J                                     148   2e-38    
ref|WP_027830538.1|  beta-lactamase                                     147   2e-38    
gb|EJP19180.1|  hypothetical protein HMPREF1142_1613                    148   2e-38    
ref|WP_044352249.1|  beta-lactamase                                     145   2e-38    
gb|EHL07559.1|  hypothetical protein HMPREF0322_01676                   148   2e-38    
ref|WP_040001877.1|  ribonuclease J [                                   148   2e-38    
ref|WP_005366875.1|  ribonuclease J [                                   148   2e-38    
ref|WP_035058373.1|  ribonuclease J                                     148   3e-38    
ref|WP_041220304.1|  ribonuclease J                                     148   3e-38    
ref|WP_007956434.1|  ribonuclease J                                     148   3e-38    
ref|WP_028509602.1|  ribonuclease J                                     148   3e-38    
ref|WP_010295532.1|  ribonuclease J                                     148   3e-38    
ref|WP_040330758.1|  ribonuclease J                                     148   3e-38    
gb|ADJ25537.1|  RNA-metabolising metallo-beta-lactamase                 148   3e-38    
ref|WP_018306754.1|  ribonuclease J                                     148   3e-38    
ref|WP_003371907.1|  ribonuclease J                                     148   3e-38    
ref|WP_011460280.1|  ribonuclease J                                     148   3e-38    
ref|WP_016322464.1|  ribonuclease J                                     148   3e-38    
ref|WP_027437824.1|  ribonuclease J                                     148   3e-38    
ref|WP_022250599.1|  hypothetical protein                               148   3e-38    
ref|WP_017750709.1|  ribonuclease J                                     148   3e-38    
ref|WP_028271952.1|  ribonuclease                                       148   3e-38    
ref|WP_040335472.1|  ribonuclease J                                     148   3e-38    
ref|WP_007953139.1|  ribonuclease J                                     148   3e-38    
ref|WP_007936343.1|  MULTISPECIES: ribonuclease J                       148   3e-38    
ref|WP_027190382.1|  ribonuclease J                                     148   3e-38    
ref|WP_026674228.1|  Zn-dependent hydrolase                             148   3e-38    
ref|WP_032118077.1|  ribonuclease J                                     148   3e-38    
ref|WP_040199157.1|  ribonuclease J                                     148   3e-38    
ref|WP_039217263.1|  MULTISPECIES: ribonuclease J                       148   3e-38    
ref|WP_022169304.1|  uncharacterized protein                            148   3e-38    
gb|ADU51150.1|  RNA-metabolising metallo-beta-lactamase                 148   3e-38    
ref|WP_024614562.1|  ribonuclease J                                     148   3e-38    
ref|WP_017894710.1|  ribonuclease J                                     148   3e-38    
ref|WP_044030039.1|  ribonuclease J                                     149   3e-38    
ref|WP_013237885.1|  MULTISPECIES: ribonuclease J                       148   3e-38    
ref|WP_007070683.1|  beta-lactamase                                     148   3e-38    
ref|WP_022027604.1|  metallo-beta-lactamase family protein              148   3e-38    
ref|WP_034440115.1|  ribonuclease J                                     148   3e-38    
gb|KFC52388.1|  ribonuclease                                            148   3e-38    
ref|WP_035161240.1|  ribonuclease J                                     148   3e-38    
ref|WP_028506272.1|  ribonuclease J                                     147   3e-38    
gb|EQF96115.1|  metallo-beta-lactamase superfamily protein              145   3e-38    
gb|EHI58103.1|  hypothetical protein HMPREF9473_03867 [ [               147   3e-38    
ref|WP_008424953.1|  hypothetical protein                               147   3e-38    
ref|WP_042395407.1|  ribonuclease J                                     147   4e-38    
ref|WP_042435139.1|  beta-lactamase                                     147   4e-38    
ref|WP_022290509.1|  ribonuclease J                                     147   4e-38    
ref|WP_015774543.1|  ribonuclease J                                     147   4e-38    
ref|WP_021432184.1|  hypothetical protein [                             147   4e-38    
ref|WP_018704435.1|  MULTISPECIES: ribonuclease J                       147   4e-38    
ref|WP_023975115.1|  ribonuclease J                                     147   4e-38    
ref|WP_011691314.1|  MULTISPECIES: ribonuclease                         147   4e-38    
ref|WP_009616298.1|  ribonuclease J                                     147   4e-38    
ref|WP_034859832.1|  ribonuclease J [                                   147   4e-38    
ref|WP_040086051.1|  ribonuclease J                                     148   5e-38    
ref|WP_003490503.1|  MULTISPECIES: ribonuclease J                       147   5e-38    
gb|EQF53802.1|  metallo-beta-lactamase superfamily protein              144   5e-38    
ref|WP_039773697.1|  ribonuclease J                                     147   5e-38    
ref|WP_027020021.1|  ribonuclease J                                     148   5e-38    
ref|WP_014967490.1|  ribonuclease J                                     147   5e-38    
ref|WP_015936667.1|  ribonuclease                                       147   5e-38    
ref|WP_036337644.1|  MULTISPECIES: ribonuclease                         147   5e-38    
ref|WP_022072679.1|  uncharacterized protein                            147   5e-38    
ref|WP_003376966.1|  MULTISPECIES: ribonuclease J                       147   5e-38    
ref|WP_036315017.1|  ribonuclease                                       147   5e-38    
ref|WP_002856517.1|  MULTISPECIES: ribonuclease                         147   6e-38    
ref|WP_041704359.1|  ribonuclease J                                     147   6e-38    
dbj|GAK44554.1|  beta-lactamase domain-containing protein               147   6e-38    
ref|WP_036384225.1|  ribonuclease                                       147   6e-38    
ref|WP_028075504.1|  ribonuclease J                                     147   6e-38    
ref|WP_030034478.1|  ribonuclease J                                     147   6e-38    
ref|WP_034438241.1|  ribonuclease J                                     147   6e-38    
ref|WP_010079115.1|  ribonuclease                                       147   6e-38    
gb|EKU78640.1|  hypothetical protein HMPREF9282_00437                   148   6e-38    
ref|WP_006235967.1|  MULTISPECIES: beta-lactamase                       147   6e-38    
ref|WP_022094702.1|  uncharacterized protein                            147   6e-38    
ref|WP_013301375.1|  beta-lactamase                                     147   6e-38    
ref|WP_015739648.1|  ribonuclease J                                     147   6e-38    
ref|WP_027294070.1|  MULTISPECIES: ribonuclease J                       147   7e-38    
ref|WP_014901954.1|  ribonuclease J                                     147   7e-38    
ref|WP_043055072.1|  ribonuclease                                       147   7e-38    
ref|WP_039631423.1|  ribonuclease J                                     147   7e-38    
ref|WP_028245119.1|  ribonuclease                                       147   7e-38    
ref|WP_040379008.1|  ribonuclease J                                     147   7e-38    
ref|WP_003399457.1|  ribonuclease J                                     147   7e-38    
emb|CBZ03179.1|  Zn-dependent hydrolase, RNA-metabolising, CPSF 1...    147   7e-38    
ref|WP_035299934.1|  ribonuclease J                                     147   7e-38    
ref|WP_003356477.1|  ribonuclease J                                     147   7e-38    
ref|WP_029504692.1|  ribonuclease J                                     147   8e-38    



>ref|XP_011073026.1| PREDICTED: uncharacterized protein LOC105158090 isoform X2 [Sesamum 
indicum]
Length=857

 Score =   350 bits (897),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRRRF AGPFEVEPIRVTHSIPDC GLV RC  GTI HT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRRFVAGPFEVEPIRVTHSIPDCSGLVFRCADGTIFHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_011073024.1| PREDICTED: uncharacterized protein LOC105158090 isoform X1 [Sesamum 
indicum]
Length=878

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRRRF AGPFEVEPIRVTHSIPDC GLV RC  GTI HT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRRFVAGPFEVEPIRVTHSIPDCSGLVFRCADGTIFHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_010319061.1| PREDICTED: uncharacterized protein LOC101264202 isoform X4 [Solanum 
lycopersicum]
Length=747

 Score =   345 bits (884),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDEPGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLR ISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRRISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_008811803.1| PREDICTED: uncharacterized protein LOC103722876 isoform X3 [Phoenix 
dactylifera]
Length=701

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PD  FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDEFGVQKIVPDITFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLK+FK R++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIKKRLKEFGIFVPSRLKLFKIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGR++SE VVAD+LLRHISA
Sbjct  235  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRSVSEAVVADALLRHISA  294

Query  26   ATGRIIA  6
            A GR+IA
Sbjct  295  AKGRVIA  301



>ref|XP_006581877.1| PREDICTED: uncharacterized protein LOC100779771 isoform X2 [Glycine 
max]
Length=855

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA+IITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPALDSNTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LIKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_009595697.1| PREDICTED: uncharacterized protein LOC104091946 isoform X2 [Nicotiana 
tomentosiformis]
Length=851

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            Y++LGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  113  YEDLGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  173  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA
Sbjct  233  GDWKIDESPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  292

Query  26   ATGRII  9
            A GRII
Sbjct  293  AKGRII  298



>ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51809.1| conserved hypothetical protein [Ricinus communis]
Length=880

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAVIITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  115  YDELGVQKIIPDTTFIKRWSHKIEAVIITHGHEDHIGALPWVIPALDSRTPIYASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IF+PSRLKVF+TR++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIKKRLKEHGIFLPSRLKVFRTRKKFIAGPFEVEPIRVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVADSLLRHISA
Sbjct  235  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADSLLRHISA  294

Query  26   ATGRII  9
            A GRII
Sbjct  295  AKGRII  300



>ref|XP_009595689.1| PREDICTED: uncharacterized protein LOC104091946 isoform X1 [Nicotiana 
tomentosiformis]
Length=880

 Score =   347 bits (889),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            Y++LGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  113  YEDLGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  173  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA
Sbjct  233  GDWKIDESPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  292

Query  26   ATGRII  9
            A GRII
Sbjct  293  AKGRII  298



>ref|XP_002279798.1| PREDICTED: uncharacterized protein LOC100268000 isoform X1 [Vitis 
vinifera]
Length=886

 Score =   346 bits (888),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLV+RC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFRTRKKFIAGPFEIEPIRVTHSIPDCCGLVIRCADGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHIS+
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISS  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_006581876.1| PREDICTED: uncharacterized protein LOC100779771 isoform X1 [Glycine 
max]
Length=884

 Score =   346 bits (888),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA+IITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPALDSNTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LIKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_009774848.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104224837 
[Nicotiana sylvestris]
Length=880

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            Y++LGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  113  YEDLGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  173  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA
Sbjct  233  GDWKIDESPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  292

Query  26   ATGRII  9
            A GR+I
Sbjct  293  AKGRVI  298



>gb|KHN23276.1| Ribonuclease J [Glycine soja]
Length=884

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA+IITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  114  YDELGVQKIIPDTTFIRKWSHKIEALIITHGHEDHIGALPWVIPALDSNTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LIKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_006578697.1| PREDICTED: uncharacterized protein LOC100783850 isoform X2 [Glycine 
max]
Length=886

 Score =   346 bits (887),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIFASSFTLE
Sbjct  114  YDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFASSFTLE  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+KKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LMKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_010319060.1| PREDICTED: uncharacterized protein LOC101264202 isoform X3 [Solanum 
lycopersicum]
Length=851

 Score =   345 bits (884),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDEPGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLR ISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRRISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_003522430.1| PREDICTED: uncharacterized protein LOC100783850 isoform X1 [Glycine 
max]
Length=888

 Score =   345 bits (886),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIFASSFTLE
Sbjct  116  YDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFASSFTLE  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+KKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  176  LMKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  236  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  295

Query  26   ATGRII  9
            + GR+I
Sbjct  296  SKGRVI  301



>ref|XP_010319059.1| PREDICTED: uncharacterized protein LOC101264202 isoform X2 [Solanum 
lycopersicum]
Length=852

 Score =   345 bits (884),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDEPGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLR ISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRRISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_010319058.1| PREDICTED: uncharacterized protein LOC101264202 isoform X1 [Solanum 
lycopersicum]
Length=881

 Score =   345 bits (885),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDEPGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLR ISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRRISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>gb|KHN31905.1| Ribonuclease J [Glycine soja]
Length=888

 Score =   345 bits (886),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIFASSFTLE
Sbjct  116  YDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFASSFTLE  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+KKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  176  LMKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  236  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  295

Query  26   ATGRII  9
            + GR+I
Sbjct  296  SKGRVI  301



>ref|XP_010250772.1| PREDICTED: uncharacterized protein LOC104592923 isoform X2 [Nelumbo 
nucifera]
Length=886

 Score =   344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  113  YDELGVQKIIPDTAFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLK+F+TR++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKEFGIFVPSRLKMFRTRKKFIAGPFEVEPIRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+LLRHISA
Sbjct  233  GDWKIDESPLDGKTFDREALEELSKEGVTLMMSDSTNVLSPGRTISEAVVADALLRHISA  292

Query  26   ATGRII  9
            A GR+I
Sbjct  293  AKGRVI  298



>ref|XP_006351477.1| PREDICTED: uncharacterized protein LOC102586834 [Solanum tuberosum]
Length=852

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  114  YDEPGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHSIPDC G+VLRC  GTILHT
Sbjct  174  LIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHSIPDCSGIVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLR ISA
Sbjct  234  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRLISA  293

Query  26   ATGRII  9
            A GR+I
Sbjct  294  AKGRVI  299



>ref|XP_010250771.1| PREDICTED: uncharacterized protein LOC104592923 isoform X1 [Nelumbo 
nucifera]
Length=887

 Score =   344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  113  YDELGVQKIIPDTAFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLK+F+TR++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKEFGIFVPSRLKMFRTRKKFIAGPFEVEPIRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+LLRHISA
Sbjct  233  GDWKIDESPLDGKTFDREALEELSKEGVTLMMSDSTNVLSPGRTISEAVVADALLRHISA  292

Query  26   ATGRII  9
            A GR+I
Sbjct  293  AKGRVI  298



>emb|CDP10033.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   343 bits (881),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALD+ TPIFASSFT+E
Sbjct  125  YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDARTPIFASSFTME  184

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+PSRLK+FKT+ RF AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  185  LIKKRLKEFGIFIPSRLKIFKTKMRFVAGPFEVEPIRVTHSIPDCCGLVLRCADGTILHT  244

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDR ALEELSKEGVTLMMSDSTNVLSPGRTLSETVVAD+LLR ISA
Sbjct  245  GDWKIDETPLDGKVFDRGALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADALLRRISA  304

Query  26   ATGRII  9
            A GR+I
Sbjct  305  AKGRVI  310



>ref|XP_008811801.1| PREDICTED: uncharacterized protein LOC103722876 isoform X1 [Phoenix 
dactylifera]
Length=889

 Score =   343 bits (881),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PD  FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDEFGVQKIVPDITFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLK+FK R++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIKKRLKEFGIFVPSRLKLFKIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGR++SE VVAD+LLRHISA
Sbjct  235  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRSVSEAVVADALLRHISA  294

Query  26   ATGRIIA  6
            A GR+IA
Sbjct  295  AKGRVIA  301



>ref|XP_010105237.1| Ribonuclease J [Morus notabilis]
 gb|EXC04124.1| Ribonuclease J [Morus notabilis]
Length=872

 Score =   343 bits (879),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  139  YDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSKTPIFASSFTME  198

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+T+R+F AGPFE+EPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  199  LIKKRLKENGIFVPSRLKVFRTKRKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTIFHT  258

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRT+SE+VVADSL+RHISA
Sbjct  259  GDWKIDESPLDGKVFDRETLEELSKEGVTLMMSDSTNVLSPGRTMSESVVADSLMRHISA  318

Query  26   ATGRII  9
            A GR+I
Sbjct  319  AKGRVI  324



>gb|EPS67461.1| hypothetical protein M569_07313, partial [Genlisea aurea]
Length=815

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  116  YDELGVQKIIPDTTFIQKWSHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTVE  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVF+ R+RF AGPFEVEPIRVTHSIPDC GLV RC  GTILHT
Sbjct  176  LIKKRLKEFGIFVPSRLKVFRIRKRFVAGPFEVEPIRVTHSIPDCSGLVFRCADGTILHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSE VVA+SLLRHISA
Sbjct  236  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSEKVVAESLLRHISA  295

Query  26   ATGRII  9
            + GR+I
Sbjct  296  SKGRVI  301



>ref|XP_006477010.1| PREDICTED: uncharacterized protein LOC102606767 isoform X1 [Citrus 
sinensis]
Length=912

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS+TPI+ASSFT+E
Sbjct  145  YDELGVQKITPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSNTPIYASSFTME  204

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLKE  IFVPSRLK FKTRR+F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  205  LIRKRLKENGIFVPSRLKTFKTRRKFMAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  264

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE+VV D+L+RH+SA
Sbjct  265  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESVVKDALMRHVSA  324

Query  26   ATGRII  9
            A GR+I
Sbjct  325  AKGRVI  330



>ref|XP_007137930.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
 gb|ESW09924.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
Length=871

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIF+SSFT E
Sbjct  113  YDELGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFSSSFTKE  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI KRLKE  IFVPSRLKVF+ R++F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LINKRLKEHGIFVPSRLKVFRMRKKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISA
Sbjct  233  GDWKIDETPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISA  292

Query  26   ATGRII  9
            + GR+I
Sbjct  293  SNGRVI  298



>gb|EMS68688.1| Ribonuclease J [Triticum urartu]
Length=369

 Score =   325 bits (833),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  116  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLK F+ R RF AGPFEVEPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  176  LIKKRLKEFGIFLSSRLKSFRVRNRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGTIFHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTN+LSPGR+ SE+VVA SLLRH+S 
Sbjct  236  GDWKIDESPVDGRIFDREALEELSKEGVTLMMSDSTNILSPGRSTSESVVASSLLRHVSE  295

Query  26   ATGR  15
            A GR
Sbjct  296  AKGR  299



>ref|XP_006827615.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
 gb|ERM95031.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
Length=866

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  117  YDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  176

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEFSIFVPSRLK+FK R+RF AGPFEVEPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  177  LIKKRLKEFSIFVPSRLKLFKIRKRFNAGPFEVEPIRVTHSIPDCCGLVLRCADGTIFHT  236

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG +FDR+ALEEL+KEGVTLMMSDSTNVLSPGR++SE VV D+LLR+I+A
Sbjct  237  GDWKIDESPLDGKIFDRQALEELAKEGVTLMMSDSTNVLSPGRSMSEAVVKDALLRNITA  296

Query  26   ATGRII  9
            A GR+I
Sbjct  297  AQGRVI  302



>ref|XP_002318122.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
 gb|EEE96342.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
Length=916

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI +W HKIEAVIITHGHEDHIGALPWV+PALD +TPI+ASSFT+E
Sbjct  143  YDELGVQKIIPDTTFIRRWKHKIEAVIITHGHEDHIGALPWVVPALDHNTPIYASSFTME  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFKT+R+FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  203  LIKKRLKENGIFVPSRLKVFKTKRKFTAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  263  GDWKIDESPLDGKVFDRETLEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  322

Query  26   ATGRII  9
            A GRII
Sbjct  323  AKGRII  328



>ref|XP_006440090.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
 gb|ESR53330.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
Length=912

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS+TPI+ASSFT+E
Sbjct  145  YDELGVQKITPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSNTPIYASSFTME  204

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLKE  IFVPSRLK FKTRR+F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  205  LIRKRLKENGIFVPSRLKTFKTRRKFMAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  264

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLS GRT SE+VV D+L+RH+SA
Sbjct  265  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSSGRTTSESVVKDALMRHVSA  324

Query  26   ATGRII  9
            A GR+I
Sbjct  325  AKGRVI  330



>ref|XP_011044175.1| PREDICTED: uncharacterized protein LOC105139443 isoform X1 [Populus 
euphratica]
Length=914

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELG  KI PDT FI +W HKIEAVIITHGHEDHIGALPWV+PALD +TPI+ASSFT+E
Sbjct  143  YDELGFQKIIPDTTFIRRWKHKIEAVIITHGHEDHIGALPWVVPALDHNTPIYASSFTME  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFKT+R+FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  203  LIKKRLKENGIFVPSRLKVFKTKRKFTAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRTLSE+VVAD+LLR ISA
Sbjct  263  GDWKIDESPLDGKVFDRETLEELSKEGVTLMMSDSTNVLSPGRTLSESVVADALLRRISA  322

Query  26   ATGRII  9
            A GRII
Sbjct  323  AKGRII  328



>dbj|BAD28842.1| putative metallo beta subunit lactamase [Oryza sativa Japonica 
Group]
Length=506

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  117  FDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSSTPIFASSFTME  176

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKEF IF+ SRLKVF+ R+RF AGPFEVEP+RVTHSIPDCCGLVLRC  G I HT
Sbjct  177  LIKRRLKEFGIFLSSRLKVFRVRKRFQAGPFEVEPLRVTHSIPDCCGLVLRCADGIIFHT  236

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  237  GDWKIDESPVDGKIFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  296

Query  26   ATGRII  9
            A GR+I
Sbjct  297  AKGRVI  302



>ref|XP_011024044.1| PREDICTED: uncharacterized protein LOC105125338 [Populus euphratica]
Length=890

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI +W HKIEAVIITHGHEDHIGALPWVIPALD  TPI+ASSFT+E
Sbjct  118  YDELGVQKIIPDTTFIRRWRHKIEAVIITHGHEDHIGALPWVIPALDHHTPIYASSFTME  177

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFKT+R+F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  178  LIKKRLKENGIFVPSRLKVFKTKRKFAAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  237

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRTLSE+VVAD+LLR ISA
Sbjct  238  GDWKIDESPLDGKVFDRETLEELSKEGVTLMMSDSTNVLSPGRTLSESVVADALLRRISA  297

Query  26   ATGRII  9
            A GRII
Sbjct  298  AKGRII  303



>gb|AES72341.2| RNA-metabolising metallo-beta-lactamase [Medicago truncatula]
Length=867

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+LGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  114  YDDLGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IF+PSRLK+F+T+ +F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LIKKRLKEHGIFLPSRLKIFRTKNKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRT SE+VVADSLLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTTSESVVADSLLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_009346516.1| PREDICTED: uncharacterized protein LOC103938240 [Pyrus x bretschneideri]
Length=920

 Score =   339 bits (869),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD DTPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDLDTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LLRHISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALLRHISA  317

Query  26   ATGRII  9
            A GRII
Sbjct  318  AKGRII  323



>emb|CBI15641.3| unnamed protein product [Vitis vinifera]
Length=1659

 Score =   347 bits (889),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -1

Query  566   YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
             YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  887   YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  946

Query  386   LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
             LIKKRLKEF IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLV+RC  GTILHT
Sbjct  947   LIKKRLKEFGIFVPSRLKVFRTRKKFIAGPFEIEPIRVTHSIPDCCGLVIRCADGTILHT  1006

Query  206   GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
             GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHIS+
Sbjct  1007  GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISS  1066

Query  26    ATGRII  9
             A GR+I
Sbjct  1067  AKGRVI  1072



>emb|CAN81787.1| hypothetical protein VITISV_026006 [Vitis vinifera]
Length=1616

 Score =   346 bits (888),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -1

Query  566   YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
             YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  876   YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  935

Query  386   LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
             LIKKRLKEF IFVPSRLKVF+TR++F AGPFE+EPIRVTHSIPDCCGLV+RC  GTILHT
Sbjct  936   LIKKRLKEFGIFVPSRLKVFRTRKKFIAGPFEIEPIRVTHSIPDCCGLVIRCADGTILHT  995

Query  206   GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
             GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHIS+
Sbjct  996   GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISESVVADALLRHISS  1055

Query  26    ATGRII  9
             A GR+I
Sbjct  1056  AKGRVI  1061



>ref|XP_008374252.1| PREDICTED: uncharacterized protein LOC103437549 isoform X1 [Malus 
domestica]
Length=917

 Score =   338 bits (868),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD DTPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDLDTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LLRHISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALLRHISA  317

Query  26   ATGRII  9
            A GR+I
Sbjct  318  AKGRVI  323



>gb|AES91056.2| RNA-metabolising metallo-beta-lactamase [Medicago truncatula]
Length=721

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            DELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIP LDS TP+FASSFT+EL
Sbjct  119  DELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPMLDSQTPVFASSFTMEL  178

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+KRLK+  IFVPSRLKVF+TR++F AGPFE+EPI V+HSIPDCCGLVLRC  GTILHTG
Sbjct  179  IRKRLKDHGIFVPSRLKVFRTRKKFVAGPFEIEPITVSHSIPDCCGLVLRCSDGTILHTG  238

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            DWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISAA
Sbjct  239  DWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTMSESVVADALLRHISAA  298

Query  23   TGRII  9
             GR+I
Sbjct  299  KGRVI  303



>gb|KHN14093.1| Ribonuclease J [Glycine soja]
Length=810

 Score =   336 bits (861),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KW HKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  57   YDELGVQKIIPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  116

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLK+  IFVPSRLKVF+TR++F AGPFEVEPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  117  LIRKRLKDHGIFVPSRLKVFRTRKKFMAGPFEVEPITVTHSIPDCCGLVLRCSDGTILHT  176

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE+VVAD+LLR+ISA
Sbjct  177  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESVVADALLRNISA  236

Query  26   ATGRII  9
            A GR+I
Sbjct  237  AKGRVI  242



>gb|KJB08022.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08023.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08024.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
Length=884

 Score =   337 bits (865),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALD  TPI+ASSFT+E
Sbjct  113  YDELGVQKITPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDPHTPIYASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R+RFTAGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKENGIFVPSRLKVFKMRKRFTAGPFEIEPLRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDGN+FDR+ LE+LSKEGVTLMMSDSTNVLSPGRT SE VVAD+LLRHIS 
Sbjct  233  GDWKIDESPLDGNIFDRQFLEDLSKEGVTLMMSDSTNVLSPGRTTSERVVADALLRHISN  292

Query  26   ATGRII  9
            A GRII
Sbjct  293  AKGRII  298



>ref|XP_009375227.1| PREDICTED: uncharacterized protein LOC103964064 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375236.1| PREDICTED: uncharacterized protein LOC103964071 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   338 bits (867),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD DTPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDLDTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LLRHISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALLRHISA  317

Query  26   ATGRII  9
            A GR+I
Sbjct  318  AKGRVI  323



>ref|XP_008464474.1| PREDICTED: uncharacterized protein LOC103502342 isoform X2 [Cucumis 
melo]
Length=909

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  136  HDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTVE  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R+RFTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIKKRLKENGIFVPSRLKVFKMRKRFTAGPFEIEPIRVTHSIPDCCGLVLRCTDGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  256  GDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AKGRVI  321



>ref|XP_008464473.1| PREDICTED: uncharacterized protein LOC103502342 isoform X1 [Cucumis 
melo]
Length=910

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  136  HDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTVE  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R+RFTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIKKRLKENGIFVPSRLKVFKMRKRFTAGPFEIEPIRVTHSIPDCCGLVLRCTDGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  256  GDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AKGRVI  321



>ref|XP_003608859.1| Ribonuclease J [Medicago truncatula]
Length=739

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            DELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIP LDS TP+FASSFT+EL
Sbjct  119  DELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPMLDSQTPVFASSFTMEL  178

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+KRLK+  IFVPSRLKVF+TR++F AGPFE+EPI V+HSIPDCCGLVLRC  GTILHTG
Sbjct  179  IRKRLKDHGIFVPSRLKVFRTRKKFVAGPFEIEPITVSHSIPDCCGLVLRCSDGTILHTG  238

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            DWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLRHISAA
Sbjct  239  DWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTMSESVVADALLRHISAA  298

Query  23   TGRII  9
             GR+I
Sbjct  299  KGRVI  303



>gb|KHG17441.1| Ribonuclease J [Gossypium arboreum]
Length=884

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALD  TPI+ASSFT+E
Sbjct  113  YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDPHTPIYASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R+RFTAGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKENGIFVPSRLKVFKMRKRFTAGPFEIEPLRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDGN+FDR+ LE+LSKEGVTLMMSDSTNVLSPGRT SE VVAD+LLRHIS 
Sbjct  233  GDWKIDESPLDGNIFDRQFLEDLSKEGVTLMMSDSTNVLSPGRTTSERVVADALLRHISN  292

Query  26   ATGRII  9
            A GRII
Sbjct  293  AKGRII  298



>ref|XP_003602090.1| Ribonuclease J [Medicago truncatula]
Length=959

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+LGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  114  YDDLGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  173

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IF+PSRLK+F+T+ +F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  174  LIKKRLKEHGIFLPSRLKIFRTKNKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  233

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRT SE+VVADSLLRHISA
Sbjct  234  GDWKIDETPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTTSESVVADSLLRHISA  293

Query  26   ATGRII  9
            + GR+I
Sbjct  294  SKGRVI  299



>ref|XP_007037950.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
 gb|EOY22451.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
Length=1004

 Score =   338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  232  YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTME  291

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK+FKTR+RF AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  292  LIKKRLKENGIFVPSRLKIFKTRKRFMAGPFEIEPLRVTHSIPDCCGLVLRCADGTILHT  351

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG +FDR+ LE+LSKEGVTLMMSDSTNVLSPGRT+SE+ VAD+LLRHISA
Sbjct  352  GDWKIDESPLDGKIFDRQFLEDLSKEGVTLMMSDSTNVLSPGRTISESSVADALLRHISA  411

Query  26   ATGRII  9
            A GRII
Sbjct  412  AKGRII  417



>gb|KDP30936.1| hypothetical protein JCGZ_11312 [Jatropha curcas]
Length=879

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KW HKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  113  YDELGVQKIIPDTTFIKKWRHKIEAVVITHGHEDHIGALPWVIPALDSCTPIYASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+ +++FTAGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKENGIFVPSRLKVFRAKKKFTAGPFEVEPIRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDR+ LEELSKEGVTLMMSDSTNVLSPGRT+SE+VVADSL+R IS 
Sbjct  233  GDWKIDESPLDGKVFDRQTLEELSKEGVTLMMSDSTNVLSPGRTISESVVADSLMRRISE  292

Query  26   ATGRII  9
            A GR+I
Sbjct  293  AKGRVI  298



>ref|XP_007210499.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11698.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD  TPIFASSFT+E
Sbjct  111  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDPRTPIFASSFTME  170

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK F+T+R+F AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  171  LIKKRLKEHGIFVPSRLKTFRTKRKFMAGPFEIEPVRVTHSIPDCCGLVLRCSDGTILHT  230

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SET VAD+LLRHISA
Sbjct  231  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSETSVADALLRHISA  290

Query  26   ATGRII  9
            A GR+I
Sbjct  291  AKGRVI  296



>ref|XP_008392826.1| PREDICTED: uncharacterized protein LOC103455013 isoform X1 [Malus 
domestica]
Length=917

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPVRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LL+HISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALLKHISA  317

Query  26   ATGRII  9
            A GR+I
Sbjct  318  AKGRVI  323



>ref|XP_007210498.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11697.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD  TPIFASSFT+E
Sbjct  111  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDPRTPIFASSFTME  170

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK F+T+R+F AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  171  LIKKRLKEHGIFVPSRLKTFRTKRKFMAGPFEIEPVRVTHSIPDCCGLVLRCSDGTILHT  230

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SET VAD+LLRHISA
Sbjct  231  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSETSVADALLRHISA  290

Query  26   ATGRII  9
            A GR+I
Sbjct  291  AKGRVI  296



>ref|XP_009359453.1| PREDICTED: uncharacterized protein LOC103950027 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPVRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LL+HISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALLKHISA  317

Query  26   ATGRII  9
            A GR+I
Sbjct  318  AKGRVI  323



>ref|XP_004161356.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease J-like [Cucumis 
sativus]
Length=909

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  136  HDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTVE  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R++FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIKKRLKENGIFVPSRLKVFKMRKKFTAGPFEIEPIRVTHSIPDCCGLVLRCTDGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  256  GDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AKGRVI  321



>ref|XP_004138055.1| PREDICTED: ribonuclease J-like [Cucumis sativus]
Length=909

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  136  HDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTVE  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R++FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIKKRLKENGIFVPSRLKVFKMRKKFTAGPFEIEPIRVTHSIPDCCGLVLRCTDGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  256  GDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AKGRVI  321



>gb|KGN63492.1| hypothetical protein Csa_1G002120 [Cucumis sativus]
Length=910

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  136  HDELGVQKIIPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTVE  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK R++FTAGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIKKRLKENGIFVPSRLKVFKMRKKFTAGPFEIEPIRVTHSIPDCCGLVLRCTDGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE+VVAD+LLR ISA
Sbjct  256  GDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSPGRTISESVVADALLRRISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AKGRVI  321



>ref|XP_010677898.1| PREDICTED: uncharacterized protein LOC104893494 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=886

 Score =   335 bits (860),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI++WSHKIEAVIITHGHEDHIGALPWVI ALD +TPIF+SSFT+E
Sbjct  113  YDEFGVQKIIPDTTFIKRWSHKIEAVIITHGHEDHIGALPWVIRALDPNTPIFSSSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLKVF+T+RRFTAGPFE+EP+RVTHSIPDCCGLV+RC  GTI HT
Sbjct  173  LIKKRLKEFGIFVPSRLKVFRTKRRFTAGPFEIEPVRVTHSIPDCCGLVMRCSDGTIFHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+P+DG  FDR ALEELSKEGVTLMMSDSTN++SPGRT+SE+VVAD+LLRHISA
Sbjct  233  GDWKIDETPVDGKAFDRVALEELSKEGVTLMMSDSTNIMSPGRTISESVVADALLRHISA  292

Query  26   ATGRII  9
            A GR+I
Sbjct  293  AKGRVI  298



>ref|XP_008239449.1| PREDICTED: uncharacterized protein LOC103338047 [Prunus mume]
Length=903

 Score =   335 bits (860),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI+KWSHKIEA++ITHGHEDHIGALPWVIPALD  TPIFASSFT+E
Sbjct  138  FDELGVQKIIPDTTFIKKWSHKIEAIVITHGHEDHIGALPWVIPALDPGTPIFASSFTME  197

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK F+T+R+F AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  198  LIKKRLKEHGIFVPSRLKTFRTKRKFMAGPFEIEPVRVTHSIPDCCGLVLRCSDGTILHT  257

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSPGRT SET VAD+LLRHISA
Sbjct  258  GDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSPGRTTSETSVADALLRHISA  317

Query  26   ATGRII  9
            A GR+I
Sbjct  318  AKGRVI  323



>ref|XP_006600800.1| PREDICTED: uncharacterized protein LOC100814619 isoform X1 [Glycine 
max]
Length=870

 Score =   335 bits (858),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KW HKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  116  YDELGVQKIIPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLK+  IFVPSRLKVF+TR++F AGPFEVEPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  176  LIRKRLKDHGIFVPSRLKVFRTRKKFMAGPFEVEPITVTHSIPDCCGLVLRCSDGTILHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE+VVAD+LLR+ISA
Sbjct  236  GDWKIDETPLDGRVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESVVADALLRNISA  295

Query  26   ATGRII  9
            A GR+I
Sbjct  296  AKGRVI  301



>ref|XP_004500652.1| PREDICTED: ribonuclease J-like isoform X1 [Cicer arietinum]
Length=863

 Score =   334 bits (857),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+LGV KI PDT FI KWSHKIEA++ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  110  YDDLGVQKIIPDTTFIRKWSHKIEALVITHGHEDHIGALPWVIPALDSSTPIFASSFTME  169

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IF+PSRLK+F+T+ +F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  170  LIKKRLKEHGIFLPSRLKIFRTKNKFVAGPFEIEPIRVTHSIPDCCGLVLRCSDGTILHT  229

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDRE LEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+LLRHISA
Sbjct  230  GDWKIDETPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSPGRTTSESAVADALLRHISA  289

Query  26   ATGRII  9
            + GR+I
Sbjct  290  SKGRVI  295



>ref|XP_002321691.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
 gb|EEF05818.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
Length=890

 Score =   335 bits (858),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI +W HKIEAVIITHGHEDHIGALPWVIPALD  TPI+ASSFT+E
Sbjct  118  YDELGVQKIIPDTTFIRRWRHKIEAVIITHGHEDHIGALPWVIPALDHHTPIYASSFTME  177

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFKT+R+F AGPFE+EPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  178  LIKKRLKENGIFVPSRLKVFKTKRKFAAGPFEIEPIRVTHSIPDCCGLVLRCADGTILHT  237

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDRE LEELSKEGVTLMMSDSTN+LSPGRT+SE+VVAD+LLR ISA
Sbjct  238  GDWKIDESPLDGKKFDRETLEELSKEGVTLMMSDSTNILSPGRTISESVVADALLRRISA  297

Query  26   ATGRII  9
            A GRII
Sbjct  298  AKGRII  303



>ref|XP_006600801.1| PREDICTED: uncharacterized protein LOC100814619 isoform X2 [Glycine 
max]
Length=869

 Score =   334 bits (857),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI KW HKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  116  YDELGVQKIIPDTTFIRKWKHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLK+  IFVPSRLKVF+TR++F AGPFEVEPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  176  LIRKRLKDHGIFVPSRLKVFRTRKKFMAGPFEVEPITVTHSIPDCCGLVLRCSDGTILHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE+VVAD+LLR+ISA
Sbjct  236  GDWKIDETPLDGRVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESVVADALLRNISA  295

Query  26   ATGRII  9
            A GR+I
Sbjct  296  AKGRVI  301



>ref|XP_010519514.1| PREDICTED: uncharacterized protein LOC104798948 isoform X1 [Tarenaya 
hassleriana]
Length=904

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI++W HKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  143  YDEPGVQKIIPDTTFIKRWRHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK FKTRR+F AGPFE+EPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  203  LIKKRLKENGIFVPSRLKTFKTRRKFMAGPFEIEPITVTHSIPDCCGLVLRCADGTILHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDR+ALEELSKEGVTLMMSDSTNVLSPGRT+SETVVAD+L+R+ISA
Sbjct  263  GDWKIDESPLDGKVFDRQALEELSKEGVTLMMSDSTNVLSPGRTISETVVADALIRNISA  322

Query  26   ATGRII  9
            A GR+I
Sbjct  323  AKGRVI  328



>gb|KCW83176.1| hypothetical protein EUGRSUZ_B00129 [Eucalyptus grandis]
Length=861

 Score =   334 bits (856),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE+GV KI PDT FI +WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  86   YDEIGVQKIIPDTTFIRRWSHKIEAVVITHGHEDHIGALPWVIPALDSRTPIFASSFTME  145

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+T+++F AGPFE+EP+ VTHSIPDCCGLVLRC  GTI HT
Sbjct  146  LIKKRLKENGIFVPSRLKVFRTKKKFMAGPFEIEPLTVTHSIPDCCGLVLRCGDGTIFHT  205

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDGNVFDRE+LE+L+KEGVTLMMSDSTNVLSPGRT SET VAD+LLRHIS 
Sbjct  206  GDWKIDESPLDGNVFDRESLEQLAKEGVTLMMSDSTNVLSPGRTTSETSVADALLRHIST  265

Query  26   ATGRII  9
            A GR+I
Sbjct  266  AKGRVI  271



>ref|XP_010045503.1| PREDICTED: uncharacterized protein LOC104434227 [Eucalyptus grandis]
Length=867

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE+GV KI PDT FI +WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  92   YDEIGVQKIIPDTTFIRRWSHKIEAVVITHGHEDHIGALPWVIPALDSRTPIFASSFTME  151

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVF+T+++F AGPFE+EP+ VTHSIPDCCGLVLRC  GTI HT
Sbjct  152  LIKKRLKENGIFVPSRLKVFRTKKKFMAGPFEIEPLTVTHSIPDCCGLVLRCGDGTIFHT  211

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDGNVFDRE+LE+L+KEGVTLMMSDSTNVLSPGRT SET VAD+LLRHIS 
Sbjct  212  GDWKIDESPLDGNVFDRESLEQLAKEGVTLMMSDSTNVLSPGRTTSETSVADALLRHIST  271

Query  26   ATGRII  9
            A GR+I
Sbjct  272  AKGRVI  277



>ref|XP_010519515.1| PREDICTED: uncharacterized protein LOC104798948 isoform X2 [Tarenaya 
hassleriana]
Length=904

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI++W HKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  143  YDEPGVQKIIPDTTFIKRWRHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLK FKTRR+F AGPFE+EPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  203  LIKKRLKENGIFVPSRLKTFKTRRKFMAGPFEIEPITVTHSIPDCCGLVLRCADGTILHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDR+ALEELSKEGVTLMMSDSTNVLSPGRT+SETVVAD+L+R+ISA
Sbjct  263  GDWKIDESPLDGKVFDRQALEELSKEGVTLMMSDSTNVLSPGRTISETVVADALIRNISA  322

Query  26   ATGRII  9
            A GR+I
Sbjct  323  AKGRVI  328



>gb|KHG13818.1| Ribonuclease J [Gossypium arboreum]
Length=790

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALDS TPI+ASSFT+E
Sbjct  57   YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIYASSFTME  116

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  I VPSRLKVFK RRRF AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  117  LIKKRLKENGILVPSRLKVFKIRRRFKAGPFEIEPLRVTHSIPDCCGLVLRCADGTILHT  176

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDR+ LEELSKEGVTLMMSDSTNVLSPGRT+SE+ VAD+L RHIS 
Sbjct  177  GDWKIDESPLDGKTFDRQFLEELSKEGVTLMMSDSTNVLSPGRTVSESAVADALSRHISG  236

Query  26   ATGRII  9
            A GRII
Sbjct  237  AKGRII  242



>ref|XP_010909137.1| PREDICTED: uncharacterized protein LOC105035311 isoform X2 [Elaeis 
guineensis]
Length=879

 Score =   334 bits (856),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI++WSHKIEAV+ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDEFGVQKIVPDTTFIKRWSHKIEAVVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFV SRL++F  R++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIKKRLKEFGIFVLSRLRLFTIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG +FDRE LE+LSKEGVTLMMSDSTNVLSPGR++SE VVAD+LLRHISA
Sbjct  235  GDWKIDESPLDGKIFDRETLEDLSKEGVTLMMSDSTNVLSPGRSVSEAVVADALLRHISA  294

Query  26   ATGRIIA  6
            A GR+IA
Sbjct  295  AKGRVIA  301



>ref|XP_007155529.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27523.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=869

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELG+ KI PDT FI KW HKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDELGIQKIIPDTTFIRKWRHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLK+  IFVPSRLKVF+TR++F AGPFE+EPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIRKRLKDHGIFVPSRLKVFRTRKKFMAGPFEIEPITVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE++VAD+LLR+ISA
Sbjct  235  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESIVADALLRNISA  294

Query  26   ATGRII  9
            A GR+I
Sbjct  295  AKGRVI  300



>ref|XP_007155530.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27524.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=870

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELG+ KI PDT FI KW HKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDELGIQKIIPDTTFIRKWRHKIEAVIITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLK+  IFVPSRLKVF+TR++F AGPFE+EPI VTHSIPDCCGLVLRC  GTILHT
Sbjct  175  LIRKRLKDHGIFVPSRLKVFRTRKKFMAGPFEIEPITVTHSIPDCCGLVLRCSDGTILHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE++VAD+LLR+ISA
Sbjct  235  GDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSESIVADALLRNISA  294

Query  26   ATGRII  9
            A GR+I
Sbjct  295  AKGRVI  300



>gb|KJB19806.1| hypothetical protein B456_003G119600 [Gossypium raimondii]
Length=860

 Score =   333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDELGV KI PDT FI+KWSHKIEAV+ITHGHEDHIGALPWVIPALD  TPI+ASSFT+E
Sbjct  113  YDELGVQKIIPDTTFIKKWSHKIEAVVITHGHEDHIGALPWVIPALDPHTPIYASSFTME  172

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFVPSRLKVFK RRRF AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  173  LIKKRLKENGIFVPSRLKVFKIRRRFKAGPFEIEPLRVTHSIPDCCGLVLRCADGTILHT  232

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDR+ LEELSKEGVTLMMSDSTNVLSPGRT+SE+ VAD+L RHIS 
Sbjct  233  GDWKIDESPLDGKTFDRQFLEELSKEGVTLMMSDSTNVLSPGRTISESAVADALSRHISG  292

Query  26   ATGRII  9
            A GRII
Sbjct  293  AKGRII  298



>ref|XP_010235506.1| PREDICTED: uncharacterized protein LOC100825739 isoform X1 [Brachypodium 
distachyon]
Length=875

 Score =   333 bits (854),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  121  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSNTPIFASSFTME  180

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLK F+ R RF AGPFEVEPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  181  LIKKRLKEFGIFLSSRLKSFRVRNRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGTIFHT  240

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTN+LSPGR+ SE+VVA SLLRHIS 
Sbjct  241  GDWKIDESPVDGKIFDREALEELSKEGVTLMMSDSTNILSPGRSTSESVVASSLLRHISE  300

Query  26   ATGRII  9
            A GR+I
Sbjct  301  AKGRVI  306



>gb|AFW66257.2| hypothetical protein ZEAMMB73_692349, partial [Zea mays]
Length=301

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  122  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  181

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHSIPDCCGLVLRC  G I HT
Sbjct  182  LIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGIIFHT  241

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHIS  30
            GDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS
Sbjct  242  GDWKIDESPVDGKNFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHIS  300



>ref|XP_004297533.1| PREDICTED: uncharacterized protein LOC101299666 [Fragaria vesca 
subsp. vesca]
Length=897

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DELGV KI PDT FI KW HKIEA++ITHGHEDHIGALPWVIPALD  TPIFASSFT+E
Sbjct  136  FDELGVQKIIPDTTFIRKWKHKIEAIVITHGHEDHIGALPWVIPALDPSTPIFASSFTME  195

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+KRLKE  IFVPSRLK+FKT+R+F AGPFE+EP+RVTHSIPDCCGLVLRC  GTILHT
Sbjct  196  LIRKRLKEHGIFVPSRLKMFKTKRKFMAGPFEIEPVRVTHSIPDCCGLVLRCADGTILHT  255

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG  FDRE LEELSKEGVTLMMSDSTNVLSPGRT SE+ VAD+L+RHISA
Sbjct  256  GDWKIDESPLDGQGFDREGLEELSKEGVTLMMSDSTNVLSPGRTTSESSVADALMRHISA  315

Query  26   ATGRII  9
            A GR+I
Sbjct  316  AQGRVI  321



>ref|XP_006647352.1| PREDICTED: uncharacterized protein LOC102710271 isoform X1 [Oryza 
brachyantha]
Length=778

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  24   YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSSTPIFASSFTME  83

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKEF IF+ SRLKVF+ R+RF AGPFEVEP+RVTHSIPDCCGLVLRC  G I HT
Sbjct  84   LIKRRLKEFGIFLSSRLKVFRVRKRFQAGPFEVEPLRVTHSIPDCCGLVLRCADGIIFHT  143

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  144  GDWKIDESPVDGKNFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  203

Query  26   ATGRII  9
            A GR+I
Sbjct  204  AKGRVI  209



>gb|EEE57142.1| hypothetical protein OsJ_07047 [Oryza sativa Japonica Group]
Length=868

 Score =   330 bits (846),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  117  FDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSSTPIFASSFTME  176

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKEF IF+ SRLKVF+ R+RF AGPFEVEP+RVTHSIPDCCGLVLRC  G I HT
Sbjct  177  LIKRRLKEFGIFLSSRLKVFRVRKRFQAGPFEVEPLRVTHSIPDCCGLVLRCADGIIFHT  236

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  237  GDWKIDESPVDGKIFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  296

Query  26   ATGRII  9
            A GR+I
Sbjct  297  AKGRVI  302



>gb|EEC73354.1| hypothetical protein OsI_07566 [Oryza sativa Indica Group]
Length=871

 Score =   330 bits (845),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  117  FDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSSTPIFASSFTME  176

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKEF IF+ SRLKVF+ R+RF AGPFEVEP+RVTHSIPDCCGLVLRC  G I HT
Sbjct  177  LIKRRLKEFGIFLSSRLKVFRVRKRFQAGPFEVEPLRVTHSIPDCCGLVLRCADGIIFHT  236

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  237  GDWKIDESPVDGKIFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  296

Query  26   ATGRII  9
            A GR+I
Sbjct  297  AKGRVI  302



>ref|XP_002451689.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
 gb|EES04665.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
Length=875

 Score =   329 bits (844),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  122  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  181

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHSIPDCCGLVLRC  G I HT
Sbjct  182  LIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGIIFHT  241

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  242  GDWKIDESPVDGKIFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  301

Query  26   ATGRII  9
            A GR+I
Sbjct  302  AKGRVI  307



>gb|EMT12329.1| Ribonuclease J [Aegilops tauschii]
Length=851

 Score =   329 bits (843),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  116  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  175

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLK F+ R RF AGPFEVEPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  176  LIKKRLKEFGIFLSSRLKSFRVRNRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGTIFHT  235

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTN+LSPGR+ SE+VVA SLLRH+S 
Sbjct  236  GDWKIDESPVDGRIFDREALEELSKEGVTLMMSDSTNILSPGRSTSESVVASSLLRHVSE  295

Query  26   ATGRII  9
            A GR +
Sbjct  296  AKGRRV  301



>ref|XP_004952679.1| PREDICTED: uncharacterized protein LOC101761263 isoform X1 [Setaria 
italica]
Length=878

 Score =   329 bits (844),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  127  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  186

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHS+PDCCGLVLRC  G I HT
Sbjct  187  LIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHSVPDCCGLVLRCGDGIIFHT  246

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  247  GDWKIDESPVDGKIFDREALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  306

Query  26   ATGRII  9
            A GR+I
Sbjct  307  AKGRVI  312



>ref|XP_009419382.1| PREDICTED: uncharacterized protein LOC103999362 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=888

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI++WSHKIEA++ITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  115  YDEFGVQKIVPDTTFIKRWSHKIEALVITHGHEDHIGALPWVIPALDSHTPIFASSFTME  174

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKEF IFVPSRLK FK R++F AGPFEVEPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  175  LIKRRLKEFGIFVPSRLKEFKVRKKFQAGPFEVEPIRVTHSIPDCCGLVLRCSDGTIFHT  234

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDR ALE+LSKEGVTLMMSDSTNVLSPGR++SE  VAD+LLR IS 
Sbjct  235  GDWKIDESPLDGKVFDRVALEQLSKEGVTLMMSDSTNVLSPGRSVSEAAVADTLLRRISE  294

Query  26   ATGRII  9
            A GR+I
Sbjct  295  AKGRVI  300



>ref|XP_008645344.1| PREDICTED: uncharacterized protein LOC103626744 isoform X1 [Zea 
mays]
Length=874

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI+KWSHKIEAVIITHGHEDHIGALPWVIPALDS TPIFASSFT+E
Sbjct  122  YDEFGVQKIIPDTTFIKKWSHKIEAVIITHGHEDHIGALPWVIPALDSTTPIFASSFTME  181

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHSIPDCCGLVLRC  G I HT
Sbjct  182  LIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGIIFHT  241

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHIS 
Sbjct  242  GDWKIDESPVDGKKFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHISE  301

Query  26   ATGRII  9
            A GR+I
Sbjct  302  AKGRVI  307



>dbj|BAB08807.1| unnamed protein product [Arabidopsis thaliana]
Length=528

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE G+ KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  146  YDEPGIQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  205

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  206  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  265

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  266  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  325

Query  26   ATGRII  9
            A GR+I
Sbjct  326  AKGRVI  331



>emb|CDX84407.1| BnaC03g50930D [Brassica napus]
Length=893

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+ GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  144  YDDPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  203

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GLVLRC  G ILHT
Sbjct  204  LIKKRLKEHGIFVQSRLKTFNTRRRFMAGPFEIEPITVTHSIPDCSGLVLRCADGNILHT  263

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE VVAD+L+R++ A
Sbjct  264  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSEKVVADALVRNVMA  323

Query  26   ATGRII  9
            A GR+I
Sbjct  324  AKGRVI  329



>ref|XP_009150395.1| PREDICTED: uncharacterized protein LOC103873754 [Brassica rapa]
Length=907

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+ GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  149  YDDPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  208

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GLVLRC  G ILHT
Sbjct  209  LIKKRLKEHGIFVQSRLKTFNTRRRFMAGPFEIEPITVTHSIPDCSGLVLRCADGNILHT  268

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE VVAD+L+R++ A
Sbjct  269  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSEKVVADALVRNVMA  328

Query  26   ATGRII  9
            A GR+I
Sbjct  329  AKGRVI  334



>ref|XP_010909140.1| PREDICTED: uncharacterized protein LOC105035311 isoform X5 [Elaeis 
guineensis]
Length=706

 Score =   315 bits (808),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPW-----VIPALDSDTPIFAS  402
            YDE GV KI PDT FI++WSHKIEAV+ITHGHEDHI +  +     VIPALDS TPIFAS
Sbjct  115  YDEFGVQKIVPDTTFIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPALDSHTPIFAS  174

Query  401  SFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAG  222
            SFT+ELIKKRLKEF IFV SRL++F  R++F AGPFEVEPIRVTHSIPDCCGLVLRC  G
Sbjct  175  SFTMELIKKRLKEFGIFVLSRLRLFTIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDG  234

Query  221  TILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLL  42
            TILHTGDWKIDESPLDG +FDRE LE+LSKEGVTLMMSDSTNVLSPGR++SE VVAD+LL
Sbjct  235  TILHTGDWKIDESPLDGKIFDRETLEDLSKEGVTLMMSDSTNVLSPGRSVSEAVVADALL  294

Query  41   RHISAATGRIIA  6
            RHISAA GR+IA
Sbjct  295  RHISAAKGRVIA  306



>ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41105.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
Length=927

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  145  YDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  204

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  205  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  264

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  265  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  324

Query  26   ATGRII  9
            A GR+I
Sbjct  325  AKGRVI  330



>ref|XP_010484076.1| PREDICTED: uncharacterized protein LOC104762480 [Camelina sativa]
Length=899

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  134  YDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  193

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  194  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  253

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  254  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  313

Query  26   ATGRII  9
            A GR+I
Sbjct  314  AKGRVI  319



>ref|XP_010444239.1| PREDICTED: uncharacterized protein LOC104726958 [Camelina sativa]
Length=899

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  134  YDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  193

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  194  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  253

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  254  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  313

Query  26   ATGRII  9
            A GR+I
Sbjct  314  AKGRVI  319



>ref|NP_201147.2| RNase J [Arabidopsis thaliana]
 gb|AAO42228.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD93952.1| putative protein [Arabidopsis thaliana]
 gb|AED97746.1| RNA-metabolising metallo-beta-lactamase family protein [Arabidopsis 
thaliana]
Length=911

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE G+ KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  146  YDEPGIQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  205

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  206  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  265

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  266  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  325

Query  26   ATGRII  9
            A GR+I
Sbjct  326  AKGRVI  331



>ref|XP_010460357.1| PREDICTED: uncharacterized protein LOC104741250 [Camelina sativa]
Length=900

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  135  YDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  194

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  195  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  254

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  255  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  314

Query  26   ATGRII  9
            A GR+I
Sbjct  315  AKGRVI  320



>gb|KFK28054.1| hypothetical protein AALP_AA8G465700 [Arabis alpina]
Length=896

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  140  YDEPGVQKIMPDTGFIRRWRHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  199

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK+F TRRRF AGPFE+EPI VTHSIPDC GLVLRC  G ILHT
Sbjct  200  LIKKRLKEHGIFVQSRLKIFNTRRRFMAGPFEIEPITVTHSIPDCSGLVLRCADGNILHT  259

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEE+SKEG+TLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  260  GDWKIDEAPLDGKVFDREALEEISKEGITLMMSDSTNVLSPGRTISEKVVADALVRNVMA  319

Query  26   ATGRII  9
            A GR +
Sbjct  320  ANGRRV  325



>emb|CDY41516.1| BnaA06g22690D [Brassica napus]
Length=1149

 Score =   322 bits (825),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+ GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  148  YDDPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  207

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GLVLRC  G ILHT
Sbjct  208  LIKKRLKEHGIFVQSRLKTFNTRRRFMAGPFEIEPITVTHSIPDCSGLVLRCADGNILHT  267

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT SE VVAD+L+R++ A
Sbjct  268  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTTSEKVVADALVRNVMA  327

Query  26   ATGRII  9
            A GR+I
Sbjct  328  AKGRVI  333



>ref|XP_006279731.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
 gb|EOA12629.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
Length=908

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE GV KI PDT FI +W H+IEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  143  YDEPGVQKIMPDTGFIRRWKHQIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  203  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  263  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  322

Query  26   ATGRII  9
            A GR+I
Sbjct  323  AKGRVI  328



>ref|XP_010909138.1| PREDICTED: uncharacterized protein LOC105035311 isoform X3 [Elaeis 
guineensis]
Length=865

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPW-----VIPALDSDTPIFAS  402
            YDE GV KI PDT FI++WSHKIEAV+ITHGHEDHI +  +     VIPALDS TPIFAS
Sbjct  115  YDEFGVQKIVPDTTFIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPALDSHTPIFAS  174

Query  401  SFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAG  222
            SFT+ELIKKRLKEF IFV SRL++F  R++F AGPFEVEPIRVTHSIPDCCGLVLRC  G
Sbjct  175  SFTMELIKKRLKEFGIFVLSRLRLFTIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDG  234

Query  221  TILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLL  42
            TILHTGDWKIDESPLDG +FDRE LE+LSKEGVTLMMSDSTNVLSPGR++SE VVAD+LL
Sbjct  235  TILHTGDWKIDESPLDGKIFDRETLEDLSKEGVTLMMSDSTNVLSPGRSVSEAVVADALL  294

Query  41   RHISAATGRIIA  6
            RHISAA GR+IA
Sbjct  295  RHISAAKGRVIA  306



>ref|XP_010909136.1| PREDICTED: uncharacterized protein LOC105035311 isoform X1 [Elaeis 
guineensis]
Length=884

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPW-----VIPALDSDTPIFAS  402
            YDE GV KI PDT FI++WSHKIEAV+ITHGHEDHI +  +     VIPALDS TPIFAS
Sbjct  115  YDEFGVQKIVPDTTFIKRWSHKIEAVVITHGHEDHIVSASYCSVKQVIPALDSHTPIFAS  174

Query  401  SFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAG  222
            SFT+ELIKKRLKEF IFV SRL++F  R++F AGPFEVEPIRVTHSIPDCCGLVLRC  G
Sbjct  175  SFTMELIKKRLKEFGIFVLSRLRLFTIRKKFLAGPFEVEPIRVTHSIPDCCGLVLRCSDG  234

Query  221  TILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLL  42
            TILHTGDWKIDESPLDG +FDRE LE+LSKEGVTLMMSDSTNVLSPGR++SE VVAD+LL
Sbjct  235  TILHTGDWKIDESPLDGKIFDRETLEDLSKEGVTLMMSDSTNVLSPGRSVSEAVVADALL  294

Query  41   RHISAATGRIIA  6
            RHISAA GR+IA
Sbjct  295  RHISAAKGRVIA  306



>dbj|BAD44310.1| putative protein [Arabidopsis thaliana]
Length=911

 Score =   315 bits (807),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YDE G+ KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALD +TPIFASSFT+E
Sbjct  146  YDEPGIQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDPNTPIFASSFTME  205

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GL LRC  G ILHT
Sbjct  206  LIKKRLKEHGIFVQSRLKTFSTRRRFMAGPFEIEPITVTHSIPDCSGLFLRCADGNILHT  265

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRT+SE VVAD+L+R++ A
Sbjct  266  GDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMA  325

Query  26   ATGRII  9
            A  R+I
Sbjct  326  AKERVI  331



>ref|XP_006394279.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
 gb|ESQ31565.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
Length=916

 Score =   310 bits (794),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 161/186 (87%), Gaps = 3/186 (2%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            +DE GV KI PDT FI +W HKIEAV+ITHGHEDHIGALPWVIPALDS+TPIFASSFT+E
Sbjct  152  FDEPGVQKIMPDTGFIRRWKHKIEAVVITHGHEDHIGALPWVIPALDSNTPIFASSFTME  211

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKE  IFV SRLK F TRRRF AGPFE+EPI VTHSIPDC GLVLRC  G ILHT
Sbjct  212  LIKKRLKEHGIFVQSRLKTFNTRRRFMAGPFEIEPITVTHSIPDCSGLVLRCADGNILHT  271

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG VFDREALEELSKEG   MMSDSTNVLSPGRT SE VVAD+L+R++ A
Sbjct  272  GDWKIDEAPLDGKVFDREALEELSKEG---MMSDSTNVLSPGRTTSEKVVADALVRNVMA  328

Query  26   ATGRII  9
            A GR+I
Sbjct  329  AKGRVI  334



>ref|XP_001775526.1| predicted protein [Physcomitrella patens]
 gb|EDQ59723.1| predicted protein, partial [Physcomitrella patens]
Length=582

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            YD+LG+ K+ PDT FI +W  KIEAVIITHGHEDHIGALPWVIPALD  TPI+A+ FT++
Sbjct  66   YDDLGIQKVLPDTQFIHRWRDKIEAVIITHGHEDHIGALPWVIPALDPKTPIYATGFTMQ  125

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLKE++I    RL+ F  R RF AGPFE+EPIRVTHSIPDCCGLVLRC  GTI HT
Sbjct  126  LIKRRLKEYNIPAEGRLRTFSMRARFDAGPFEIEPIRVTHSIPDCCGLVLRCADGTIFHT  185

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESP+DGNVFDR ALE+L KEGVTLMMSDSTNVLSPGRT SE  VA++L+R I  
Sbjct  186  GDWKIDESPVDGNVFDRVALEQLQKEGVTLMMSDSTNVLSPGRTTSEADVAEALMRKIVE  245

Query  26   ATGR  15
            A GR
Sbjct  246  AKGR  249



>ref|XP_002977440.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
 gb|EFJ21444.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
Length=835

 Score =   284 bits (726),  Expect = 8e-87, Method: Composition-based stats.
 Identities = 128/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            Y++ GVVK+ PDT FI +W HKIEAVIITHGHEDHIGALPWVIPALD  T I+++SFTLE
Sbjct  70   YEDFGVVKVLPDTTFISRWKHKIEAVIITHGHEDHIGALPWVIPALDPQTRIYSTSFTLE  129

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLK+++     R   F  R  F AGPF+VE IRVTHSIPDCCGL+LRC  GTI H+
Sbjct  130  LIKRRLKDYNFPFEHRCHTFTMRNPFQAGPFKVEAIRVTHSIPDCCGLILRCQDGTIFHS  189

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG +FDR  LEEL KEGVTLMMSDSTNVLSPGRT+SET V  SL+++++ 
Sbjct  190  GDWKIDENPLDGKIFDRNTLEELGKEGVTLMMSDSTNVLSPGRTISETDVRKSLMQYVTE  249

Query  26   ATGRIIA  6
            A  R+I+
Sbjct  250  AKSRVIS  256



>ref|XP_002975019.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
 gb|EFJ23804.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
Length=829

 Score =   282 bits (722),  Expect = 2e-86, Method: Composition-based stats.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            Y++ GVVK+ PDT FI +W HKIEAVIITHGHEDHIGALPWVIPALD  T I+++SFTLE
Sbjct  70   YEDFGVVKVLPDTTFISRWKHKIEAVIITHGHEDHIGALPWVIPALDPQTRIYSTSFTLE  129

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RLK+++     R   F  R  F AGPF+ E IRVTHSIPDCCGL+LRC  GTI H+
Sbjct  130  LIKRRLKDYNFPFEHRCHTFTMRNPFQAGPFKAEAIRVTHSIPDCCGLILRCQDGTIFHS  189

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG +FDR  LEEL KEGVTLMMSDSTNVLSPGRT+SET V  SL+++++ 
Sbjct  190  GDWKIDENPLDGKIFDRNTLEELGKEGVTLMMSDSTNVLSPGRTISETDVRKSLMQYVTE  249

Query  26   ATGRIIA  6
            A  R+I+
Sbjct  250  AKSRVIS  256



>ref|XP_011073027.1| PREDICTED: uncharacterized protein LOC105158090 isoform X3 [Sesamum 
indicum]
Length=729

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IFVPSRLKVFKTRRRF AGPFEVEPIRVTHS
Sbjct  6    VIPALDSHTPIFASSFTMELIKKRLKEFGIFVPSRLKVFKTRRRFVAGPFEVEPIRVTHS  65

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDC GLV RC  GTI HTGDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  66   IPDCSGLVFRCADGTIFHTGDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSP  125

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRTLSETVVADSLLRHISAA GR+I
Sbjct  126  GRTLSETVVADSLLRHISAAKGRVI  150



>ref|XP_001419620.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97913.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=413

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            ++ELG+ K+ PD  F+ +W  KIEAV+ITHGHEDHIGALPWV+PALD  TPI+A  FT++
Sbjct  42   HEELGIQKVLPDVSFLARWKDKIEAVLITHGHEDHIGALPWVVPALDPSTPIYAGLFTMQ  101

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+R++E+S++   R KVF    RF AGPFE+E +RVTHSIPDCCGL+ R + GTI+HT
Sbjct  102  LIKRRMQEYSLWNDQRFKVFDMNERFQAGPFEMEAVRVTHSIPDCCGLIFRSEHGTIVHT  161

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+P+DG +FDR + E +  EGVTLMMSDSTNVLSPGRT+SE+ V++ ++R +  
Sbjct  162  GDWKIDENPVDGRIFDRTSWERVGNEGVTLMMSDSTNVLSPGRTISESAVSEGIMRRVLG  221

Query  26   ATGRII  9
              GRII
Sbjct  222  HRGRII  227



>ref|XP_009595703.1| PREDICTED: uncharacterized protein LOC104091946 isoform X3 [Nicotiana 
tomentosiformis]
Length=705

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IFVPSRLKVFKTRR+FTAGPFEVEPI VTHS
Sbjct  8    VIPALDSHTPIFASSFTMELIKKRLKEFGIFVPSRLKVFKTRRKFTAGPFEVEPITVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDC G+VLRC  GTILHTGDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCSGIVLRCSDGTILHTGDWKIDESPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRTLSETVVADSLLRHISAA GRII
Sbjct  128  GRTLSETVVADSLLRHISAAKGRII  152



>ref|XP_008811802.1| PREDICTED: uncharacterized protein LOC103722876 isoform X2 [Phoenix 
dactylifera]
Length=741

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IFVPSRLK+FK R++F AGPFEVEPIRVTHS
Sbjct  8    VIPALDSHTPIFASSFTMELIKKRLKEFGIFVPSRLKLFKIRKKFLAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCSDGTILHTGDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRIIA  6
            GR++SE VVAD+LLRHISAA GR+IA
Sbjct  128  GRSVSEAVVADALLRHISAAKGRVIA  153



>ref|XP_006578698.1| PREDICTED: uncharacterized protein LOC100783850 isoform X3 [Glycine 
max]
Length=739

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS+TPIFASSFTLEL+KKRLKE  IFVPSRLKVF+TR++F AGPFE+EPIRVTHS
Sbjct  8    VIPALDSNTPIFASSFTLELMKKRLKEHGIFVPSRLKVFRTRKKFVAGPFEIEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDE+PLDG VFDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCSDGTILHTGDWKIDETPLDGKVFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT+SE+VVAD+LLRHISA+ GR+I
Sbjct  128  GRTISESVVADALLRHISASKGRVI  152



>ref|XP_001692070.1| hypothetical protein CHLREDRAFT_115745 [Chlamydomonas reinhardtii]
 gb|EDP04560.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  +IEA+IITHGHEDHIGALPWV+PALD  TPI+ASSF ++
Sbjct  40   FSDLGMQKILPDTDFLAQWKDRIEALIITHGHEDHIGALPWVVPALDPATPIYASSFVMQ  99

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+K+RL E++++   R   F  R+RF AGPFE+EP+RVTHSIPDCCGL++R D GTI+HT
Sbjct  100  LVKRRLTEYNLWDEKRFITFDMRQRFQAGPFEIEPVRVTHSIPDCCGLIMRSDEGTIVHT  159

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG  FDRE    L  E V LMMSDSTNVLSPGRTLSE VV DSL+  +  
Sbjct  160  GDWKIDENPLDGEQFDRELFMALGSEPVALMMSDSTNVLSPGRTLSEQVVHDSLVEKVLE  219

Query  26   ATGR  15
              GR
Sbjct  220  HNGR  223



>ref|XP_002505947.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67205.1| predicted protein [Micromonas sp. RCC299]
Length=791

 Score =   269 bits (687),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 118/187 (63%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            ++ELG+ K+ PD  F+ +W  K+EAV+ITHGHEDHIGALPWVIPALD DTP++A  FT++
Sbjct  170  HEELGIQKVLPDVSFLARWRDKVEAVLITHGHEDHIGALPWVIPALDPDTPVYAGLFTMQ  229

Query  386  LIKKRLKEFSIFVP-SRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILH  210
            LI++R+KEF+++   SR KV     RF AGPFE+E +RVTHSIPDCCGL+ RC AGT++H
Sbjct  230  LIQRRMKEFNLWGDGSRFKVIDMGERFDAGPFEMEAVRVTHSIPDCCGLIFRCAAGTVVH  289

Query  209  TGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHIS  30
            TGDWKIDE+P+DG  FDRE  E + KEGVTLMMSDSTNVLSPGRT+SE+++ DS+++ + 
Sbjct  290  TGDWKIDENPVDGLNFDREQFERVGKEGVTLMMSDSTNVLSPGRTISESLIRDSMVQKVL  349

Query  29   AATGRII  9
               GRII
Sbjct  350  GHNGRII  356



>ref|XP_010663736.1| PREDICTED: uncharacterized protein LOC100268000 isoform X2 [Vitis 
vinifera]
Length=739

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IFVPSRLKVF+TR++F AGPFE+EPIRVTHS
Sbjct  8    VIPALDSHTPIFASSFTMELIKKRLKEFGIFVPSRLKVFRTRKKFIAGPFEIEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLV+RC  GTILHTGDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVIRCADGTILHTGDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT+SE+VVAD+LLRHIS+A GR+I
Sbjct  128  GRTISESVVADALLRHISSAKGRVI  152



>ref|XP_005646511.1| Metallo-hydrolase/oxidoreductase [Coccomyxa subellipsoidea C-169]
 gb|EIE21967.1| Metallo-hydrolase/oxidoreductase [Coccomyxa subellipsoidea C-169]
Length=662

 Score =   266 bits (680),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  KIEAVIITHGHEDHIGA+PWV+PALD DTPI++  F ++
Sbjct  24   FTDLGMQKILPDTSFLHRWRDKIEAVIITHGHEDHIGAMPWVVPALDPDTPIYSGGFAMQ  83

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+R++E+S++  SR K FK   RF  GPFE EPIRVTHSIPDCCG++LR + G I+HT
Sbjct  84   LIKRRMQEYSLWNESRFKTFKMNERFQLGPFECEPIRVTHSIPDCCGMILRSEHGNIVHT  143

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE P+DG+ FDR   E +SKEGV L MSDSTNVLSPGRTLSET V D+L+  +  
Sbjct  144  GDWKIDEDPMDGDKFDRNTFEAVSKEGVALFMSDSTNVLSPGRTLSETTVRDALITRVMG  203

Query  26   --ATGRII  9
                GRII
Sbjct  204  HQGKGRII  211



>ref|XP_010250773.1| PREDICTED: uncharacterized protein LOC104592923 isoform X3 [Nelumbo 
nucifera]
Length=741

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALD +TPIFASSFT+ELIKKRLKEF IFVPSRLK+F+TR++F AGPFEVEPIRVTHS
Sbjct  8    VIPALDPNTPIFASSFTMELIKKRLKEFGIFVPSRLKMFRTRKKFIAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCADGTILHTGDWKIDESPLDGKTFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT+SE VVAD+LLRHISAA GR+I
Sbjct  128  GRTISEAVVADALLRHISAAKGRVI  152



>ref|XP_011044176.1| PREDICTED: uncharacterized protein LOC105139443 isoform X2 [Populus 
euphratica]
Length=738

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            V+PALD +TPI+ASSFT+ELIKKRLKE  IFVPSRLKVFKT+R+FTAGPFE+EPIRVTHS
Sbjct  8    VVPALDHNTPIYASSFTMELIKKRLKENGIFVPSRLKVFKTKRKFTAGPFEIEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG VFDRE LEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCADGTILHTGDWKIDESPLDGKVFDRETLEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRTLSE+VVAD+LLR ISAA GRII
Sbjct  128  GRTLSESVVADALLRRISAAKGRII  152



>gb|ACD36970.1| chloroplast RNase J variant 2 [Chlamydomonas reinhardtii]
Length=767

 Score =   265 bits (676),  Expect = 4e-80, Method: Composition-based stats.
 Identities = 118/184 (64%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  +IEA+IITHGHEDHIGALPWV+PALD  TPI+ASSF ++
Sbjct  155  FSDLGMQKILPDTDFLAQWKDRIEALIITHGHEDHIGALPWVVPALDPATPIYASSFVMQ  214

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+K+RL E++++   R   F  R+RF AGPFE+EP+RVTHSIPDCCGL++R D GTI+HT
Sbjct  215  LVKRRLTEYNLWDEKRFITFDMRQRFQAGPFEIEPVRVTHSIPDCCGLIMRSDEGTIVHT  274

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG  FDRE    L  E V LMMSDSTNVLSPGRTLSE VV DSL+  +  
Sbjct  275  GDWKIDENPLDGEQFDRELFMALGSEPVALMMSDSTNVLSPGRTLSEQVVHDSLVEKVLE  334

Query  26   ATGR  15
              GR
Sbjct  335  HNGR  338



>ref|XP_006477011.1| PREDICTED: uncharacterized protein LOC102606767 isoform X2 [Citrus 
sinensis]
Length=734

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS+TPI+ASSFT+ELI+KRLKE  IFVPSRLK FKTRR+F AGPFE+EPIRVTHS
Sbjct  8    VIPALDSNTPIYASSFTMELIRKRLKENGIFVPSRLKTFKTRRKFMAGPFEIEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCADGTILHTGDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT SE+VV D+L+RH+SAA GR+I
Sbjct  128  GRTTSESVVKDALMRHVSAAKGRVI  152



>ref|XP_007510671.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18204.1| predicted protein [Bathycoccus prasinos]
Length=850

 Score =   264 bits (675),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 112/187 (60%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            ++ELG+ K+ PD  F+++W  KIEAV+ITHGHEDHIGALPW IPALD +TP++A  FT++
Sbjct  244  HEELGIQKVLPDVSFLKRWRDKIEAVVITHGHEDHIGALPWAIPALDPNTPVYAGIFTMQ  303

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+ +R++EF+++ P R KV +  +RF AGPFE+E +RVTHSIPDCCGL+ R + GTI+HT
Sbjct  304  LVSRRMQEFNLWNPDRFKVMEMGQRFMAGPFEIEAVRVTHSIPDCCGLIFRSEHGTIVHT  363

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE P+D  +FDR A E++ KEGVTLMMSDSTNVLSPGRT SE+ V +++++ +  
Sbjct  364  GDWKIDEDPVDNQIFDRTAWEQVGKEGVTLMMSDSTNVLSPGRTTSESEVREAIMQKVVG  423

Query  26   ATGRIIA  6
              GRII+
Sbjct  424  HKGRIIS  430



>ref|XP_008464475.1| PREDICTED: uncharacterized protein LOC103502342 isoform X3 [Cucumis 
melo]
Length=778

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPI+ASSFT+ELIKKRLKE  IFVPSRLKVFK R+RFTAGPFE+EPIRVTHS
Sbjct  45   VIPALDSHTPIYASSFTVELIKKRLKENGIFVPSRLKVFKMRKRFTAGPFEIEPIRVTHS  104

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG VFDRE LE+LSKEGVTLMMSDSTNVLSP
Sbjct  105  IPDCCGLVLRCTDGTILHTGDWKIDESPLDGKVFDRETLEQLSKEGVTLMMSDSTNVLSP  164

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT+SE+VVAD+LLR ISAA GR+I
Sbjct  165  GRTISESVVADALLRRISAAKGRVI  189



>ref|XP_008374253.1| PREDICTED: uncharacterized protein LOC103437549 isoform X2 [Malus 
domestica]
Length=783

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALD DTPIFASSFT+ELIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EPIRVTHS
Sbjct  45   VIPALDLDTPIFASSFTMELIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPIRVTHS  104

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  105  IPDCCGLVLRCSDGTILHTGDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSP  164

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT SE+ VAD+LLRHISAA GR+I
Sbjct  165  GRTTSESSVADALLRHISAAKGRVI  189



>ref|XP_009375228.1| PREDICTED: uncharacterized protein LOC103964064 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009375237.1| PREDICTED: uncharacterized protein LOC103964071 isoform X2 [Pyrus 
x bretschneideri]
Length=786

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALD DTPIFASSFT+ELIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EPIRVTHS
Sbjct  45   VIPALDLDTPIFASSFTMELIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPIRVTHS  104

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  105  IPDCCGLVLRCSDGTILHTGDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSP  164

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT SE+ VAD+LLRHISAA GR+I
Sbjct  165  GRTTSESSVADALLRHISAAKGRVI  189



>ref|XP_002949431.1| hypothetical protein VOLCADRAFT_59321 [Volvox carteri f. nagariensis]
 gb|EFJ49450.1| hypothetical protein VOLCADRAFT_59321 [Volvox carteri f. nagariensis]
Length=463

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  +IEA+IITHGHEDHIGALPWV+PALD  TPIFASSF +E
Sbjct  68   FSDLGMQKILPDTDFLAQWKDRIEALIITHGHEDHIGALPWVVPALDPGTPIFASSFVME  127

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RL E+S++   R   F  R++F AGPFE+EP+RVTHSIPDCCGL++R   GT++HT
Sbjct  128  LIKRRLTEYSLWDEKRFIKFDMRQKFQAGPFEIEPVRVTHSIPDCCGLIMRSSEGTLVHT  187

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE PLDG  FDR     L+ E V LMMSDSTNVLSPGRTLSE VV DS++  +  
Sbjct  188  GDWKIDEHPLDGEQFDRGLFSALASERVALMMSDSTNVLSPGRTLSEQVVHDSIVDKVLQ  247

Query  26   ATGR  15
              G+
Sbjct  248  HNGK  251



>gb|ACD36969.1| chloroplast RNase J variant 1 [Chlamydomonas reinhardtii]
Length=920

 Score =   263 bits (671),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 118/184 (64%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  +IEA+IITHGHEDHIGALPWV+PALD  TPI+ASSF ++
Sbjct  155  FSDLGMQKILPDTDFLAQWKDRIEALIITHGHEDHIGALPWVVPALDPATPIYASSFVMQ  214

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            L+K+RL E++++   R   F  R+RF AGPFE+EP+RVTHSIPDCCGL++R D GTI+HT
Sbjct  215  LVKRRLTEYNLWDEKRFITFDMRQRFQAGPFEIEPVRVTHSIPDCCGLIMRSDEGTIVHT  274

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+PLDG  FDRE    L  E V LMMSDSTNVLSPGRTLSE VV DSL+  +  
Sbjct  275  GDWKIDENPLDGEQFDRELFMALGSEPVALMMSDSTNVLSPGRTLSEQVVHDSLVEKVLE  334

Query  26   ATGR  15
              GR
Sbjct  335  HNGR  338



>ref|XP_004500653.1| PREDICTED: ribonuclease J-like isoform X2 [Cicer arietinum]
Length=720

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKE  IF+PSRLK+F+T+ +F AGPFE+EPIRVTHS
Sbjct  8    VIPALDSSTPIFASSFTMELIKKRLKEHGIFLPSRLKIFRTKNKFVAGPFEIEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDE+PLDG VFDRE LEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCSDGTILHTGDWKIDETPLDGKVFDREGLEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT SE+ VAD+LLRHISA+ GR+I
Sbjct  128  GRTTSESAVADALLRHISASKGRVI  152



>emb|CEF99170.1| Beta-lactamase-like [Ostreococcus tauri]
Length=729

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            ++ELG+ K+ PD  F+ +W  KIEAV+ITHGHEDHIGALPWVIPALD  TPI+A  FT++
Sbjct  143  HEELGIQKVLPDVSFLHRWRDKIEAVLITHGHEDHIGALPWVIPALDPATPIYAGLFTMQ  202

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+R+ E+S++   R KVF    RF AGPF++E +RVTHSIPDCCGL+ R + GTI+HT
Sbjct  203  LIKRRMLEYSLWNDDRFKVFNMNERFQAGPFDMEAVRVTHSIPDCCGLIFRSEHGTIVHT  262

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+P+DG  FDR + E + +EGVTLMMSDSTNVLSPGRT+SE+ V++ ++R +  
Sbjct  263  GDWKIDETPVDGLHFDRTSWERVGQEGVTLMMSDSTNVLSPGRTVSESQVSEGIMRKVLG  322

Query  26   ATGRII  9
             +GRII
Sbjct  323  HSGRII  328



>ref|XP_009359454.1| PREDICTED: uncharacterized protein LOC103950027 isoform X2 [Pyrus 
x bretschneideri]
Length=786

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALD +TPIFASSFT+ELIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+EP+RVTHS
Sbjct  45   VIPALDPNTPIFASSFTMELIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEIEPVRVTHS  104

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG  FDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  105  IPDCCGLVLRCSDGTILHTGDWKIDESPLDGRGFDREALEELSKEGVTLMMSDSTNVLSP  164

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT SE+ VAD+LL+HISAA GR+I
Sbjct  165  GRTTSESSVADALLKHISAAKGRVI  189



>ref|XP_008392827.1| PREDICTED: uncharacterized protein LOC103455013 isoform X2 [Malus 
domestica]
Length=783

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -1

Query  464  HIGA-LPWVIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEV  288
            H+G     VIPALD +TPIFASSFT+ELIKKRLKE  IFVPSRL+ F+T+R+FTAGPFE+
Sbjct  37   HMGTKTTLVIPALDPNTPIFASSFTMELIKKRLKEHGIFVPSRLRTFRTKRKFTAGPFEI  96

Query  287  EPIRVTHSIPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMS  108
            EP+RVTHSIPDCCGLVLRC  GTILHTGDWKIDESPLDG  FDREALEELSKEGVTLMMS
Sbjct  97   EPVRVTHSIPDCCGLVLRCSDGTILHTGDWKIDESPLDGRGFDREALEELSKEGVTLMMS  156

Query  107  DSTNVLSPGRTLSETVVADSLLRHISAATGRII  9
            DSTNVLSPGRT SE+ VAD+LL+HISAA GR+I
Sbjct  157  DSTNVLSPGRTTSESSVADALLKHISAAKGRVI  189



>ref|XP_010677899.1| PREDICTED: uncharacterized protein LOC104893494 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=740

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VI ALD +TPIF+SSFT+ELIKKRLKEF IFVPSRLKVF+T+RRFTAGPFE+EP+RVTHS
Sbjct  8    VIRALDPNTPIFSSSFTMELIKKRLKEFGIFVPSRLKVFRTKRRFTAGPFEIEPVRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLV+RC  GTI HTGDWKIDE+P+DG  FDR ALEELSKEGVTLMMSDSTN++SP
Sbjct  68   IPDCCGLVMRCSDGTIFHTGDWKIDETPVDGKAFDRVALEELSKEGVTLMMSDSTNIMSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GRT+SE+VVAD+LLRHISAA GR+I
Sbjct  128  GRTISESVVADALLRHISAAKGRVI  152



>ref|XP_010909139.1| PREDICTED: uncharacterized protein LOC105035311 isoform X4 [Elaeis 
guineensis]
Length=731

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IFV SRL++F  R++F AGPFEVEPIRVTHS
Sbjct  8    VIPALDSHTPIFASSFTMELIKKRLKEFGIFVLSRLRLFTIRKKFLAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTILHTGDWKIDESPLDG +FDRE LE+LSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCSDGTILHTGDWKIDESPLDGKIFDRETLEDLSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRIIA  6
            GR++SE VVAD+LLRHISAA GR+IA
Sbjct  128  GRSVSEAVVADALLRHISAAKGRVIA  153



>ref|XP_011400344.1| Ribonuclease J [Auxenochlorella protothecoides]
 gb|KFM27377.1| Ribonuclease J [Auxenochlorella protothecoides]
Length=693

 Score =   257 bits (656),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  560  ELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELI  381
            +LG+ K+ PDT F+ KW  KIEAV ITHGHEDHIGALPWVIPALD +TPIFA  F + L+
Sbjct  122  DLGMAKLLPDTSFLAKWKDKIEAVFITHGHEDHIGALPWVIPALDPNTPIFAPGFPMRLV  181

Query  380  KKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGD  201
            ++RLKE+ ++ P+R      RR F  GPF+ E  RVTHSIPDCCGLVLRCDAGTI+H+GD
Sbjct  182  ERRLKEYKLWNPARAHTVAIRRPFQCGPFQAEAFRVTHSIPDCCGLVLRCDAGTIVHSGD  241

Query  200  WKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHI--SA  27
            WKIDE+P+DG  FDR+  E+L KEGVTL MSDSTNVLS GRT SE VV  +L+  +    
Sbjct  242  WKIDETPIDGECFDRDFFEQLGKEGVTLFMSDSTNVLSAGRTQSEAVVEKALMERMLDHE  301

Query  26   ATGRII  9
              GRII
Sbjct  302  NKGRII  307



>ref|XP_003575091.2| PREDICTED: uncharacterized protein LOC100825739 isoform X2 [Brachypodium 
distachyon]
Length=721

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS+TPIFASSFT+ELIKKRLKEF IF+ SRLK F+ R RF AGPFEVEPIRVTHS
Sbjct  8    VIPALDSNTPIFASSFTMELIKKRLKEFGIFLSSRLKSFRVRNRFQAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTI HTGDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTN+LSP
Sbjct  68   IPDCCGLVLRCGDGTIFHTGDWKIDESPVDGKIFDREALEELSKEGVTLMMSDSTNILSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GR+ SE+VVA SLLRHIS A GR+I
Sbjct  128  GRSTSESVVASSLLRHISEAKGRVI  152



>ref|XP_009419383.1| PREDICTED: uncharacterized protein LOC103999362 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=740

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIK+RLKEF IFVPSRLK FK R++F AGPFEVEPIRVTHS
Sbjct  8    VIPALDSHTPIFASSFTMELIKRRLKEFGIFVPSRLKEFKVRKKFQAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  GTI HTGDWKIDESPLDG VFDR ALE+LSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCSDGTIFHTGDWKIDESPLDGKVFDRVALEQLSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GR++SE  VAD+LLR IS A GR+I
Sbjct  128  GRSVSEAAVADTLLRRISEAKGRVI  152



>ref|XP_005846864.1| hypothetical protein CHLNCDRAFT_35723 [Chlorella variabilis]
 gb|EFN54762.1| hypothetical protein CHLNCDRAFT_35723 [Chlorella variabilis]
Length=814

 Score =   254 bits (650),  Expect = 5e-76, Method: Composition-based stats.
 Identities = 112/184 (61%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + +LG+ KI PDT F+ +W  KIEAV+ITHGHEDHIGALPWV PALD  TPI+A +F ++
Sbjct  130  FTDLGMQKILPDTSFLAQWRDKIEAVVITHGHEDHIGALPWVWPALDPSTPIYAGAFPMQ  189

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIK+RL+EF+++   R  V   R+ F  GPF+  PIRVTHSIPDCCGLVLR D GTI+HT
Sbjct  190  LIKRRLQEFNLYDEGRCHVISMRQNFQLGPFDCTPIRVTHSIPDCCGLVLRSDHGTIVHT  249

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDE+P+DG  FDR+  +E+ +EGV+L MSDSTNVLSPGRT SE VV  +L+  +  
Sbjct  250  GDWKIDENPVDGESFDRQVFDEIGREGVSLFMSDSTNVLSPGRTTSEAVVETALMNRVMG  309

Query  26   ATGR  15
              G+
Sbjct  310  HQGK  313



>ref|XP_003057206.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58851.1| predicted protein [Micromonas pusilla CCMP1545]
Length=813

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            ++ELG+ K+ PD  F+ +W  KIEAV+ITHGHEDHIGALPWVIPALD  TP++A  FT++
Sbjct  184  HEELGIQKVLPDVSFLSRWKDKIEAVLITHGHEDHIGALPWVIPALDPSTPVYAGLFTMQ  243

Query  386  LIKKRLKEFSIFV-PSRLKVFKTR--RRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTI  216
            LI +R+KEF+++   SR KV       RF+AGPFE+E +RVTHSIPDCCGL+ RC AGTI
Sbjct  244  LIARRMKEFNLWGDGSRFKVIGVGDGSRFSAGPFEMEAVRVTHSIPDCCGLIFRCAAGTI  303

Query  215  LHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRH  36
            +HTGDWKIDE+P+DG  FDR A E + +EGVTLMMSDSTNVLSPGRT+SE+ + D+++  
Sbjct  304  VHTGDWKIDENPVDGLNFDRSAWERVGQEGVTLMMSDSTNVLSPGRTISESKIRDAMVAR  363

Query  35   ISAATGRII  9
                 GRII
Sbjct  364  AHGHKGRII  372



>ref|XP_004952680.1| PREDICTED: uncharacterized protein LOC101761263 isoform X2 [Setaria 
italica]
Length=718

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHS
Sbjct  8    VIPALDSTTPIFASSFTMELIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            +PDCCGLVLRC  G I HTGDWKIDESP+DG +FDREALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   VPDCCGLVLRCGDGIIFHTGDWKIDESPVDGKIFDREALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GR++SE+VVA SLLRHIS A GR+I
Sbjct  128  GRSISESVVAGSLLRHISEAKGRVI  152



>ref|XP_006647353.1| PREDICTED: uncharacterized protein LOC102710271 isoform X2 [Oryza 
brachyantha]
Length=721

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIK+RLKEF IF+ SRLKVF+ R+RF AGPFEVEP+RVTHS
Sbjct  8    VIPALDSSTPIFASSFTMELIKRRLKEFGIFLSSRLKVFRVRKRFQAGPFEVEPLRVTHS  67

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  G I HTGDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSP
Sbjct  68   IPDCCGLVLRCADGIIFHTGDWKIDESPVDGKNFDRQALEELSKEGVTLMMSDSTNVLSP  127

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GR++SE+VVA SLLRHIS A GR+I
Sbjct  128  GRSISESVVAGSLLRHISEAKGRVI  152



>ref|XP_008645345.1| PREDICTED: uncharacterized protein LOC103626744 isoform X2 [Zea 
mays]
Length=756

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  443  VIPALDSDTPIFASSFTLELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHS  264
            VIPALDS TPIFASSFT+ELIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHS
Sbjct  45   VIPALDSTTPIFASSFTMELIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHS  104

Query  263  IPDCCGLVLRCDAGTILHTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSP  84
            IPDCCGLVLRC  G I HTGDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSP
Sbjct  105  IPDCCGLVLRCGDGIIFHTGDWKIDESPVDGKKFDRQALEELSKEGVTLMMSDSTNVLSP  164

Query  83   GRTLSETVVADSLLRHISAATGRII  9
            GR++SE+VVA SLLRHIS A GR+I
Sbjct  165  GRSISESVVAGSLLRHISEAKGRVI  189



>gb|EYU23119.1| hypothetical protein MIMGU_mgv1a0011951mg, partial [Erythranthe 
guttata]
Length=694

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LIKKRLKEF IFVPSRLK+FKT+RRF AGPF+VEPIRVTHSIPDC GLV RC  GTILHT
Sbjct  1    LIKKRLKEFGIFVPSRLKIFKTKRRFVAGPFDVEPIRVTHSIPDCSGLVFRCSDGTILHT  60

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWKIDESPLDG VFDREALEELSKEGVTLMMSDSTNVLSPGRTLSE+VVADSLLRHISA
Sbjct  61   GDWKIDESPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSESVVADSLLRHISA  120

Query  26   ATGRII  9
              GR+I
Sbjct  121  IQGRVI  126



>gb|AFW70510.1| hypothetical protein ZEAMMB73_470070 [Zea mays]
Length=201

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  392  LELIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTIL  213
            +ELIKKRLKEF IF+ SRLKV + ++RF AGPFEVEPIRVTHSIPDCCGLVLRC  G I 
Sbjct  1    MELIKKRLKEFGIFLSSRLKVLRIKKRFQAGPFEVEPIRVTHSIPDCCGLVLRCGDGIIF  60

Query  212  HTGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHI  33
            HTGDWKIDESP+DG  FDR+ALEELSKEGVTLMMSDSTNVLSPGR++SE+VVA SLLRHI
Sbjct  61   HTGDWKIDESPVDGKKFDRQALEELSKEGVTLMMSDSTNVLSPGRSISESVVAGSLLRHI  120

Query  32   SAATGRII  9
            S A GR+I
Sbjct  121  SEAKGRVI  128



>ref|XP_001712914.1| regulator of transcription that contains myb domains [Bigelowiella 
natans]
 gb|ABA27302.1| regulator of transcription that contains myb domains [Bigelowiella 
natans]
Length=636

 Score =   210 bits (534),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 101/185 (55%), Positives = 124/185 (67%), Gaps = 2/185 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+ K+ PD  F+    + IE +IITHGHEDHIGA+ WV+P L +D  ++ S F   +I 
Sbjct  112  LGIQKVIPDINFLTHIQNLIEGLIITHGHEDHIGAINWVLPILRTDALVYTSRFVYNIIS  171

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            KR+ + +       ++F  ++RF  GPFE E  RVTHSIPDCCG V+R   G I+HTGDW
Sbjct  172  KRIDKQNYLFKKLFRIFDLKKRFQLGPFECEAFRVTHSIPDCCGFVIRSKYGLIVHTGDW  231

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHIS--AA  24
            KIDE PLDG  FDRE LE +SKE V LMMSDSTN LS GRT SE VV DSL+  I+    
Sbjct  232  KIDEFPLDGEKFDREFLESISKEKVLLMMSDSTNSLSHGRTASEKVVQDSLVSIITNPKI  291

Query  23   TGRII  9
             GRII
Sbjct  292  KGRII  296



>ref|XP_003081348.1| putative metallo beta subunit lactamase (ISS) [Ostreococcus tauri]
Length=404

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = -1

Query  560  ELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELI  381
            ELG+ K+ PD  F+ +W  KIEAV+ITHGHEDHIGALPWVIPALD  TPI+A  FT++LI
Sbjct  31   ELGIQKVLPDVSFLHRWRDKIEAVLITHGHEDHIGALPWVIPALDPATPIYAGLFTMQLI  90

Query  380  KKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGD  201
            K+R+ E+S++   R KVF    RF AGPF++E +RVTHSIPDCCGL+ R + GTI+HTGD
Sbjct  91   KRRMLEYSLWNDDRFKVFNMNERFQAGPFDMEAVRVTHSIPDCCGLIFRSEHGTIVHTGD  150

Query  200  WKIDESPLDGNVFDREALEELSKEGVTLMMSDS---TNVLSPGRTLSETVVA  54
            WKIDE+P+DG  FDR + E + +E            T V+  G  L  T +A
Sbjct  151  WKIDETPVDGLHFDRTSWERVGQEXXXXXXXSGVMHTTVIGNGEMLGVTPLA  202



>gb|ACF24513.1| myb domain containing transcription regulator [Gymnochlora stellata]
Length=552

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = -1

Query  566  YDELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            + + G+ KI PD   +  +  ++E++IITHGHEDHIGAL W+IP  ++  PI+ S F   
Sbjct  31   FTKYGIKKIVPDINLLSYFKDRVESLIITHGHEDHIGALSWIIPIFENRLPIYVSGFVYN  90

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI +R+          LK F  ++ F AGPF     RVTHSIPDCCGL ++   G +LHT
Sbjct  91   LITQRISSSDRKNEYNLKRFSLKKMFQAGPFHCVAFRVTHSIPDCCGLFIKTSFGNVLHT  150

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GDWK D+SPLDG   D+  LE++S+E V LMMSDSTN  + GRT SE++V DS++ HI  
Sbjct  151  GDWKFDDSPLDGESTDKCFLEKISQESVLLMMSDSTNAQTSGRTESESLVQDSIINHICN  210

Query  26   --ATGRII  9
                GRII
Sbjct  211  PLNKGRII  218



>gb|AIB09652.1| myb domain-containing regulator of transcription [Lotharella 
sp. CCMP622]
Length=654

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 93/188 (49%), Positives = 120/188 (64%), Gaps = 2/188 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D +GV KI PD  F+  +  KIE+++ITHGHEDHIGAL W+IP LD +  IF+      +
Sbjct  130  DTIGVKKIIPDINFLAFFKDKIESIVITHGHEDHIGALEWIIPILDQNIIIFSPRLVFNI  189

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +KKR    +  +     +FK +  F  GPF  +  RVTHSIPDCCGLV +   G +LHTG
Sbjct  190  LKKRFLNQNNSIILNFVIFKIKTEFILGPFICQAFRVTHSIPDCCGLVFKSYLGNLLHTG  249

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            DWKIDE PLDG   D+  LE LSKE + LMMSDSTN ++ GRT SE  + +S+++ I   
Sbjct  250  DWKIDEYPLDGEQLDKSFLEYLSKEKILLMMSDSTNAMTSGRTDSEKTIQNSIVKKILYG  309

Query  23   TG--RIIA  6
                RIIA
Sbjct  310  NNNKRIIA  317



>ref|WP_041970296.1| ribonuclease J [Geobacter sp. OR-1]
 dbj|GAM08676.1| ribonuclease J 1 [Geobacter sp. OR-1]
Length=558

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++     +I  + +THGHEDHIGALP+V+P ++   PIF ++ TL L+K
Sbjct  50   LGIDLVVPDITYLRDRVERIRGIFLTHGHEDHIGALPYVLPEINP--PIFGTALTLGLVK  107

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKEF +     L+V K R   TAG F VE IRVTHSI D CGL +R   GT++HTGD+
Sbjct  108  AKLKEFHLDEKVDLRVVKPRESVTAGCFTVEFIRVTHSIVDGCGLAIRTPEGTVIHTGDF  167

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG + D  +     +EGV  +MSDSTNV   G T+SE  V ++         G
Sbjct  168  KIDQTPVDGELTDLASFARYGEEGVLALMSDSTNVKREGYTISERAVGEAFHELFPKCPG  227

Query  17   RII  9
            RII
Sbjct  228  RII  230



>ref|WP_022188780.1| uncharacterized protein [Ruminococcus sp. CAG:177]
 emb|CDB42741.1| uncharacterized protein BN517_00925 [Ruminococcus sp. CAG:177]
Length=591

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 7/188 (4%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  ++E+ + +I  ++ITHGHEDHIG LP+++  L+   P++ +  T+ L
Sbjct  80   DMLGVDLVLPDFTYVERNADRIRGIVITHGHEDHIGGLPYLLKVLN--VPVYGTKLTIGL  137

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L+E  +   + L V K     T G F VE I V HSIPD  GL +RC+ GTI+HTG
Sbjct  138  IQGKLREHGLLNSASLNVIKPGDVITLGGFTVEAIHVNHSIPDALGLAIRCEGGTIVHTG  197

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADS---LLRHI  33
            D+KID +P+DG + D   L E+ +EGV  +MSDSTN   PG T SE  V +S   L R  
Sbjct  198  DFKIDTTPIDGGMMDLGRLAEIGQEGVLCLMSDSTNAERPGFTESERKVGESFETLFR--  255

Query  32   SAATGRII  9
             A   RII
Sbjct  256  KAGNNRII  263



>ref|WP_031514459.1| ribonuclease J [Desulfotomaculum alkaliphilum]
Length=554

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +  H +  +++THGHEDHIG+LP+V+  + +  P++ +  TL L+ 
Sbjct  46   LGIDIVIPDITYLVENKHLLRGIVLTHGHEDHIGSLPYVLRQIKA--PVYGTKLTLGLLA  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE ++F  ++L   K R     GPF+VE I+V+HSIPD  GL +    GTI+HTGD+
Sbjct  104  HKLKEHNLFDQTQLNTVKPRDIIQVGPFKVEFIKVSHSIPDAVGLAIHTPVGTIVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D   L +L ++GV +M+SDSTNV  PG TLSE +V  +       A  
Sbjct  164  KIDQTPVDGEVTDLYKLAQLGEKGVLVMLSDSTNVERPGYTLSEKIVGHTFEEAFQNAKE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_035148932.1| ribonuclease J [Clostridium tetanomorphum]
 gb|KAJ51272.1| RNA-metabolising metallo-beta-lactamase [Clostridium tetanomorphum 
DSM 665]
Length=553

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 112/182 (62%), Gaps = 2/182 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            GV  + PD  ++     K++   +THGHEDHIG+LP+++  L+   PI+ +  TL +++ 
Sbjct  46   GVDLVIPDITYLLDNKDKVKGFFLTHGHEDHIGSLPYILKQLN--LPIYGTKLTLGIVQN  103

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +LKE  I     L   K       G  EVE IRVTHSI D C + +    G ILHTGD+K
Sbjct  104  KLKEHDILSKCELNGIKAGDVIKVGDLEVEFIRVTHSIADSCAIAIHTPIGVILHTGDFK  163

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATGR  15
            ID +P+DG++ D + + EL K+GV L+M+DSTNV  PG T+SE  + D+L R  S A GR
Sbjct  164  IDYTPIDGSIIDFQRISELGKQGVMLLMADSTNVQRPGHTISEKAIGDTLTRIFSNAEGR  223

Query  14   II  9
            +I
Sbjct  224  VI  225



>ref|WP_040329937.1| ribonuclease J [Candidatus Clostridium anorexicamassiliense]
Length=549

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 113/182 (62%), Gaps = 2/182 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            GV  + PD  ++++   KI  + ITHGHEDHIGALP+++  ++   PI+ +  ++ LI+ 
Sbjct  42   GVDLVIPDISYLKEKKDKIRGIFITHGHEDHIGALPYILKQIN--IPIYGTKLSIGLIEN  99

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +LKE +IF   +L V  +    +     VE IR THSI D C L +    GTI+HTGD+K
Sbjct  100  KLKEHNIFSECKLNVVNSGDNISFKELRVEFIRNTHSIADSCSLAIHTPEGTIIHTGDFK  159

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATGR  15
            ID +P+DG V D E +  L KEGV L+M+DSTNV   G T+SE  + D L R I  A GR
Sbjct  160  IDYTPIDGLVMDLERMSTLGKEGVLLLMADSTNVERKGHTISEKAIGDKLNRIIENADGR  219

Query  14   II  9
            +I
Sbjct  220  VI  221



>ref|WP_013780905.1| ribonuclease J [Mahella australiensis]
 gb|AEE96475.1| RNA-metabolising metallo-beta-lactamase [Mahella australiensis 
50-1 BON]
Length=556

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PDT ++ K   K++ +++THGHEDHIGALP+V+  ++   P++ +  TL L
Sbjct  46   DMPGVDLVIPDTSYLVKIKDKLKGIVLTHGHEDHIGALPYVLKEIN--VPVYGTRMTLGL  103

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKEF +    +L   +   +   G FEVE I V HSI     L +RC  G I+HTG
Sbjct  104  VENKLKEFGLSTSVKLVHVEAGSKIQLGAFEVELINVNHSIAGTVSLAIRCPVGLIVHTG  163

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D +P+DG V D     +L +EGV  M +DSTNV  PG T+SE+VV ++  R  + +
Sbjct  164  DFKVDYTPIDGEVIDLGRFAQLGQEGVLAMFADSTNVERPGYTMSESVVGETFDRIFAES  223

Query  23   TGRII  9
            TGRII
Sbjct  224  TGRII  228



>ref|WP_007908681.1| ribonuclease J [Ktedonobacter racemifer]
 gb|EFH90923.1| RNA-metabolising metallo-beta-lactamase [Ktedonobacter racemifer 
DSM 44963]
Length=553

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = -1

Query  563  DEL-GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLE  387
            DE+ GV  + PDT ++    H+I  ++ITHGHEDH+G+LP+V+P LD   PI+A+  T  
Sbjct  42   DEMFGVDLVIPDTSYLADKKHRIRGILITHGHEDHVGSLPYVLPMLDF-PPIYATRLTQG  100

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
            LI+ +LKE  +   + + V     +   G   +E  RV HSIPD  G+V+R   GT++HT
Sbjct  101  LIQVKLKEHRLLEKTIINVISPEDKLELGSCGIEFFRVNHSIPDAIGIVIRTPIGTVVHT  160

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GD+K D +P+DG   D   L EL  +GV LMM DST V SPG T SE V+ DSL +  + 
Sbjct  161  GDYKFDYTPVDGKPADLGKLGELGNQGVLLMMGDSTRVESPGYTPSERVINDSLDKIFAN  220

Query  26   ATGRII  9
            A GR+I
Sbjct  221  APGRVI  226



>ref|WP_013175208.1| ribonuclease J [Syntrophothermus lipocalidus]
 gb|ADI01806.1| RNA-metabolising metallo-beta-lactamase [Syntrophothermus lipocalidus 
DSM 12680]
Length=554

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 117/183 (64%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   K++AV++THGHEDH+GALP+++  +D   PI+ +  T+ +I+
Sbjct  47   LGIDIVIPDMTYLFENRDKVKAVLVTHGHEDHVGALPYLLREID--VPIYGTKLTIGIIE  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +L+E  +   +RL + K R +   GP E E IRV+HSIPD   + +    GTILHTGD+
Sbjct  105  AKLREHGL-TGARLNIVKPRDKINVGPLEAEFIRVSHSIPDTLAIAIHSPVGTILHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG V D     EL ++GV LM+SDSTN   PG T+SE VV ++         G
Sbjct  164  KLDQTPVDGEVVDFRKFAELGEKGVLLMLSDSTNAERPGYTMSERVVGNTFDELFGRCEG  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_003541273.1| MULTISPECIES: ribonuclease J [Desulfotomaculum]
 gb|AEF94328.1| Ribocuclease J [Desulfotomaculum carboxydivorans CO-1-SRB]
Length=554

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +    +  +++THGHEDHIGALP+V+  ++   P++ S   L L++
Sbjct  46   LGIDIVIPDITYLLENKELVRGILLTHGHEDHIGALPYVLKQIN--VPVYGSKLALGLVQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE +I    +L   K R     GPF+VE IRV+HSIPD   L +    GT+LHTGD+
Sbjct  104  GKLKEHNILDEVKLYTVKPRDTVHIGPFKVEFIRVSHSIPDAMALAIHTPVGTVLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D     +L ++GV +MMSDSTNV  PG T+SE VV ++       A  
Sbjct  164  KIDQTPVDGEVIDFHKFAQLGEKGVLVMMSDSTNVERPGYTMSERVVGNTFDETFRNAEE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_004512338.1| ribonuclease J [Geobacter metallireducens]
 gb|ABB30609.1| metal-dependent hydrolase, beta-lactamase superfamily [Geobacter 
metallireducens GS-15]
 gb|EHP87996.1| RNA-metabolising metallo-beta-lactamase [Geobacter metallireducens 
RCH3]
Length=558

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ + + ++  + +THGHEDHIGALP+V+P L    PIF ++ TL  ++
Sbjct  50   LGIDIVIPDITYLRERADRVRGIFLTHGHEDHIGALPYVLPELP--VPIFGTALTLGFVR  107

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            ++LKEF +   + L V K R   T GPF+VE IRV+HSI D C L +R   G ++HTGD+
Sbjct  108  EKLKEFDLDSSTDLSVVKPRESVTVGPFKVEFIRVSHSIVDGCALAIRTPEGVVIHTGDF  167

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG + D  +      EGV  + SDSTNV   G TLSE +V ++         G
Sbjct  168  KIDQTPVDGELTDLASFARYGSEGVLALFSDSTNVERQGYTLSERLVGEAFDEIFPRCPG  227

Query  17   RII  9
            RII
Sbjct  228  RII  230



>ref|WP_006722641.1| beta-lactamase [Collinsella intestinalis]
 gb|EEP44897.1| hypothetical protein COLINT_02396 [Collinsella intestinalis DSM 
13280]
Length=559

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 113/184 (61%), Gaps = 1/184 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            ++ G+  + PD  ++ +  HK+  +IITHGHEDH GALP+++  L++  PIF+S  TL  
Sbjct  49   NQPGIDLVLPDYTYVLENEHKLRGIIITHGHEDHTGALPYLLQDLNNKVPIFSSKLTLGF  108

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L EF I  P + +  K       G F +E    THSIP   G+ L+  AGT++HTG
Sbjct  109  IEGKLSEFRIRAP-KFREVKGGSHVNLGCFSIEFFSTTHSIPGALGVFLKTPAGTVVHTG  167

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG   D  AL +  K+GV L+MSDSTN   PG T SE  V  S+L  I  A
Sbjct  168  DFKLDQTPIDGVTPDYGALAKFGKQGVDLLMSDSTNATVPGFTKSEAEVGPSILHAIKNA  227

Query  23   TGRI  12
             GR+
Sbjct  228  KGRV  231



>ref|WP_027098291.1| ribonuclease J [Clostridium paraputrificum]
Length=563

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  + PD  F+++   K++ + ITHGHEDHIGALP+++  L+   P++ +  TL L
Sbjct  53   DLYGIDLVIPDITFLKRNKDKVKGIFITHGHEDHIGALPYILKELN--VPVYGTRLTLGL  110

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L E  +     L V +         F++E IR  HSI D C L L    G I+HTG
Sbjct  111  IETKLTEHKMLNDCTLNVVEQGETVKLNNFKIEFIRTNHSIADSCALALHTPIGVIIHTG  170

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D K+D +P+DG V D     EL K+GV L+M+DSTNV  PG T+SE+ + ++L R+ + A
Sbjct  171  DIKVDYTPIDGKVIDLGRFAELGKKGVLLLMADSTNVTHPGHTMSESSLGETLNRYFTKA  230

Query  23   TGRII  9
            +GRII
Sbjct  231  SGRII  235



>ref|WP_041774969.1| ribonuclease J [Leptospirillum ferrooxidans]
Length=553

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  ++++   K+ A+ +THGHEDHIGA+P+ +   +   PIF ++ TL L
Sbjct  43   DLLGIDLIIPDFSYLKENRKKVLALFLTHGHEDHIGAVPYFLREFN--VPIFGTALTLGL  100

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LK+      ++L   K R   T GPF VEPIR+THSI D     +  +AGTILHTG
Sbjct  101  LEGKLKQHKNITETKLVTLKPREACTMGPFSVEPIRITHSIADGVSFAITTEAGTILHTG  160

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D +P+DG  FD      L  +G+  +MSDSTN    G +LSE +VA+ L + IS A
Sbjct  161  DFKVDLTPIDGEHFDMHRFCALGDQGILCLMSDSTNSEKSGLSLSEALVAEPLHQLISMA  220

Query  23   TGRII  9
             GR+I
Sbjct  221  PGRVI  225



>dbj|BAM07398.1| metallo-beta-lactamase family protein [Leptospirillum ferrooxidans 
C2-3]
Length=566

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  ++++   K+ A+ +THGHEDHIGA+P+ +   +   PIF ++ TL L
Sbjct  56   DLLGIDLIIPDFSYLKENRKKVLALFLTHGHEDHIGAVPYFLREFN--VPIFGTALTLGL  113

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LK+      ++L   K R   T GPF VEPIR+THSI D     +  +AGTILHTG
Sbjct  114  LEGKLKQHKNITETKLVTLKPREACTMGPFSVEPIRITHSIADGVSFAITTEAGTILHTG  173

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D +P+DG  FD      L  +G+  +MSDSTN    G +LSE +VA+ L + IS A
Sbjct  174  DFKVDLTPIDGEHFDMHRFCALGDQGILCLMSDSTNSEKSGLSLSEALVAEPLHQLISMA  233

Query  23   TGRII  9
             GR+I
Sbjct  234  PGRVI  238



>ref|WP_013361695.1| ribonuclease J [[Clostridium] sticklandii]
 emb|CBH21602.1| ribonuclease J1 [ [[Clostridium] sticklandii]
Length=554

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ K   KI+ +++THGHEDHIGA+P+V+  LD   PI+  +  + L++
Sbjct  47   LGIDIVIPDITYLIKNREKIKGLVLTHGHEDHIGAIPYVLKKLD--IPIYGPNLAIGLLE  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +   S L V     +   G FEVE +RVTHSIPD C L +    GTI HTGD+
Sbjct  105  IKLKEHRLSNNS-LNVVNPGSKIKLGNFEVEFVRVTHSIPDACALAITTGVGTIFHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   + E+  +GV LMM +STNV  PG TLSE+ V  +L    S AT 
Sbjct  164  KVDYTPIDGQVMDLHRIAEIGSKGVLLMMGESTNVERPGYTLSESNVGHTLDEIFSEATS  223

Query  17   RII  9
            RI+
Sbjct  224  RIL  226



>gb|EAY57343.1| Metallo-beta-lactamase family protein [Leptospirillum rubarum]
 gb|EIJ77432.1| Metallo-beta-lactamase family protein [Leptospirillum sp. Group 
II 'C75']
 gb|AFS53142.1| putative hydrolase of the metallo-beta-lactamase superfamily 
[Leptospirillum ferriphilum ML-04]
Length=562

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  F+++  +++ A+ +THGHEDHIGA+P+ +   D   P+F +  TL L
Sbjct  52   DLLGIDLIIPDMTFLKENRNRLLALFLTHGHEDHIGAIPYFLREFD--VPVFGTPLTLGL  109

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ ++++     P RL   + R ++T GPF  EPIR+THSI D     +  +AGTILHTG
Sbjct  110  VEGKVRQHKSLPPPRLVSIRPREKYTVGPFTFEPIRITHSIADGVAFAITTEAGTILHTG  169

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+D   FD   L  L +EGV  ++SDSTN    G +LSE  V + L + IS A
Sbjct  170  DFKIDLTPIDNEHFDMHRLCSLGEEGVLCLISDSTNSEKEGLSLSERQVTEPLEQMISQA  229

Query  23   TGRII  9
             GR+I
Sbjct  230  PGRVI  234



>ref|WP_038506823.1| MULTISPECIES: ribonuclease J [Leptospirillum]
 gb|AIA30236.1| ribonuclease J [Leptospirillum ferriphilum YSK]
Length=555

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  F+++  +++ A+ +THGHEDHIGA+P+ +   D   P+F +  TL L
Sbjct  45   DLLGIDLIIPDMTFLKENRNRLLALFLTHGHEDHIGAIPYFLREFD--VPVFGTPLTLGL  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ ++++     P RL   + R ++T GPF  EPIR+THSI D     +  +AGTILHTG
Sbjct  103  VEGKVRQHKSLPPPRLVSIRPREKYTVGPFTFEPIRITHSIADGVAFAITTEAGTILHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+D   FD   L  L +EGV  ++SDSTN    G +LSE  V + L + IS A
Sbjct  163  DFKIDLTPIDNEHFDMHRLCSLGEEGVLCLISDSTNSEKEGLSLSERQVTEPLEQMISQA  222

Query  23   TGRII  9
             GR+I
Sbjct  223  PGRVI  227



>ref|WP_006721181.1| beta-lactamase [Collinsella stercoris]
 gb|EEA90292.1| hypothetical protein COLSTE_01542 [Collinsella stercoris DSM 
13279]
Length=559

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 113/184 (61%), Gaps = 1/184 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            ++ G+  + PD  ++ +  HK+  +IITHGHEDH GALP+++  L++  PIF+S  TL  
Sbjct  49   NQPGIDLVLPDYTYVLENEHKLRGIIITHGHEDHTGALPYLLQDLNNKVPIFSSKLTLGF  108

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L EF I  P + +  K       G F +E    THSIP   G+ L+  AGT++HTG
Sbjct  109  IEGKLSEFRIRAP-KFREVKGGSHINLGCFSIEFFSTTHSIPGALGVFLKTPAGTVVHTG  167

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG   D  A+ +  K+GV L+MSDSTN   PG T SE  V  SLL  I  A
Sbjct  168  DFKLDQTPIDGVTPDYGAIAKFGKQGVDLLMSDSTNATVPGFTKSEAEVGPSLLHIIKNA  227

Query  23   TGRI  12
             GR+
Sbjct  228  KGRV  231



>ref|WP_041670664.1| ribonuclease J [Acetobacterium woodii]
Length=546

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 112/184 (61%), Gaps = 2/184 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
             G+  + PD  +I +   K++ V+ITHGHEDHIG L +++  +D   PI+A+ FT+ LI 
Sbjct  40   FGIDIVLPDFNYILENQEKVKGVVITHGHEDHIGGLVYLLKKID--IPIYATKFTMGLID  97

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            K+LKE  +   +   + K + R   G F VE IRV HSI D  GL ++C A T++HTGD+
Sbjct  98   KKLKEHGLLTKTTRIIVKPKDRIDIGGFNVEFIRVNHSIADAVGLCIKCAAATVVHTGDF  157

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID  P+ G + D +   ++  +GV L+MSDSTNV S G T SE+ V  +L      A G
Sbjct  158  KIDYHPIGGEIIDLQRFAKIGSQGVDLLMSDSTNVESAGFTPSESTVGPTLYNLFRGAKG  217

Query  17   RIIA  6
            RII 
Sbjct  218  RIIV  221



>ref|WP_025209063.1| ribonuclease J [Hippea sp. KM1]
Length=551

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 116/186 (62%), Gaps = 3/186 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  +I +   K++A+I+TH HEDH+GA+P+++  L+   PI+ +  TL L
Sbjct  42   DMLGVDIVIPDFSYIYENKDKLKALILTHAHEDHVGAIPYLLQNLN--IPIYGTKLTLGL  99

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +K +LKEF+I     +++ +  R+F  G FE+EPIR THSI D  G  +  D G I+HTG
Sbjct  100  VKAKLKEFNITNVKFIEI-EPSRKFRIGDFEIEPIRTTHSIVDGVGFAITTDVGVIIHTG  158

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID++P+DG  FD     E   +GV L++SDSTN    G T SE  +    L   S+A
Sbjct  159  DFKIDQTPVDGKPFDMLKFSEYGSKGVKLLLSDSTNATVRGFTGSEKEIKKGFLSIFSSA  218

Query  23   TGRIIA  6
             GRI+ 
Sbjct  219  KGRILV  224



>gb|EDZ38560.1| Metallo-beta-lactamase family protein [Leptospirillum sp. Group 
II '5-way CG']
 gb|KGA93092.1| Zn-dependent hydrolase [Leptospirillum ferriphilum]
Length=562

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  ++++  +++ A+ +THGHEDHIGA+P+ +   D   P+F +  TL L
Sbjct  52   DLLGIDLIIPDMTYLKENRNRLLALFLTHGHEDHIGAIPYFLREFD--VPVFGTPLTLGL  109

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ ++++     P RL   + R ++T GPF  EPIR+THSI D     +  +AGTILHTG
Sbjct  110  VEGKVRQHKSLPPPRLVSIRPREKYTVGPFTFEPIRITHSIADGVAFAIMTEAGTILHTG  169

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+D   FD   L  L +EGV  ++SDSTN    G +LSE  V + L + IS A
Sbjct  170  DFKIDLTPIDNEHFDMHRLCSLGEEGVLCLISDSTNSEKEGLSLSERQVTEPLEQMISQA  229

Query  23   TGRII  9
             GR+I
Sbjct  230  PGRVI  234



>ref|WP_028307303.1| ribonuclease J [Desulfitibacter alkalitolerans]
Length=554

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +   K++ +I+THGHEDHIGALP+++  LD   P++ +  TL L+K
Sbjct  47   LGVDVVIPDFTYLIENREKVKGIILTHGHEDHIGALPFILKELD--VPVYGTKLTLGLVK  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   ++L + K R     G F++E  RV+HSI D  GL +    GTILHTGD+
Sbjct  105  TKLKESGIN-NAQLNIIKPRDNIHIGAFKIEFFRVSHSIADSIGLAVHTPVGTILHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG+V D   L ++ ++GV +M+SDSTN   PG T+SE  V ++       + G
Sbjct  164  KVDHTPVDGDVMDFARLSQIGEKGVLVMLSDSTNAQRPGYTMSEKAVGETFDEIFRNSQG  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_036083188.1| ribonuclease J [Leptospirillum ferriphilum]
Length=555

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  I PD  ++++  +++ A+ +THGHEDHIGA+P+ +   D   P+F +  TL L
Sbjct  45   DLLGIDLIIPDMTYLKENRNRLLALFLTHGHEDHIGAIPYFLREFD--VPVFGTPLTLGL  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ ++++     P RL   + R ++T GPF  EPIR+THSI D     +  +AGTILHTG
Sbjct  103  VEGKVRQHKSLPPPRLVSIRPREKYTVGPFTFEPIRITHSIADGVAFAIMTEAGTILHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+D   FD   L  L +EGV  ++SDSTN    G +LSE  V + L + IS A
Sbjct  163  DFKIDLTPIDNEHFDMHRLCSLGEEGVLCLISDSTNSEKEGLSLSERQVTEPLEQMISQA  222

Query  23   TGRII  9
             GR+I
Sbjct  223  PGRVI  227



>ref|WP_022408182.1| hypothetical protein [Clostridium sp. CAG:354]
 emb|CDE10437.1| putative uncharacterized protein [Clostridium sp. CAG:354]
Length=618

 Score =   158 bits (399),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 81/185 (44%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++EK   KI A+IITHGHEDHIGA+P+++  ++   PI+A+  T  L
Sbjct  108  DMLGIDLVIPDISYLEKNKDKIRALIITHGHEDHIGAIPYLLKKIN--VPIYATRLTCGL  165

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L+E  +   ++L   K      AG F VE IR +HSIPD   L ++  AGT++HTG
Sbjct  166  IRNKLEEHKLVKSTKLVEVKQGEVVKAGKFSVEFIRSSHSIPDSVALAIKSPAGTVIHTG  225

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D   L EL  EGV  +MSDSTN    G T+SE  V D   R     
Sbjct  226  DFKIDYTPIDGQIMDFGRLAELGNEGVLALMSDSTNSERKGYTMSEKTVGDVFERLFQGC  285

Query  23   TGRII  9
              RI+
Sbjct  286  RKRIV  290



>ref|WP_034132436.1| ribonuclease J [Peptococcaceae bacterium BICA1-8]
Length=555

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 1/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +  + I+ +++THGHEDHIGALP+V+  LD D PIF +  TL ++ 
Sbjct  46   LGIDVVIPDITYLIENRNMIKGIVLTHGHEDHIGALPYVLRDLD-DVPIFGTKLTLGILG  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE +     +L V K R     G F++E  +V+HSIPD  GL +    GTILHTGD+
Sbjct  105  GKLKEANFSSRVKLNVVKPRDIINLGSFKIEFFKVSHSIPDAVGLGIHTPVGTILHTGDF  164

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG V D   + +   EGV +++SDSTNV  PG T+SE VV  +   +   A  
Sbjct  165  KLDQTPVDGKVADFNRIAQFGAEGVLVLLSDSTNVERPGFTMSEKVVGQNFDDNFRLAKE  224

Query  17   RII  9
            RII
Sbjct  225  RII  227



>ref|WP_035377430.1| ribonuclease J [Fervidicella metallireducens]
 gb|EYE89672.1| ribonuclease J [Fervidicella metallireducens AeB]
Length=554

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
             GV  + PD  ++ K   K++ +++THGHEDHIGALP+++  L+   P++ +  TL +++
Sbjct  46   FGVDIVIPDVSYLIKNKDKVKGIVLTHGHEDHIGALPYILKQLN--VPVYGTKLTLGIVE  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   S+L+V + +     G  +VE IR +HSI D C L +    G I+HTGD+
Sbjct  104  TKLKEHGILRESQLRVVQPKDVIVFGDVKVEFIRNSHSIADSCSLAIHTPVGIIVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG V D   L EL KEGV L+M+DSTNV  PG T+SE  V ++  +  S    
Sbjct  164  KIDFTPIDGAVMDITRLSELGKEGVLLLMADSTNVERPGHTMSERAVGETFEKIFSDTKQ  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_021776294.1| Lipid-A-disaccharide synthase protein [alpha proteobacterium 
RS24]
 gb|ERL47276.1| Lipid-A-disaccharide synthase protein [alpha proteobacterium 
RS24]
Length=558

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 116/184 (63%), Gaps = 2/184 (1%)
 Frame = -1

Query  560  ELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELI  381
            E G+  I PDT FIE+   +++ +++THGHEDHIGA+ ++ P L    P+FA+ FT EL+
Sbjct  55   EPGIDVILPDTRFIEQHKKRLKGLVLTHGHEDHIGAVAYLWPRLR--CPVFATPFTAELV  112

Query  380  KKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGD  201
            + +L E  +     L +     + T GPFE++ + +THSI + C L +R   G +LHTGD
Sbjct  113  RSKLLEAGLEDQVELNILPLNSQITLGPFEIDLVGLTHSIVEPCALAIRTPVGNLLHTGD  172

Query  200  WKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAAT  21
            WKID  P  G V D E L+   +EG+  ++ DSTNVLSPG + SE++VA+SL   +    
Sbjct  173  WKIDPDPQIGKVTDVEKLKAFGEEGIEAIICDSTNVLSPGTSGSESLVAESLAETVKHCK  232

Query  20   GRII  9
            GR++
Sbjct  233  GRVV  236



>ref|WP_027363779.1| ribonuclease J [Desulfotomaculum alcoholivorax]
Length=554

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++ +  + +  +++THGHEDHIGALP+V+  L+   P++ +  TL +
Sbjct  44   DLLGIDMVIPDITYLLENKNIVRGIVLTHGHEDHIGALPYVLRELN--VPVYGTRLTLGI  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +K++L+E  +   ++L   K R   + GPF++E IRV+HSIPD   L +    G I+HTG
Sbjct  102  LKEKLRERQMVDEAKLYCVKPRDIISIGPFKIEFIRVSHSIPDAVSLAIETPVGVIVHTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG V D   L +L ++GV +++SDSTNV  PG TLSE VV  +       A
Sbjct  162  DFKLDQTPVDGEVTDFNRLAQLGEKGVLVLLSDSTNVERPGYTLSEKVVGQTFDDSFRQA  221

Query  23   TGRII  9
              RII
Sbjct  222  NERII  226



>ref|WP_038144516.1| ribonuclease J [Veillonella sp. oral taxon 780]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 118/185 (64%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  ++ +   K+ AV+ITHGHEDHIG+L +++  ++   P++A++    L
Sbjct  48   DMLGVDIVIPDMSYLIEHKDKVRAVVITHGHEDHIGSLAYLLKEVN--VPVYATNLVCGL  105

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +LKE  +    +L+V K    F  G F+V  I+  HSIPD C + L    GT++HTG
Sbjct  106  IEGKLKEHHVKA-KKLQVVKAGDEFKIGCFKVGFIQTNHSIPDACAIFLETPVGTVVHTG  164

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG + D     EL  +GV  +MSDSTNV  PG T SE+ V  +++R ++ A
Sbjct  165  DFKVDQTPVDGKLMDVHKFAELGNKGVLALMSDSTNVEKPGFTPSESSVGPAIMRAVAEA  224

Query  23   TGRII  9
            TGR+I
Sbjct  225  TGRVI  229



>dbj|GAF26815.1| predicted hydrolase of the metallo-beta-lactamase superfamily 
[Moorella thermoacetica Y72]
Length=564

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +    ++ +I+THGHEDHIGALP+V+   D + P++ +  TL LI+
Sbjct  56   LGVDVVIPDYTYLLENRQMVKGIIVTHGHEDHIGALPYVLK--DLNVPVYGTKLTLALIQ  113

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE   F   RL+  K R     GPF VE I V+HSI D   L +    GTI+HT D+
Sbjct  114  AKLKEQGNFNGVRLQQVKPRDTLKIGPFRVEFIHVSHSIADTVALAIHTPVGTIVHTSDF  173

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG VFD     EL ++GV ++MSDSTNV  PG T+SE VV  +       A  
Sbjct  174  KIDYTPIDGEVFDFYKFAELGEKGVLVLMSDSTNVERPGFTMSERVVGGTFDEVFRRARE  233

Query  17   RII  9
            RII
Sbjct  234  RII  236



>ref|WP_025774532.1| ribonuclease J [Moorella thermoacetica]
Length=555

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +    ++ +I+THGHEDHIGALP+V+   D + P++ +  TL LI+
Sbjct  47   LGVDVVIPDYTYLLENRQMVKGIIVTHGHEDHIGALPYVLK--DLNVPVYGTKLTLALIQ  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE   F   RL+  K R     GPF VE I V+HSI D   L +    GTI+HT D+
Sbjct  105  AKLKEQGNFNGVRLQQVKPRDTLKIGPFRVEFIHVSHSIADTVALAIHTPVGTIVHTSDF  164

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG VFD     EL ++GV ++MSDSTNV  PG T+SE VV  +       A  
Sbjct  165  KIDYTPIDGEVFDFYKFAELGEKGVLVLMSDSTNVERPGFTMSERVVGGTFDEVFRRARE  224

Query  17   RII  9
            RII
Sbjct  225  RII  227



>ref|WP_011392583.1| ribonuclease J [Moorella thermoacetica]
 ref|YP_429926.1| hypothetical protein Moth_1069 [Moorella thermoacetica ATCC 39073]
 gb|ABC19383.1| conserved hypothetical protein [Moorella thermoacetica ATCC 39073]
Length=555

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +    ++ +I+THGHEDHIGALP+V+   D + P++ +  TL LI+
Sbjct  47   LGVDVVIPDYTYLLENRQMVKGIIVTHGHEDHIGALPYVLK--DLNVPVYGTKLTLALIQ  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE   F   RL+  K R     GPF VE I V+HSI D   L +    GTI+HT D+
Sbjct  105  AKLKEQGNFNGVRLQQVKPRDTLKIGPFRVEFIHVSHSIADTVALAIHTPVGTIVHTSDF  164

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG VFD     EL ++GV ++MSDSTNV  PG T+SE VV  +       A  
Sbjct  165  KIDYTPIDGEVFDFYKFAELGEKGVLVLMSDSTNVERPGFTMSERVVGGTFDEVFRRARE  224

Query  17   RII  9
            RII
Sbjct  225  RII  227



>ref|WP_012532397.1| ribonuclease J [Geobacter bemidjiensis]
 gb|ACH40963.1| metal-dependent hydrolase, beta-lactamase superfamily [Geobacter 
bemidjiensis Bem]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ + + +I A+++THGHEDHIGALP+V+   D + PI+ ++ TL  +K
Sbjct  50   LGIDVVIPDIGYLIERADRIRAILLTHGHEDHIGALPYVLR--DINPPIYGTALTLGFVK  107

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            ++LKEF +     L+V K R     G FEVE IRV HSI D C L L C  G ++HTGD+
Sbjct  108  EKLKEFELDQKVDLRVVKPRDTVQLGSFEVEFIRVAHSIVDGCALALSCPEGVVIHTGDF  167

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG + D        ++GV  + +DSTN+   G TLSE +V D+      A  G
Sbjct  168  KLDQTPVDGELTDLATFSRYGEKGVLALFADSTNIEREGYTLSERLVGDAFEEIFPACAG  227

Query  17   RII  9
            R+I
Sbjct  228  RVI  230



>ref|WP_022193582.1| uncharacterized protein [Clostridium sp. CAG:217]
 emb|CDB52094.1| uncharacterized protein BN539_00316 [Clostridium sp. CAG:217]
Length=590

 Score =   157 bits (396),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 76/173 (44%), Positives = 109/173 (63%), Gaps = 2/173 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++EK  HKI+ V++THGHEDHIG L +++  ++   PI+A+  T+ L
Sbjct  79   DLPGVDLVIPDFTYVEKNRHKIKGVLVTHGHEDHIGGLAFLLKRIN--VPIYATKLTIGL  136

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +LKE  +   ++L   + R   T G F +E I V HSIPD  GL +RC AG I+ TG
Sbjct  137  IQGKLKEHGLLNKAKLVEIRPRDNITLGAFNIEFIHVNHSIPDAVGLAIRCPAGVIIQTG  196

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSL  45
            D+KID +P+DG++ D     E  K+GV  ++SDSTN   PG T+SE  V +S 
Sbjct  197  DFKIDTTPVDGDMIDLARFAEYGKKGVLALLSDSTNAERPGYTMSERKVGESF  249



>ref|WP_026841106.1| ribonuclease J [Geobacter bremensis]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ + + +I A+++THGHEDHIGALP+V+   D + PI+ ++ TL  +K
Sbjct  50   LGIDVVIPDIGYLIERADRIRAILLTHGHEDHIGALPYVLR--DINPPIYGTALTLGFVK  107

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            ++LKEF +     L+V K R     G FEVE IRV HSI D C L L C  G ++HTGD+
Sbjct  108  EKLKEFELDQKVDLRVVKPRDTVQLGSFEVEFIRVAHSIVDGCALALSCPEGVVIHTGDF  167

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG + D        ++GV  + +DSTN+   G TLSE +V D+      A  G
Sbjct  168  KLDQTPVDGELTDLATFSRYGEKGVLALFADSTNIEREGYTLSERLVGDAFEEIFPACAG  227

Query  17   RII  9
            R+I
Sbjct  228  RVI  230



>gb|AFA47776.1| ribonuclease J [Acetobacterium woodii DSM 1030]
Length=579

 Score =   156 bits (395),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 79/183 (43%), Positives = 112/183 (61%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
             G+  + PD  +I +   K++ V+ITHGHEDHIG L +++  +D   PI+A+ FT+ LI 
Sbjct  73   FGIDIVLPDFNYILENQEKVKGVVITHGHEDHIGGLVYLLKKID--IPIYATKFTMGLID  130

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            K+LKE  +   +   + K + R   G F VE IRV HSI D  GL ++C A T++HTGD+
Sbjct  131  KKLKEHGLLTKTTRIIVKPKDRIDIGGFNVEFIRVNHSIADAVGLCIKCAAATVVHTGDF  190

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID  P+ G + D +   ++  +GV L+MSDSTNV S G T SE+ V  +L      A G
Sbjct  191  KIDYHPIGGEIIDLQRFAKIGSQGVDLLMSDSTNVESAGFTPSESTVGPTLYNLFRGAKG  250

Query  17   RII  9
            RII
Sbjct  251  RII  253



>ref|WP_011878267.1| ribonuclease J [Desulfotomaculum reducens]
 gb|ABO50457.1| beta-lactamase domain protein [Desulfotomaculum reducens MI-1]
Length=554

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   ++  +++THGHEDHIGALP+V+  ++   P++ S   L L++
Sbjct  46   LGIDIVIPDITYLLEHKEQVLGILLTHGHEDHIGALPYVLRQIN--VPVYGSKLALGLVQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE ++    +L   K R     GPF +E IRV+HSIPD   + +    GT+LHTGD+
Sbjct  104  GKLKEHNLLDQVKLHTVKPRDTIHIGPFRIEFIRVSHSIPDAMAIAIHTPVGTLLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D      L ++GV +MMSDSTNV  PG T+SE VV ++       A  
Sbjct  164  KIDQTPVDGEVIDLPRFAALGEKGVLVMMSDSTNVERPGYTMSERVVGNTFDETFRHAQE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_012032459.1| ribonuclease J [Pelotomaculum thermopropionicum]
 dbj|BAF59470.1| predicted hydrolase [Pelotomaculum thermopropionicum SI]
Length=554

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +    +  +++THGHEDHIGALP+V+  L    P++ +  TL L++
Sbjct  46   LGIDIVIPDISYLLENREIVRGIVLTHGHEDHIGALPYVLRQLK--VPVYGTKLTLGLLQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I+  + L   K R     GPF+VE IRV+HSIPD   + +    G +LHTGD+
Sbjct  104  GKLKEQGIYGEAALHTVKPRDSVQIGPFKVEFIRVSHSIPDAVAVAIHTPLGVVLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D + L +L ++GV +++SDSTN   PG T+SE VV ++        T 
Sbjct  164  KIDQTPVDGQVTDFQRLAQLGEKGVLVLLSDSTNAERPGYTMSERVVGNTFDETFRQTTD  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_013681062.1| ribonuclease J [Hippea maritima]
 gb|AEA33017.1| Ribocuclease J [Hippea maritima DSM 10411]
Length=551

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 114/185 (62%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  +I +   K+ A+I+TH HEDH+GA+P+++  ++   PI+ +  TL L
Sbjct  42   DMLGVDIVIPDFSYIYENKDKLRALILTHAHEDHVGAIPYLLQNIN--VPIYGTKLTLGL  99

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +K +LKEF I     +++ +  R+F  G FE+EPIR THSI D  G  +  D G I+HTG
Sbjct  100  VKAKLKEFKITNVQFVEI-EPSRKFQIGDFELEPIRTTHSIVDGVGFAITTDVGVIIHTG  158

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID++P+DG  FD     E   +GV L++SDSTN    G T SE  +    L   S+A
Sbjct  159  DFKIDQTPVDGKPFDMLKFSEYGSKGVKLLLSDSTNATVKGFTGSEKEIKRGFLDIFSSA  218

Query  23   TGRII  9
             GRI+
Sbjct  219  KGRIL  223



>ref|WP_013823559.1| ribonuclease J [Desulfotomaculum kuznetsovii]
 gb|AEG16048.1| Ribocuclease J [Desulfotomaculum kuznetsovii DSM 6115]
Length=554

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +    +  +++THGHEDHIGALP+V+  L+   PI+ +  TL L++
Sbjct  46   LGIDVVIPDITYLLENKDAVRGIVLTHGHEDHIGALPYVLKQLN--VPIYGTRLTLGLLQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +   + L+V K R   T GPF+VE IRV+HSIPD   + +    G I+HTGD+
Sbjct  104  GKLKEQGLAGEANLQVVKPRDTVTIGPFKVEFIRVSHSIPDAVAVAVHTPVGVIVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D     +L + GV +++SDSTNV  PG T+SE VV  +       A  
Sbjct  164  KIDQTPVDGEVTDFYRFAQLGERGVLVLLSDSTNVERPGYTMSERVVGATFDETFRQAKE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_035356824.1| ribonuclease J [Acetobacterium dehalogenans]
Length=572

 Score =   156 bits (394),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 79/185 (43%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  + PD  +I +   K++ V+ITHGHEDHIG L +++  ++   PI+A+ FT+ L
Sbjct  64   DMFGIDIVLPDFNYILENQDKVKGVVITHGHEDHIGGLVYLLKKIN--LPIYATKFTMGL  121

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I K+LKE  +   +   + K + R   G F VE IRV HSI D  GL ++C A T++HTG
Sbjct  122  IDKKLKEHGLLTKTTRIIVKPKERIDIGEFNVEFIRVNHSIADAVGLCIKCAAATVVHTG  181

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID  P+ G V D +   ++  +GV L+MSDSTNV   G T SE+ V  +L      A
Sbjct  182  DFKIDYHPIGGEVIDLQRFAKIGSQGVDLLMSDSTNVEGAGFTPSESTVGPTLYNLFRGA  241

Query  23   TGRII  9
             GRII
Sbjct  242  KGRII  246



>ref|WP_008413417.1| Ribonuclease J 1 [Desulfotomaculum hydrothermale]
 emb|CCO09404.1| Ribonuclease J 1 [Desulfotomaculum hydrothermale Lam5 = DSM 18033]
Length=554

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   ++  +++THGHEDHIGALP+V+  ++   P++ S   L L++
Sbjct  46   LGIDIVIPDITYLLEHKEQVLGILLTHGHEDHIGALPYVLRQIN--VPVYGSKLALGLVQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE ++    +L   K R     GPF+ E IRV+HSIPD   + +    GT+LHTGD+
Sbjct  104  GKLKEHNMLDQVQLNTVKPRDIIQIGPFKCEFIRVSHSIPDAMAIAIHTPVGTLLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D      L ++GV +M+SDSTNV  PG T+SE VV ++       AT 
Sbjct  164  KIDQTPVDGEVIDLPRFAALGEKGVLVMLSDSTNVERPGYTMSERVVGNTFDETFRNATE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_013841942.1| ribonuclease J [Desulfotomaculum ruminis]
 gb|AEG60179.1| RNA-metabolising metallo-beta-lactamase [Desulfotomaculum ruminis 
DSM 2154]
Length=554

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   ++ A+++THGHEDHIGALP+V+  ++   P++ S   L L+ 
Sbjct  46   LGIDIVIPDISYLIENRQQVRAILLTHGHEDHIGALPYVLRQIN--VPVYGSKLALGLVH  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +    +L   K R     GPF+ E IRV+HSIPD   + +    GT+LHTGD+
Sbjct  104  GKLKEHHMVDQVQLNTVKPRDTVQIGPFKAEFIRVSHSIPDAMAVAIHTPVGTLLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID++P+DG V D     +L ++GV +MMSDSTNV  PG T+SE VV ++       A  
Sbjct  164  KIDQTPVDGEVTDFHRFAQLGEKGVLVMMSDSTNVERPGYTMSERVVGNTFDETFRHAKE  223

Query  17   RII  9
            RI+
Sbjct  224  RIV  226



>ref|WP_020717484.1| hypothetical protein [Acidobacteriaceae bacterium KBS 96]
Length=555

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 107/167 (64%), Gaps = 2/167 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  F+EK + K+  +++THGHEDHIG +P+++  L+   P++ + FTL L++
Sbjct  45   LGVDIVTPDFSFLEKNAEKVRGLVLTHGHEDHIGGVPFLLGTLN--IPVYGTEFTLALVE  102

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            +RL+E  +   ++L + K  +R T GPFE+E I VTHSI     L +    G I+HTGD+
Sbjct  103  RRLEEHELLDTAKLNIVKAGQRITLGPFEIEFIHVTHSIVAAVALAITTPLGVIIHTGDF  162

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVV  57
            K+D +P D  +FD   L E  K GV L+MSDSTNV  PG T SE  V
Sbjct  163  KVDPTPTDNELFDLHTLAEYGKRGVLLLMSDSTNVDRPGYTESERAV  209



>gb|EKD92655.1| hypothetical protein ACD_28C00372G0009 [uncultured bacterium]
Length=661

 Score =   156 bits (394),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 77/185 (42%), Positives = 115/185 (62%), Gaps = 1/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++ +    I  V +THGH DHIG +P+++P L     ++ +  T+  
Sbjct  144  DMLGIDYVLPDVSYLMERKQNIRGVFLTHGHLDHIGGIPYLLPRLGFPM-VYGAPLTMGF  202

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +KK+L+EF +   +R +VF  + +F  G FEV   RV HSIPD   +V+ C AG I+HTG
Sbjct  203  VKKQLEEFRLNALARTRVFDPKEKFRLGAFEVSFFRVNHSIPDAVAVVIDCPAGRIVHTG  262

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K D SP D    D + +  + K+GV +++SDSTN L PG+T SE V+A++L   I  A
Sbjct  263  DFKFDFSPADQRPADFQEIATVGKKGVMVLVSDSTNSLEPGQTTSEKVIAENLDDIIRKA  322

Query  23   TGRII  9
            TGR+I
Sbjct  323  TGRLI  327



>ref|WP_022487813.1| rNA-metabolising metallo-beta-lactamase [Acidaminococcus sp. 
CAG:542]
 emb|CDE93707.1| rNA-metabolising metallo-beta-lactamase [Acidaminococcus sp. 
CAG:542]
Length=557

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PDT F+ +   K +A+ +THGHEDHIGALP+V+   D D P++ +  TL +
Sbjct  48   DMLGIDLVIPDTTFLMENKEKFKAIFLTHGHEDHIGALPYVMK--DFDVPVYGTPLTLGI  105

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +  RLKE  +   S+ K+ K      AG F VE IRV HSIPD   L +    G I+HTG
Sbjct  106  LSGRLKENGVS-DSKCKMVKPGATVRAGAFRVEFIRVNHSIPDAVALAIHTPVGVIVHTG  164

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K D++P+DG V D   L E+ ++GV L+MSDSTN+   G T SE  V  +L      A
Sbjct  165  DYKFDQTPVDGQVTDYAKLSEVGRKGVLLLMSDSTNIERTGYTPSEKSVGKTLDEQFRMA  224

Query  23   TGRII  9
              R+I
Sbjct  225  RNRVI  229



>ref|WP_034107548.1| ribonuclease J [Desulfotomaculum sp. BICA1-6]
Length=554

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++ +  + +  +++THGHEDHIGALP+V+  LD   P++ +  TL +
Sbjct  44   DLLGIDIVIPDITYLLENKNIVRGIVLTHGHEDHIGALPYVLKQLD--VPVYGTGLTLGI  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++++L+E  +   ++L   K R     GPF+VE IRV+HSIPD   L +    G I+HTG
Sbjct  102  LREKLRERHLADSTKLHCVKPRDVIQVGPFKVEFIRVSHSIPDAVALAIETPVGIIVHTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID++P+DG V D   L +L   GV  M+SDSTNV  PG T+SE VV  +       A
Sbjct  162  DFKIDQTPVDGEVTDFYRLAQLGDRGVLAMLSDSTNVERPGYTMSERVVGQTFDDTFRKA  221

Query  23   TGRII  9
              RII
Sbjct  222  DERII  226



>ref|WP_011698454.1| ribonuclease J [Syntrophobacter fumaroxidans]
 gb|ABK17284.1| beta-lactamase domain protein [Syntrophobacter fumaroxidans MPOB]
Length=561

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 117/186 (63%), Gaps = 2/186 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +++ A+++THGHEDHIGA+P+++  +    PI+A++ TL L
Sbjct  50   DMLGIDIVIPDFTYLQKNRNRVRALLVTHGHEDHIGAIPFLLREVP--VPIYATTLTLAL  107

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            IK++LKE  +   S L   + R     GPF++E I+V HSIPD  GL +R   G I+H+G
Sbjct  108  IKEKLKEHGLLERSELCRVEPRETIGIGPFDIEFIQVCHSIPDGVGLAIRTPVGVIIHSG  167

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG  FD     +  ++GV  + +DSTNV  PG TLSE  V  +L       
Sbjct  168  DFKIDNTPVDGRRFDMARFGKYGEQGVLALFADSTNVERPGYTLSEKDVGATLRDIFREC  227

Query  23   TGRIIA  6
            +GRII 
Sbjct  228  SGRIIV  233



>gb|EGS38404.1| hypothetical protein HMPREF9200_0908 [Veillonella sp. oral taxon 
780 str. F0422]
Length=639

 Score =   155 bits (392),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 77/185 (42%), Positives = 118/185 (64%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  ++ +   K+ AV+ITHGHEDHIG+L +++  ++   P++A++    L
Sbjct  129  DMLGVDIVIPDMSYLIEHKDKVRAVVITHGHEDHIGSLAYLLKEVN--VPVYATNLVCGL  186

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +LKE  +    +L+V K    F  G F+V  I+  HSIPD C + L    GT++HTG
Sbjct  187  IEGKLKEHHV-KAKKLQVVKAGDEFKIGCFKVGFIQTNHSIPDACAIFLETPVGTVVHTG  245

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG + D     EL  +GV  +MSDSTNV  PG T SE+ V  +++R ++ A
Sbjct  246  DFKVDQTPVDGKLMDVHKFAELGNKGVLALMSDSTNVEKPGFTPSESSVGPAIMRAVAEA  305

Query  23   TGRII  9
            TGR+I
Sbjct  306  TGRVI  310



>ref|WP_015839245.1| ribonuclease J [Geobacter sp. M21]
 gb|ACT20073.1| beta-lactamase domain protein [Geobacter sp. M21]
Length=558

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   +I A+++THGHEDHIGALP+V+   D + PI+ ++ TL  +K
Sbjct  50   LGIDVVIPDIGYLIERVDRIRAILLTHGHEDHIGALPYVLR--DINPPIYGTALTLGFVK  107

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            ++LKEF +     L+V K R     G FEVE IRV HSI D C L + C  G ++HTGD+
Sbjct  108  EKLKEFELDQKVDLRVVKPRDTVQLGSFEVEFIRVAHSIVDGCALAISCPEGVVIHTGDF  167

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG + D        ++GV  + +DSTN+   G TLSE +V D+      A +G
Sbjct  168  KLDQTPVDGELTDLATFSRYGEKGVLALFADSTNIEREGYTLSERLVGDAFEEIFPACSG  227

Query  17   RII  9
            R+I
Sbjct  228  RVI  230



>ref|WP_035311834.1| ribonuclease J [Clostridium sp. HMP27]
 gb|KGK81724.1| ribonuclease J [Clostridium sp. HMP27]
Length=554

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++     K++   ITHGHEDHIG+LP+++  L++  PI+ ++ TL +
Sbjct  44   DMYGVDLVIPDITYLLNNKEKVKGFFITHGHEDHIGSLPYILKQLNA--PIYGTNLTLGM  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L+E ++    +L V  T          +E IRVTHSI D C L +    G ILHTG
Sbjct  102  IRTKLEEHALISDCQLNVVNTSDIIKLENLSIEFIRVTHSIADSCALAIHTPIGVILHTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG V D E +  L KEGV L+M+DSTNV   G T+SE  + ++  R  + A
Sbjct  162  DFKIDYTPIDGKVMDLERISTLGKEGVLLLMADSTNVERIGHTISEKSIGETFNRVFANA  221

Query  23   TGRII  9
             GR+I
Sbjct  222  EGRVI  226



>ref|WP_027308309.1| ribonuclease J [Caloramator sp. ALD01]
Length=554

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 2/184 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
             G+  + PD  ++ K  +K++ +++THGHEDHIGALP+V+  L+   P++ +  TL +++
Sbjct  46   FGIDIVIPDISYLLKNKNKVKGIVLTHGHEDHIGALPYVLKQLN--VPVYGTRLTLGIVE  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +     LKV K     T     VE I+ +HSI D C L +    GTILHTGD+
Sbjct  104  TKLKEHGLLSDCTLKVVKHNDVITFNDLSVEFIKNSHSIADSCSLAIHTPLGTILHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   L EL ++GV L+++DSTNV  PG T+SE  V ++  +  +   G
Sbjct  164  KVDYTPIDGVVMDFARLAELGRQGVILLLADSTNVERPGYTMSERTVGETFQKIFNETRG  223

Query  17   RIIA  6
            RII 
Sbjct  224  RIIV  227



>ref|WP_038268157.1| ribonuclease J [[Clostridium] litorale]
 gb|KDR94186.1| ribonuclease J 1 [ [[Clostridium] litorale DSM 5388]
Length=554

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ K   K++A+ +THGHEDHIGALP+V+  ++   PI+ +  TL L++
Sbjct  47   LGIDIVIPDITYLLKNKDKVKAIFLTHGHEDHIGALPYVLKKIN--VPIYGTKLTLGLVE  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I    +L+V K  +      FEVE IRV HSIPD C + +  D G + HTGD+
Sbjct  105  FKLKEHKIN-NLKLQVVKPGQNIKKSNFEVEFIRVNHSIPDACAIAVHTDMGILFHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+D ++ D   + E+  +GV L+M+DSTNV  PG T+SE  V  +L      A  
Sbjct  164  KIDHTPIDKDLMDFGRIAEIGSKGVLLLMADSTNVERPGATMSERTVGSNLDEIFGGAKN  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_022370752.1| hypothetical protein [Eggerthella sp. CAG:368]
 emb|CDD67465.1| putative uncharacterized protein [Eggerthella sp. CAG:368]
Length=618

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 113/185 (61%), Gaps = 1/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  I PD  ++ + + K+  +IITHGHEDH G+LP+++  LD   PI+A+  TL L
Sbjct  109  DHPGVDLILPDYTYVLEHADKLRGIIITHGHEDHTGSLPYLLKDLDKQVPIYATKLTLGL  168

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +LKE  I   ++L   K  ++   G    E   V HSIPD  G+     AG +LHTG
Sbjct  169  IEGKLKEHKI-KNAKLCEIKPGQKIKLGCITAEFFSVNHSIPDAVGVFFTSPAGNVLHTG  227

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D+SP+DG   D  AL   +K+GVTLMMSDSTN  +P  T SE  V  +L + IS A
Sbjct  228  DFKLDQSPIDGVHTDFGALARFAKQGVTLMMSDSTNATNPNFTPSEAEVGKTLDKIISTA  287

Query  23   TGRII  9
             GR+I
Sbjct  288  KGRVI  292



>ref|WP_033045158.1| ribonuclease J [Clostridium botulinum]
Length=548

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+ A++   P++ +  TL +
Sbjct  38   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRAVN--VPVYGTKLTLGI  95

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  96   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  155

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  156  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  215

Query  23   TGRII  9
             GRII
Sbjct  216  KGRII  220



>ref|WP_006716055.1| ribonuclease J [Desulfitobacterium metallireducens]
 gb|AHF07413.1| ribonuclease J [Desulfitobacterium metallireducens DSM 15288]
Length=554

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 114/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++EK   KI+ + +THGHEDHIG LP+++P L+   P++A+  T+ L++
Sbjct  42   LGIDLVIPDISYLEKRKDKIKGIFVTHGHEDHIGGLPFILPRLN--VPVYATKLTIGLVR  99

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +++E   +  S  +V +  +   AG FEVE  RVTHSIPD  G  L    G +++TGD+
Sbjct  100  AKVQERGGYPDSLFRVLEPGKPVQAGEFEVEAFRVTHSIPDAVGYSLLSPVGRVIYTGDF  159

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG+  D   L E  +EGV  ++ DSTN   PG T+SE VV  +L    + A G
Sbjct  160  KVDYTPIDGHEMDLSKLAEWGQEGVLALLCDSTNAERPGMTMSERVVGKTLRDWFARAEG  219

Query  17   RII  9
            +II
Sbjct  220  KII  222



>ref|WP_022744617.1| ribonuclease J 1 [Clostridium saccharobutylicum]
 gb|AGX42335.1| ribonuclease J 1 [Clostridium saccharobutylicum DSM 13864]
Length=555

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  + PD  ++ K S KI+ + +THGHEDHIGALP+V+  L+   P++ +  TL +
Sbjct  45   DMFGIDIVIPDISYLLKNSEKIKGIFLTHGHEDHIGALPYVLKQLN--VPVYGTKLTLGI  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +   + L   K +         VE I+  HSI D   + +    G +LHTG
Sbjct  103  VETKLKEHGLLSSTELIRVKPKDIIKLSSVSVEFIKTNHSIADSVAIAIHTPLGVVLHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D   L EL ++GV +MM+DSTNV  PG T++E VV D+ LR  + A
Sbjct  163  DFKIDYTPIDGEMMDFARLAELGRKGVLVMMADSTNVERPGYTMTERVVGDTFLRLFNKA  222

Query  23   TGRII  9
             GRII
Sbjct  223  NGRII  227



>ref|WP_041350115.1| ribonuclease J [Clostridium botulinum]
 gb|KGO14447.1| ribonuclease J [Clostridium botulinum]
 gb|KIN80342.1| ribonuclease J [Clostridium botulinum]
Length=548

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+ A++   P++ +  TL +
Sbjct  38   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRAVN--VPVYGTKLTLGI  95

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  96   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  155

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  156  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  215

Query  23   TGRII  9
             GRII
Sbjct  216  KGRII  220



>ref|WP_012938379.1| ribonuclease J [Acidaminococcus fermentans]
 gb|ADB47390.1| RNA-metabolising metallo-beta-lactamase [Acidaminococcus fermentans 
DSM 20731]
Length=558

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PDT F+ +   K +A+ +THGHEDHIGALP+V+   D D P++ +  TL +
Sbjct  49   DMLGIDLVIPDTTFLMENKDKFKAIFLTHGHEDHIGALPYVMK--DFDVPVYGTPLTLGI  106

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +  RLKE  +   S+ K+ K      AG F VE IRV HSIPD   L +    G I+HTG
Sbjct  107  LSGRLKENGVS-DSKCKMVKPGATVRAGAFRVEFIRVNHSIPDAVALAIHTPVGVIVHTG  165

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K D++P+DG V D   L E+ ++GV L+MSDSTN+   G T SE  V  +L      A
Sbjct  166  DYKFDQTPVDGQVTDYAKLAEVGRKGVLLLMSDSTNIERTGYTPSEKSVGKTLDEQFRLA  225

Query  23   TGRII  9
              R+I
Sbjct  226  RNRVI  230



>ref|WP_021951059.1| uncharacterized protein [Clostridium sp. CAG:678]
 emb|CCY67953.1| uncharacterized protein BN753_01582 [Clostridium sp. CAG:678]
Length=593

 Score =   155 bits (391),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 76/183 (42%), Positives = 112/183 (61%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  F+E+ + KI+ ++ITHGHEDHIG +P+++  ++   PI+++  T+ LIK
Sbjct  84   LGVDSVIPDFTFVEENADKIKGLLITHGHEDHIGGIPYLLKKIN--VPIYSTRLTIGLIK  141

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +   ++L+      +   G F VE I V HSIPD  GL + C AGTI+HTGD+
Sbjct  142  GKLKEHGLLDKAKLREISPSDKIKLGKFTVEFIHVNHSIPDAVGLAISCAAGTIIHTGDF  201

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG++ +     E   +GV  ++ DSTN   PG T+SE  V +S L     A  
Sbjct  202  KIDTTPVDGDMINLPRFAEYGTKGVLALLQDSTNAERPGYTMSEKKVGESFLNLFRKAGK  261

Query  17   RII  9
            R I
Sbjct  262  RRI  264



>ref|WP_041537920.1| ribonuclease J [Carboxydothermus hydrogenoformans]
Length=552

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   K++AV++THGHEDHIG +P+ +   D   P++ +  TL L+ 
Sbjct  45   LGIDMVIPDMSYLIENKEKVKAVLLTHGHEDHIGGMPYFLKQFD--VPVYGTRLTLGLLS  102

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   S L V   R     GPF++E I+V+HSIPD  G+ +    GT++HTGD+
Sbjct  103  AKLKEAGIPRAS-LNVVAPRDVLNIGPFKIEFIKVSHSIPDTVGIAVHTPVGTVVHTGDF  161

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   L EL ++GV ++MSDSTN   PG TLSE  V ++       A G
Sbjct  162  KLDPTPVDGKVTDFYKLAELGEKGVLVLMSDSTNAERPGFTLSEKTVGNTFEETFRVAEG  221

Query  17   RII  9
            RII
Sbjct  222  RII  224



>gb|ABB14068.1| metallo-beta-lactamase family protein [Carboxydothermus hydrogenoformans 
Z-2901]
Length=554

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   K++AV++THGHEDHIG +P+ +   D   P++ +  TL L+ 
Sbjct  47   LGIDMVIPDMSYLIENKEKVKAVLLTHGHEDHIGGMPYFLKQFD--VPVYGTRLTLGLLS  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   S L V   R     GPF++E I+V+HSIPD  G+ +    GT++HTGD+
Sbjct  105  AKLKEAGIPRAS-LNVVAPRDVLNIGPFKIEFIKVSHSIPDTVGIAVHTPVGTVVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   L EL ++GV ++MSDSTN   PG TLSE  V ++       A G
Sbjct  164  KLDPTPVDGKVTDFYKLAELGEKGVLVLMSDSTNAERPGFTLSEKTVGNTFEETFRVAEG  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_020735078.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008149550.1| hypothetical protein SCE1572_15640 [Sorangium cellulosum So0157-2]
 gb|AGP35812.1| hypothetical protein SCE1572_15640 [Sorangium cellulosum So0157-2]
Length=529

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 113/183 (62%), Gaps = 5/183 (3%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV    PD  ++ + +  ++AVI+THGHEDHIG LP ++   +   P++ + FTL L++
Sbjct  24   LGVEVAIPDLSYV-REAGGVDAVIVTHGHEDHIGGLPSLL--REFPVPVYGTRFTLRLVR  80

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
            +RL E  I VP  L+  + +R FTAGPF  EP+RVTHSIPD  G  +    G ++HTGD+
Sbjct  81   ERLVEHGIDVP--LREVEPQRHFTAGPFRAEPLRVTHSIPDAVGFAIETGEGILIHTGDY  138

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+ G   D     E  + GV  ++SDSTN    G ++SET VA+  LR    A G
Sbjct  139  KIDLTPVGGERLDLGRFAEYGRAGVAALLSDSTNSERDGWSVSETAVAEGFLRPFREAKG  198

Query  17   RII  9
            RI+
Sbjct  199  RIL  201



>ref|WP_012047895.1| ribonuclease J [Clostridium botulinum]
 ref|YP_001255055.1| RNA-metabolizing metallo-beta-lactamase [Clostridium botulinum 
A str. ATCC 3502]
 emb|CAL84117.1| metallo-beta-lactamase superfamily protein [Clostridium botulinum 
A str. ATCC 3502]
Length=567

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+ A++   P++ +  TL +
Sbjct  57   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRAVN--VPVYGTKLTLGI  114

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  115  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  174

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  175  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  234

Query  23   TGRII  9
             GRII
Sbjct  235  KGRII  239



>ref|WP_003385808.1| ribonuclease J [Clostridium botulinum]
 ref|YP_001388271.1| RNA-metabolizing metallo-beta-lactamase [Clostridium botulinum 
A str. Hall]
 gb|ABS32630.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum A str. ATCC 19397]
 gb|ABS37147.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum A str. Hall]
 gb|EDT80607.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum NCTC 2916]
 gb|ACO83705.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum A2 str. Kyoto]
 emb|CBZ04466.1| Zn-dependent hydrolase, RNA-metabolising, CPSF 100 kDa analog 
[Clostridium botulinum H04402 065]
 gb|EKN42302.1| Zn-dependent hydrolase, RNA-metabolising protein [Clostridium 
botulinum CFSAN001627]
 gb|EPS55707.1| Zn-dependent hydrolase [Clostridium botulinum Af84]
 gb|KEJ02678.1| ribonuclease J [Clostridium botulinum A2B3 87]
 dbj|BAQ14221.1| putative RNA-metabolizing metallo-beta-lactamase [Clostridium 
botulinum]
Length=569

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+ A++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRAVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>ref|WP_035348753.1| ribonuclease J [Edaphobacter aggregans]
Length=554

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 104/167 (62%), Gaps = 2/167 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +   K+ A+++THGHEDHIG LPW++  L+   PI+ + FTL L++
Sbjct  45   LGVDIVVPDISYLTENRDKVRAIVLTHGHEDHIGGLPWILSELN--VPIYGTEFTLALVE  102

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +L+E ++   + L       R T GPF + PIRVTHS+ DC  L +    G +LHTGD+
Sbjct  103  GKLEEHNLLDDAELNEIIPGHRLTLGPFSIMPIRVTHSLVDCVALAIHTPVGVVLHTGDF  162

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVV  57
            K+D SP DG  FD +A  EL K+GV  ++ DSTNV   G T SE  V
Sbjct  163  KVDLSPTDGQPFDLQAFAELGKQGVLALLQDSTNVDRRGYTPSEKAV  209



>ref|WP_017416977.1| ribonuclease J [Clostridium tunisiense]
Length=554

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 112/182 (62%), Gaps = 2/182 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            GV  + PD  ++     K++A+ ITHGHEDHIG+LP+++  L+   P++ +  TL +I+ 
Sbjct  47   GVDLVIPDITYLLNNKDKVKAIFITHGHEDHIGSLPYILKQLN--VPVYGTRLTLGIIEN  104

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +LKE +I    +L   +  +        VE IR THSI D C + +    G ILHTGD+K
Sbjct  105  KLKEHNILQECKLNGVEAGQIVKLQNLNVEFIRNTHSIADSCSIAIHTPVGIILHTGDFK  164

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATGR  15
            ID +P+DG V D E +  L ++GV L+M+DSTNV   G T+SE  + ++L R IS A GR
Sbjct  165  IDYTPIDGKVMDLERISALGRKGVLLLMADSTNVQRQGHTISERSIGETLNRVISGARGR  224

Query  14   II  9
            +I
Sbjct  225  VI  226



>ref|WP_040193915.1| ribonuclease J [Clostridium sp. CL-6]
Length=554

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  I PD  ++++ S K++   +THGHEDHIG+LP+V+  L++  PI+ +  TL +
Sbjct  44   DMYGVDLIIPDISYLKEHSSKVKGFFLTHGHEDHIGSLPYVLKQLNA--PIYGTRLTLGI  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +  +LKE  +    +L   +          +VE IR THSI D C L +   AG +LHTG
Sbjct  102  VGNKLKEHEMLSECKLNNVEAGDIIKLQKMQVEFIRNTHSIADSCSLAIHTPAGVVLHTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D E   EL +EGV L+M+DSTNV   G +LSE  +  +L +  S A
Sbjct  162  DFKIDYTPIDGKIMDLERFGELGREGVLLLMADSTNVERQGYSLSEKSIGHTLNKIFSTA  221

Query  23   TGRII  9
             GR+I
Sbjct  222  EGRVI  226



>ref|WP_021766116.1| ribonuclease J 1 [Leptotrichia sp. oral taxon 215]
 gb|ERK67749.1| ribonuclease J 1 [Leptotrichia sp. oral taxon 215 str. W9775]
Length=624

 Score =   154 bits (390),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 84/187 (45%), Positives = 115/187 (61%), Gaps = 3/187 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDS-DTPIFASSFTLE  387
            + LG+  I PD  ++E    K++A+++THGHEDHIGA+P++   L S D P++    TLE
Sbjct  112  EHLGIDVIIPDFSYLESNRDKVKALLLTHGHEDHIGAIPYLYQKLGSEDIPMYGGRLTLE  171

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGP-FEVEPIRVTHSIPDCCGLVLRCDAGTILH  210
            L K + ++    +P   K+ K R        F VE I VTHSI DC  + ++  AGTILH
Sbjct  172  LAKAKFEKRDTKLPKE-KIIKGRSILKISKYFTVEFISVTHSIADCYAICIKTPAGTILH  230

Query  209  TGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHIS  30
            TGD+K+D +P+DG  FD   L +L +EGV L++SDSTN   PG T SE  V +SL    S
Sbjct  231  TGDFKVDLTPVDGEGFDFGRLAQLGEEGVDLLLSDSTNAQIPGFTPSERTVGESLKDEFS  290

Query  29   AATGRII  9
             A GRII
Sbjct  291  KAQGRII  297



>ref|WP_012159512.1| ribonuclease J [Alkaliphilus oremlandii]
 gb|ABW19200.1| beta-lactamase domain protein [Alkaliphilus oremlandii OhILAs]
Length=554

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 113/185 (61%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++ K   K++ +++THGHEDHIGALP+V+  L+   P++ +  TL L
Sbjct  45   DMLGIDIVIPDITYLIKNKDKVKGIVLTHGHEDHIGALPYVLKKLN--VPVYGTRLTLGL  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ ++KE  +    +L+     +    G FEVE IR +HS+PD C + L    G I HTG
Sbjct  103  VEIKIKEHKL-SDIQLQKVDVGQMVQLGEFEVEFIRTSHSMPDSCAIALHTSLGVIFHTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG V D   + EL K+GV +MM+DSTNV  PG T+SE+ V  +       A
Sbjct  162  DFKIDYTPIDGQVIDLHRIAELGKKGVLVMMADSTNVERPGYTMSESNVGATFENIFRNA  221

Query  23   TGRII  9
              RII
Sbjct  222  ENRII  226



>ref|WP_034541882.1| ribonuclease J [Carboxydothermus ferrireducens]
Length=552

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +   K++AV++THGHEDHIG +P+ +   D   P++ +  TL L+ 
Sbjct  45   LGIDMVIPDMSYLIENKDKVKAVLLTHGHEDHIGGMPYFLKQFD--VPVYGTRLTLGLLS  102

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   S L V   R     GPF++E I+V+HSIPD  G+ +    GT++HTGD+
Sbjct  103  AKLKEAGIPRAS-LNVVAPRDVLNIGPFKIEFIKVSHSIPDTVGIAVHTPVGTVVHTGDF  161

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   L EL ++GV ++MSDSTN   PG TLSE  V ++       A G
Sbjct  162  KLDPTPVDGKVTDFYKLAELGEKGVLVLMSDSTNAERPGFTLSEKTVGNTFEETFRVAEG  221

Query  17   RII  9
            RII
Sbjct  222  RII  224



>ref|WP_022259045.1| uncharacterized protein [Eubacterium sp. CAG:251]
 emb|CDC33203.1| uncharacterized protein BN563_00111 [Eubacterium sp. CAG:251]
Length=591

 Score =   154 bits (389),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 76/173 (44%), Positives = 107/173 (62%), Gaps = 2/173 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++E+ + KI  +IITHGHEDHIG L +++  ++   PI+A+  T+ L
Sbjct  80   DLPGVDLVIPDFSYVERNADKIRGIIITHGHEDHIGGLAYLLKKVN--IPIYATKLTIGL  137

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            IK +L+E  +   ++L   K R   T G F +E I V HSIPD  GL +RC AG I+ TG
Sbjct  138  IKGKLEEHRLLNSAKLVEIKPRDNITLGAFNIEMIHVNHSIPDAVGLAIRCPAGVIIQTG  197

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSL  45
            D+KID +P+DG++ D     E  ++GV  ++SDSTN   PG T SE  V DS 
Sbjct  198  DFKIDTTPVDGDMIDLSRFAEYGRKGVLALLSDSTNAERPGYTPSEKSVGDSF  250



>ref|WP_042277904.1| ribonuclease J [Clostridium sp. 01]
Length=553

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++     KI+ + +THGHEDHIGA+P+++  ++   P++ +  TL L
Sbjct  43   DMYGVDLVIPDVKYLLDKKDKIKGLFLTHGHEDHIGAIPYILKQIN--MPVYGTKLTLGL  100

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE +I     LK  K+  +      ++E I+VTHSI D C L +    G ILHTG
Sbjct  101  VENKLKEHNILDICDLKSVKSGEKIKLENLKIEFIKVTHSIADACALAIHTPIGVILHTG  160

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG V D   +  L K+GV L+M+DSTNV   G +LSE  + ++L R  S A
Sbjct  161  DFKIDYTPIDGRVTDLSRMATLGKKGVLLLMADSTNVERKGHSLSEKTIGEALTRLFSNA  220

Query  23   TGRII  9
             GR+I
Sbjct  221  KGRVI  225



>ref|WP_020715164.1| ribonuclease J [Acidobacteriaceae bacterium KBS 89]
Length=554

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 110/182 (60%), Gaps = 2/182 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LGV  + PD  ++ +   K+ A+++THGHEDHIG LPW++  L+   P++ + FTL L++
Sbjct  45   LGVDIVVPDISYLTENREKVRAILLTHGHEDHIGGLPWILSELN--VPVYGTEFTLALVE  102

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +L+E ++   + L      RR T GPF V PIRVTHS+ DC  L +    GT+LHTGD+
Sbjct  103  GKLEEHNLLDDADLIEMIPGRRLTLGPFSVMPIRVTHSLVDCVALAIHTPVGTVLHTGDF  162

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D SP D   FD  A  EL K+GV +++ DSTNV   G T SE  V   L    S A  
Sbjct  163  KVDLSPPDNKPFDLHAFAELGKQGVLVLLQDSTNVDRSGYTPSERAVRPRLDEIFSQAKK  222

Query  17   RI  12
            ++
Sbjct  223  KL  224



>gb|EES51279.1| metallo-beta-lactamase superfamily protein [Clostridium botulinum 
E1 str. 'BoNT E Beluga']
Length=554

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 114/186 (61%), Gaps = 2/186 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  I PD  ++ +  +K++   ITHGHEDHIG +P+++  ++   P++A+  TL L
Sbjct  44   DLYGIDIIIPDVTYLIRNKNKVKGFFITHGHEDHIGGIPYILQQIN--VPVYATKLTLAL  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L+E  +    +L + +         F VE IR  HSIPD C + +    G I+H+G
Sbjct  102  IESKLEEHHMLNDCKLNLVEVGGSVKLKNFNVEFIRNNHSIPDACSIAMHTPMGVIVHSG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V + +   EL K+GV L+M+DSTNVL  G T+SE  V ++L    S A
Sbjct  162  DFKIDFTPIDGHVMNLQRYAELGKKGVLLLMADSTNVLHKGYTMSEKTVGETLNGLFSKA  221

Query  23   TGRIIA  6
            TGR+I 
Sbjct  222  TGRVIV  227



>ref|WP_022366975.1| uncharacterized protein [Firmicutes bacterium CAG:341]
 emb|CDD63050.1| uncharacterized protein BN614_01503 [Firmicutes bacterium CAG:341]
Length=591

 Score =   154 bits (388),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 76/173 (44%), Positives = 107/173 (62%), Gaps = 2/173 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++E  + KI+ +IITHGHEDHIG L +++  ++   PI+A+  T+ L
Sbjct  80   DLPGVDLVIPDFSYVEHNADKIKGIIITHGHEDHIGGLAYLLKKVN--IPIYATKLTIGL  137

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            IK +L+E  +   ++L   K R   T G F +E I V HSIPD  GL +RC AG I+ TG
Sbjct  138  IKGKLEEHRLLNSAKLVEIKPRDNITLGSFNIEMIHVNHSIPDAVGLAIRCPAGVIIQTG  197

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSL  45
            D+KID +P+DG++ D     E  ++GV  ++SDSTN   PG T SE  V DS 
Sbjct  198  DFKIDTTPVDGDMIDLSRFAEYGRKGVLALLSDSTNAERPGYTPSEKSVGDSF  250



>ref|WP_042394749.1| ribonuclease J [Clostridium sp. JCC]
Length=553

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            GV  I PD  +++    KI+ + +THGHEDHIG+LP+V+  ++   PI+ +  T+ ++K 
Sbjct  46   GVDLIIPDISYLKNNVKKIKGIFLTHGHEDHIGSLPYVLKEVN--VPIYGTKLTIGIVKT  103

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +L+E ++    +L   +         F+VE IR THSI D C L +    GTILHTGD+K
Sbjct  104  KLEEHNLLSEVKLHNVEAGDIIKFDKFKVEFIRNTHSIADSCSLAIFTPVGTILHTGDFK  163

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATGR  15
            ID +P+DG   D + +  L KEGVTL+M+DSTNV   G +LSE  +  +L R IS A GR
Sbjct  164  IDYTPIDGETMDLQRISNLGKEGVTLLMADSTNVERKGHSLSEKSIGHTLDRIISKARGR  223

Query  14   IIA  6
            +I 
Sbjct  224  VIV  226



>ref|WP_018662152.1| Zn-dependent hydrolase, RNA-metabolising, CPSF 100 kDa analog 
[Thermobrachium celere]
 emb|CDF58247.1| Zn-dependent hydrolase, RNA-metabolising, CPSF 100 kDa analog 
[Thermobrachium celere DSM 8682]
Length=554

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 2/184 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
             G+  + PD  ++ K  +K++ +++THGHEDHIGALP+V+  L+   P++ +  TL +++
Sbjct  46   FGIDIVIPDISYLLKNKNKVKGIVLTHGHEDHIGALPYVLKQLN--VPVYGTRLTLGIVE  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I     LKV       T G   VE I+ +HSI D C L +    G ILHTGD+
Sbjct  104  TKLKEHGILSDCTLKVVNYNDVVTFGDLSVEFIKNSHSIADSCSLAIHTPLGIILHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P+DG V D   L EL ++GV L+++DSTNV   G T+SE  V D+  +  +   G
Sbjct  164  KVDYTPIDGVVMDFARLAELGRQGVVLLLADSTNVERQGYTMSERTVGDTFQKIFNETRG  223

Query  17   RIIA  6
            RII 
Sbjct  224  RIIV  227



>gb|ACD51285.1| metallo-beta-lactamase superfamily protein [Clostridium botulinum 
E3 str. Alaska E43]
Length=554

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 114/186 (61%), Gaps = 2/186 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  I PD  ++ +  +K++   ITHGHEDHIG +P+++  ++   P++A+  TL L
Sbjct  44   DLYGIDIIIPDVTYLIRNKNKVKGFFITHGHEDHIGGIPYILQQIN--VPVYATKLTLAL  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L+E  +    +L + +         F VE IR  HSIPD C + +    G I+H+G
Sbjct  102  IESKLEEHHMLNDCKLNLVEVGGSVKLKNFNVEFIRNNHSIPDACSIAMHTPMGVIVHSG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V + +   EL K+GV L+M+DSTNVL  G T+SE  V ++L    S A
Sbjct  162  DFKIDFTPIDGHVMNLQRYAELGKKGVLLLMADSTNVLHKGYTMSEKTVGETLNGLFSKA  221

Query  23   TGRIIA  6
            TGR+I 
Sbjct  222  TGRVIV  227



>ref|WP_012874748.1| ribonuclease J [Thermobaculum terrenum]
 gb|ACZ41713.1| beta-lactamase domain protein [Thermobaculum terrenum ATCC BAA-798]
Length=553

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  ++ K   +I A  I+HGHEDHIGALP+++   D D PI+A+  T  L
Sbjct  42   DMLGVDLLIPDIQYLLKSRKRIVAYCISHGHEDHIGALPYIL--RDIDAPIYATPLTRGL  99

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +LKE ++   +RL+ +K       G F VEP  VTHSIPD  GL + C  GTI++TG
Sbjct  100  IEVKLKEANLLQSARLRTYKDGDVVKIGKFTVEPFHVTHSIPDAVGLAITCPVGTIVYTG  159

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K D +P+DG   +   + ++ + GV  ++SD  +V + G T SE VV D+  R  + A
Sbjct  160  DFKFDPTPVDGKQANYGLIAQIGRRGVLTLLSDCVHVETKGHTPSEQVVGDTFRRVFAEA  219

Query  23   TGRII  9
             GRII
Sbjct  220  KGRII  224



>ref|WP_013120276.1| ribonuclease J [Thermincola potens]
 gb|ADG82259.1| RNA-metabolising metallo-beta-lactamase [Thermincola potens JR]
Length=554

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 115/183 (63%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +    +  +++THGHEDHIGALP+++   D D P++ +  TL L++
Sbjct  46   LGIDVVIPDITYLLENKDIVRGIVLTHGHEDHIGALPYILK--DLDVPVYGTKLTLGLLQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE ++     L   K R     GPF+VE IRV+HSIPD   + +    GT+LHTGD+
Sbjct  104  GKLKENNMSNCVTLVTVKPRDVVDIGPFKVEFIRVSHSIPDAVAIAIHTPVGTVLHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D++P+DG+V D   + EL ++GV +++SDSTNV  PG T+SE VV  +       A  
Sbjct  164  KLDQTPVDGDVTDFHRIAELGQKGVLVLLSDSTNVERPGYTMSERVVGATFDETFRMAKD  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_029452639.1| ribonuclease J [Clostridium algidicarnis]
Length=552

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++   S K++ + +THGHEDHIGALP+++  ++   P++ ++ TL +
Sbjct  42   DMYGVDLVIPDVKYLVDNSEKVKGIFLTHGHEDHIGALPYILKQIN--VPVYGTNLTLGI  99

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +K +LKE +I     L V +          +VE IR THSI D C + +    G I HTG
Sbjct  100  VKNKLKEHNILSDCDLHVVEAGDIVELQDLKVEFIRNTHSIADSCCIAVHTPVGVIFHTG  159

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG V D E +  L K+GV L+++DSTNV   G T+SE  + D+L R +S A
Sbjct  160  DFKIDFTPIDGLVMDLERISALGKQGVLLLLADSTNVERAGHTISEKAIGDTLTRILSNA  219

Query  23   TGRII  9
             GR+I
Sbjct  220  KGRVI  224



>ref|WP_033052533.1| ribonuclease J [Clostridium botulinum]
Length=548

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  38   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRVVN--VPVYGTKLTLGI  95

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  96   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  155

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  156  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  215

Query  23   TGRII  9
             GRII
Sbjct  216  KGRII  220



>ref|WP_006315221.1| Zn-dependent hydrolase, RNA-metabolising [Clostridiaceae bacterium 
L21-TH-D2]
 gb|EOC99945.1| Zn-dependent hydrolase, RNA-metabolising [Clostridiaceae bacterium 
L21-TH-D2]
Length=554

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ K   KI+ +++THGHEDHIGALP+V+  ++   P++ +  TL L++
Sbjct  47   LGIDVVIPDITYLLKNREKIKGIVLTHGHEDHIGALPYVLKKIN--VPVYGTKLTLGLVE  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             ++KE  +   ++L+V K  ++   G FEVE IR +HSIPD   L +    G ++HTGD+
Sbjct  105  NKIKEHKLK-NTKLRVTKPGQKIKLGCFEVEFIRTSHSIPDSVALAINTPVGVVVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            K+D +P++G V D     EL K+GV + M+DSTNV  PG T+SE  V  + +     A  
Sbjct  164  KVDYTPINGEVMDLHRFAELGKKGVLVAMADSTNVERPGYTMSERTVGSTFIDIFKTAKQ  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_010247550.1| ribonuclease J [Acetivibrio cellulolyticus]
Length=555

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  ++ K   K+  +++THGHEDHIGALP+++   D   P++ +  TL L
Sbjct  45   DMLGIDLVIPDVTYLSKNIEKVRGIVVTHGHEDHIGALPYILK--DLKVPVYGTKLTLGL  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+++L+E  I     L+V K     + G F+VE IR THSI D   L ++   GT++HTG
Sbjct  103  IEQKLEEHGILNDVELRVVKPSDVVSLGCFKVEFIRSTHSIADSVALAIQTPVGTVIHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+ G   D   L EL  +GV L+MSDSTNV  PG T+SE  V ++       A
Sbjct  163  DFKIDYTPIQGEAMDLARLAELGNKGVLLLMSDSTNVERPGYTMSERTVGEAFEEIFMNA  222

Query  23   TGRII  9
              RI+
Sbjct  223  KRRIL  227



>ref|WP_009169049.1| ribonuclease J [Clostridium sp. DL-VIII]
 gb|EHI98368.1| Ribocuclease J [Clostridium sp. DL-VIII]
Length=555

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  + PD  ++ K S KI+ + +THGHEDHIGALP+V+  L+   P++ +  TL +
Sbjct  45   DMFGIDIVIPDVSYLIKNSEKIKGIFLTHGHEDHIGALPYVLRQLN--VPVYGTKLTLGI  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +   + L   K +         VE I+  HSI D   + +    G +LHTG
Sbjct  103  VETKLKEHGLLASTELIRVKPKDIIKLDSVSVEFIKTNHSIADSVAIAVHTPLGVVLHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D   L EL K+GV +MM+DSTNV  PG T++E VV ++ L+  S A
Sbjct  163  DFKIDYTPIDGEMMDFGRLAELGKKGVLVMMADSTNVERPGYTMTEKVVGETFLQLFSKA  222

Query  23   TGRII  9
             GRII
Sbjct  223  KGRII  227



>ref|WP_008517411.1| beta-lactamase [alpha proteobacterium IMCC14465]
 gb|EJW22219.1| hypothetical protein IMCC14465_00580 [alpha proteobacterium IMCC14465]
Length=553

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 114/184 (62%), Gaps = 2/184 (1%)
 Frame = -1

Query  560  ELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELI  381
            E G+  I PDT FIE+   +++ +++THGHEDHIGA+ ++ P L    P++A+ FT EL+
Sbjct  50   EPGIDVILPDTRFIEQHKKRLKGLVLTHGHEDHIGAVAYLWPRLR--CPVYATPFTAELV  107

Query  380  KKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGD  201
            + +L E  I     L +     + T G FE++ I +THSI + C L +R   G +LHTGD
Sbjct  108  RGKLLEAGIEDQVALNILPLNSQITLGSFEIDLIGLTHSIAEPCALAIRTPVGNLLHTGD  167

Query  200  WKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAAT  21
            WKID  P  G V D E L+   +EG+  ++ DSTNVLSPG + SE +VA++L   +    
Sbjct  168  WKIDPDPQIGKVTDVEKLKAFGEEGIDAIICDSTNVLSPGTSGSEALVAETLAETVKHCK  227

Query  20   GRII  9
            GR++
Sbjct  228  GRVV  231



>gb|ABS41668.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum F str. Langeland]
 gb|ACA43864.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum B1 str. Okra]
 gb|ADG00259.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum F str. 230613]
 gb|EKX78285.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum CFSAN001628]
Length=569

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLRVVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>ref|WP_038113552.1| ribonuclease J [Veillonella montpellierensis]
Length=546

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++ +   K+ AV+ITHGHEDHIG+L ++I  + +DTPI+A+     L
Sbjct  35   DMPGVDIVIPDMSYLIENRKKVRAVVITHGHEDHIGSLSYLIKEIGTDTPIYATDLVCGL  94

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ + KE S      L V K      AG F+V  I+ THSIPD C +      G ++HTG
Sbjct  95   IEGKFKE-SRLGTKYLNVVKAGEEIKAGVFKVGFIQTTHSIPDSCAIYFDTPLGIVVHTG  153

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG + D     EL   GV  +M+DSTNV  PG T SE+ V  +L R +  A
Sbjct  154  DFKVDQTPVDGRMMDVHKFAELGNRGVLALMADSTNVEKPGYTGSESSVGPALKRAVGEA  213

Query  23   TGRII  9
             GR++
Sbjct  214  KGRVV  218



>ref|WP_032884098.1| MULTISPECIES: ribonuclease J [Clostridium]
Length=546

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  36   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  93

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  94   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  153

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  154  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  213

Query  23   TGRII  9
             GRII
Sbjct  214  KGRII  218



>ref|WP_027718227.1| ribonuclease J [Desulfovirgula thermocuniculi]
Length=554

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ +    +  +++THGHEDHIGALP+V+  L    P++ +  TL L++
Sbjct  46   LGIDVVIPDITYLLENRDNVLGIMLTHGHEDHIGALPYVLKHLH--VPVYGTKLTLALVQ  103

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  I   + L+V K R   T GPF VE IRV+HSIPD   L +    G ++HTGD+
Sbjct  104  SKLKEHGIGGEADLRVVKPRDTVTVGPFRVEFIRVSHSIPDAVALAVHTPLGVVVHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG + D   L +L + GV +++SDSTNV  PG T+SE +V ++       A  
Sbjct  164  KIDHTPVDGELTDFFRLAQLGERGVLVLLSDSTNVERPGYTMSERMVGNTFDEAFRQARE  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_026902059.1| ribonuclease J [Peptostreptococcaceae bacterium VA2]
Length=553

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  GV  + PD  ++ +   K++ + +THGHEDHIGA+P+++  L+   P++ +  TL L
Sbjct  43   DMYGVDLVIPDIKYLVERKDKVKGMFLTHGHEDHIGAIPYILKQLN--IPVYGTKLTLGL  100

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            +K +LKE  +   S LK  +T++       ++E I VTHSI D C L +    G ILHTG
Sbjct  101  VKNKLKEHGLENSSILKTVRTQQSIKLENMKIEFIGVTHSIADSCALAIHTPIGVILHTG  160

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D   +  L K+GV L+M+DSTNV   G +LSE  + ++L +  S +
Sbjct  161  DFKIDYTPIDGRMMDLNRIAALGKKGVLLLMADSTNVERTGHSLSEKTIGEALNKIFSPS  220

Query  23   TGRII  9
             GRII
Sbjct  221  KGRII  225



>ref|WP_043013619.1| ribonuclease J [Clostridium botulinum]
 gb|KIS25020.1| ribonuclease J [Clostridium botulinum B2 450]
Length=546

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  36   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  93

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  94   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  153

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  154  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  213

Query  23   TGRII  9
             GRII
Sbjct  214  KGRII  218



>ref|WP_021802207.1| RNA-metabolising metallo-beta-lactamase family protein [Clostridium 
intestinale]
 gb|ERK30232.1| RNA-metabolising metallo-beta-lactamase family protein [Clostridium 
intestinale URNW]
Length=555

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 109/185 (59%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D  G+  + PD  +++K + K+  + +THGHEDHIGALP+V+  L+   P++ +  TL L
Sbjct  45   DMFGIDVVIPDVSYLQKNADKVRGIFLTHGHEDHIGALPYVLKQLN--VPVYGTKLTLGL  102

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     L   K R         VE I++ HSI D C + +    G +LHTG
Sbjct  103  VETKLKEHGLLSSVELIRVKPREVVKLNAVSVEFIKINHSIADACAIAIHTPIGAVLHTG  162

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+D    D   L EL ++GV +M++DSTNV  PG TLSE VV ++ +     A
Sbjct  163  DFKIDYTPIDNEPTDFSRLAELGRKGVLVMLADSTNVERPGYTLSERVVGENFINFFGKA  222

Query  23   TGRII  9
             GRII
Sbjct  223  KGRII  227



>ref|WP_033063182.1| ribonuclease J [Clostridium botulinum]
Length=548

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  38   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  95

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  96   VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  155

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  156  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  215

Query  23   TGRII  9
             GRII
Sbjct  216  KGRII  220



>ref|WP_028464850.1| RNA-metabolising metallo-beta-lactamase [Nisaea denitrificans]
Length=555

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 104/170 (61%), Gaps = 2/170 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            G+  + PD  FIE+    +  ++ITHGHEDHIGA+P + P L    PI+A+ FT  LI++
Sbjct  52   GIDVLLPDPEFIEQRRKDLVGLVITHGHEDHIGAIPHLWPRLR--CPIYATPFTATLIRR  109

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +L E  I     L        F  GPFE++ I +THSIP+  GL +RC  GT++HTGDWK
Sbjct  110  KLSEVGILEQVELIEVDISANFVLGPFELQLITLTHSIPEANGLAIRCGGGTVMHTGDWK  169

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSL  45
             D  P+ G   D EAL EL  EGV  ++ DSTNVL  GR+ SE  + +SL
Sbjct  170  FDPDPVIGRTSDIEALRELGDEGVLALIGDSTNVLDEGRSGSEASLTESL  219



>gb|EDT86188.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum Bf]
 gb|ACQ52564.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
botulinum Ba4 str. 657]
 gb|AJD27864.1| hypothetical protein T257_2881 [Clostridium botulinum CDC_297]
 gb|AJE09420.1| hypothetical protein T259_1561 [Clostridium botulinum CDC_1436]
Length=569

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>gb|EDU36282.1| hypothetical protein CLOSPO_02450 [Clostridium sporogenes ATCC 
15579]
Length=567

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  57   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  114

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  115  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  174

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  175  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  234

Query  23   TGRII  9
             GRII
Sbjct  235  KGRII  239



>ref|WP_021726953.1| hypothetical protein [Olsenella profusa]
 gb|ERL06499.1| hypothetical protein HMPREF1316_1317 [Olsenella profusa F0195]
Length=553

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 111/184 (60%), Gaps = 1/184 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D+ G+  + PD  ++ +   K+  ++ITHGHEDHIGALP+++  L    P+++S  TL  
Sbjct  45   DQPGIDLVLPDYTYVLENEQKLRGILITHGHEDHIGALPYLLADLTRKVPVYSSKLTLGF  104

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            I+ +L EF I  P R +  +       G F ++   +THSIP   G+ +R  AG+++HTG
Sbjct  105  IENKLSEFRINAP-RFREVQNGTHLNLGSFSIDFFSMTHSIPAALGIYMRTPAGSVMHTG  163

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D++P+DG   + +A+   S  G+ L++SDSTN   PG T SE  V  SL   I  A
Sbjct  164  DFKLDQTPIDGVTPNYQAISRFSTMGIDLLLSDSTNATRPGFTPSEAAVGPSLRHIIKNA  223

Query  23   TGRI  12
            TGR+
Sbjct  224  TGRV  227



>ref|WP_021169514.1| ribonuclease J 1 [Sporomusa ovata]
 gb|EQB26700.1| ribonuclease J 1 [Sporomusa ovata DSM 2662]
Length=553

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 113/185 (61%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +I +   KI AV++THGHEDHIG+L +++  +D   P++ S  TL L
Sbjct  44   DMLGIDLVIPDISYIIENKDKIRAVVLTHGHEDHIGSLFYLLRHID--VPVYGSRLTLGL  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ RLKE+ +   ++L         T G FEV  IRV HSI D  G+ L+   GT++HTG
Sbjct  102  VEGRLKEYDVST-TKLIPVAPGDSITLGAFEVGFIRVNHSIADALGIYLKTPVGTVVHTG  160

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID++P+DG + D     EL  +GV +++SDSTN   PG T SE  V  SL  H   A
Sbjct  161  DFKIDQTPVDGKMIDIHKFAELGNQGVLVLLSDSTNAERPGYTKSERTVTVSLDEHFRTA  220

Query  23   TGRII  9
             GRII
Sbjct  221  RGRII  225



>dbj|GAE02997.1| Zn-dependent hydrolase, RNA-metabolising, CPSF 100 kDa analog 
[Clostridium botulinum B str. Osaka05]
Length=569

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>gb|EHN14088.1| RNA-metabolizing metallo-beta-lactamase family protein [Clostridium 
sporogenes PA 3679]
 gb|KCZ67062.1| ribonuclease J 1 [Clostridium sporogenes]
 gb|AJD29687.1| hypothetical protein T258_1329 [Clostridium botulinum Prevot_594]
Length=569

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>ref|WP_044566217.1| ribonuclease J [Anaerococcus sp. 9402080]
Length=559

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 116/185 (63%), Gaps = 3/185 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LGV  + PD  ++E+   K+  + +THGHEDHIGA+P+ + ++D  T ++ S  T  L
Sbjct  44   DMLGVDIVIPDFTYVEENKDKLRGIFVTHGHEDHIGAIPYFLKSVD--TNVYCSKLTKGL  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ + KE  +  P+R+K+     +   G   VE IRV+HSIPD C + ++   GTIL TG
Sbjct  102  LENKFKEHGLN-PNRIKMVNVNNKVNVGELSVEFIRVSHSIPDSCSIAVKSPVGTILFTG  160

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+K+D +P+DG+  D + L EL K+G+  + +DSTNV  PG +LSE  V D+ +R     
Sbjct  161  DFKMDFTPIDGDPTDIQRLAELGKKGLLAVYADSTNVERPGHSLSEKEVGDTFIRIFGQV  220

Query  23   TGRII  9
            +GRII
Sbjct  221  SGRII  225



>ref|WP_042384628.1| MULTISPECIES: ribonuclease J [Clostridium]
Length=569

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 111/185 (60%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PD  +++K  +K++ + +THGHEDHIGALP+V+  ++   P++ +  TL +
Sbjct  59   DMLGIDVVIPDITYLKKNINKVKGIFLTHGHEDHIGALPYVLREVN--VPVYGTKLTLGI  116

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +     LK  K R         VE IR +HSI D   + +    G +LHTG
Sbjct  117  VETKLKEHGLLSSVELKCIKPREIIRLQNVSVEFIRTSHSIADTVAIAIHTPLGVVLHTG  176

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG+V D     E+ K GV  MM+DSTNV  PG T+SE+ V ++ L   S  
Sbjct  177  DFKIDYTPIDGHVTDLARFAEIGKRGVIAMMADSTNVERPGYTMSESTVGEAFLNIFSGV  236

Query  23   TGRII  9
             GRII
Sbjct  237  KGRII  241



>ref|WP_036734249.1| ribonuclease J [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFD41561.1| ribonuclease J [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI35738.1| ribonuclease J [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI37587.1| ribonuclease J [Peptococcaceae bacterium SCADC1_2_3]
Length=554

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLEL  384
            D LG+  + PDT ++ +  + I  V+++HGHEDHIGALP+V+  L    P++ +  TL L
Sbjct  44   DMLGIDIVIPDTTYLLENKNLICGVVLSHGHEDHIGALPYVLKQLK--VPVYGTKLTLGL  101

Query  383  IKKRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTG  204
            ++ +LKE  +   ++LK  K R   + GPF+VE IRV+HS+PD   +V+    G I++TG
Sbjct  102  LQDKLKEQGLAEEAQLKEVKPREIISIGPFKVELIRVSHSVPDAVSIVVYTPVGKIVYTG  161

Query  203  DWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAA  24
            D+KID +P+DG + D   L +L +EGV +++SDSTNV   G T+SE +V D+       A
Sbjct  162  DFKIDHTPVDGEITDFFRLAQLGEEGVLVLISDSTNVEHLGYTMSERIVGDAFDEVFRQA  221

Query  23   TGRII  9
              RII
Sbjct  222  KERII  226



>ref|WP_025435545.1| ribonuclease J [Eubacterium acidaminophilum]
 gb|AHM56553.1| ribonuclease J 1 [Eubacterium acidaminophilum DSM 3953]
Length=554

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = -1

Query  557  LGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIK  378
            LG+  + PD  ++ K   K++ + +THGHEDHIGALP+ +  ++   P++ +  TL L++
Sbjct  47   LGIDIVIPDISYLLKHKDKVKGIFLTHGHEDHIGALPYFLKKIN--VPVYGTRLTLGLVE  104

Query  377  KRLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDW  198
             +LKE  +    +L+V K  +      FEVE IRV HSI D C + +  + GT+ HTGD+
Sbjct  105  FKLKEHRLN-NVKLQVVKPGQMIKKSNFEVEFIRVNHSIADACAIAVHTEIGTLFHTGDF  163

Query  197  KIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATG  18
            KID +P+DG++ D   + E+  +GV LMM+DSTNV  PG T+SE  V  +L    S A  
Sbjct  164  KIDHTPIDGDLMDFGRIAEIGSQGVLLMMADSTNVERPGATMSERTVGATLDEIFSGAKS  223

Query  17   RII  9
            RII
Sbjct  224  RII  226



>ref|WP_012859663.1| ribonuclease J [Sebaldella termitidis]
 gb|ACZ07064.1| beta-lactamase domain protein [Sebaldella termitidis ATCC 33386]
Length=591

 Score =   152 bits (385),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 81/187 (43%), Positives = 115/187 (61%), Gaps = 3/187 (2%)
 Frame = -1

Query  563  DELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDS-DTPIFASSFTLE  387
            + LG+  I PD  ++E    KI+++++THGHEDHIGA+P++   L S D  I+    TLE
Sbjct  79   EHLGIDVIIPDFTYLENNKDKIKSLLLTHGHEDHIGAIPYLFQKLGSTDITIYGGKLTLE  138

Query  386  LIKKRLKEFSIFVPSRLKVFKTRRRFTAGP-FEVEPIRVTHSIPDCCGLVLRCDAGTILH  210
            L K + ++    +P ++KV K R +      F VE I VTHSI DC  + ++  AG I+H
Sbjct  139  LAKAKFEKKDAVIP-KMKVVKGRTKLKLSKYFSVEFISVTHSIADCYAICIKTPAGIIVH  197

Query  209  TGDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHIS  30
            +GD+K+D +P+DG  FD   L +L +EGV L++SDSTN   PG T SE  V +SL     
Sbjct  198  SGDFKVDLTPVDGEGFDFARLAQLGEEGVDLLLSDSTNAAIPGFTPSEKSVGESLREEFG  257

Query  29   AATGRII  9
             A GRII
Sbjct  258  KAKGRII  264



>ref|WP_015651527.1| hydrolase of metallo-BETA-lactamase superfamily protein [Corynebacterium 
callunae]
 gb|AGG67096.1| hydrolase of metallo-BETA-lactamase superfamily protein [Corynebacterium 
callunae DSM 20147]
Length=730

 Score =   153 bits (387),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 7/186 (4%)
 Frame = -1

Query  560  ELGVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELI  381
            E GV  I PD   IE   H++EA+++THGHEDHIGA+PW++  L  D PI AS FTL LI
Sbjct  205  EPGVDLILPDFGPIEDHLHRVEALVVTHGHEDHIGAIPWLL-KLRHDIPILASRFTLALI  263

Query  380  KKRLKEFSIFVPSRLKVFKTRRRFTA--GPFEVEPIRVTHSIPDCCGLVLRCDAGTILHT  207
              + KE       R K+ +   +     GPF +    V HSIPDC GL ++  AG ++HT
Sbjct  264  AAKCKEHR----QRPKLIEVNEQSNENRGPFNIRFWAVNHSIPDCLGLAIKTPAGLVIHT  319

Query  206  GDWKIDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISA  27
            GD K+D++P DG   D  AL     EGV LM+ DSTN  +PG + SE  V  +L R IS 
Sbjct  320  GDIKLDQTPTDGRPTDLPALSRFGDEGVDLMLCDSTNATTPGVSGSEAEVGPTLKRLISE  379

Query  26   ATGRII  9
            A  R+I
Sbjct  380  AKQRVI  385



>ref|WP_021875718.1| Putative RNA-metabolising metallo-beta-lactamase [Clostridium 
chauvoei]
 emb|CDG01775.1| Putative RNA-metabolising metallo-beta-lactamase [Clostridium 
chauvoei JF4335]
Length=554

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 113/183 (62%), Gaps = 2/183 (1%)
 Frame = -1

Query  554  GVVKIXPDTXFIEKWSHKIEAVIITHGHEDHIGALPWVIPALDSDTPIFASSFTLELIKK  375
            GV  I PD  ++++   K++ + +THGHEDHIGALP+++  L+   P++ +  TL +++ 
Sbjct  47   GVDLIIPDISYLKENKEKVKGIFLTHGHEDHIGALPYILKQLN--IPVYGTKLTLGIVET  104

Query  374  RLKEFSIFVPSRLKVFKTRRRFTAGPFEVEPIRVTHSIPDCCGLVLRCDAGTILHTGDWK  195
            +LKE +I     L   +         F++E IR THSI D C + +    GTILHTGD+K
Sbjct  105  KLKEHNILSDCTLNKVEPGDIIQLDNFKIEFIRSTHSIADSCFIAIHTQEGTILHTGDFK  164

Query  194  IDESPLDGNVFDREALEELSKEGVTLMMSDSTNVLSPGRTLSETVVADSLLRHISAATGR  15
            +D +P+DG V D E +  +SK GV L+M+DSTNV   G T+SE+++ ++  R    A GR
Sbjct  165  VDYTPIDGLVIDLERIATISKSGVLLLMADSTNVERKGHTMSESIIGNTFNRIFQGAKGR  224

Query  14   IIA  6
            +I 
Sbjct  225  VIV  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920