BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022D22

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS70149.1|  hypothetical protein M569_04613                       57.0    3e-06   Genlisea aurea
ref|XP_009798373.1|  PREDICTED: CTL-like protein DDB_G0274487         56.6    4e-06   Nicotiana sylvestris
ref|XP_009601981.1|  PREDICTED: CTL-like protein DDB_G0274487         55.1    1e-05   Nicotiana tomentosiformis
ref|XP_004229669.1|  PREDICTED: protein pns1                          54.7    2e-05   Solanum lycopersicum
ref|XP_006345397.1|  PREDICTED: CTL-like protein DDB_G0274487-like    53.5    5e-05   Solanum tuberosum [potatoes]
ref|XP_008461825.1|  PREDICTED: CTL-like protein DDB_G0274487 iso...  50.4    4e-04   
ref|XP_008461824.1|  PREDICTED: CTL-like protein DDB_G0274487 iso...  50.4    4e-04   Cucumis melo [Oriental melon]



>gb|EPS70149.1| hypothetical protein M569_04613, partial [Genlisea aurea]
Length=408

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 45/89 (51%), Gaps = 26/89 (29%)
 Frame = +2

Query  89   MGASEPVVeren---------nereaeerqrDVERGEMGFQAGGSYNYppappapagggg  241
            MGA EPVV                E E   +D+ERGE+GF A  +               
Sbjct  1    MGAEEPVVSERKDEELEDIDGKIDEEESELKDLERGEVGFHAPAA---------------  45

Query  242  gHGFHMGRMQRLSATNPLRLVMESAIRVA  328
              GFHM RMQRLS++NPLRLVM+  IRVA
Sbjct  46   --GFHMSRMQRLSSSNPLRLVMDKRIRVA  72



>ref|XP_009798373.1| PREDICTED: CTL-like protein DDB_G0274487 [Nicotiana sylvestris]
Length=586

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  512  TVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
            T T TPQQ +VITLNSR+YTNKFSLF+FLLH++ A
Sbjct  138  TPTTTPQQPSVITLNSRSYTNKFSLFIFLLHMVAA  172



>ref|XP_009601981.1| PREDICTED: CTL-like protein DDB_G0274487 [Nicotiana tomentosiformis]
Length=582

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  512  TVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
            T   TPQQ +VITLNSR+YTNKFSLF+FLLH++ A
Sbjct  134  TPATTPQQPSVITLNSRSYTNKFSLFIFLLHMVAA  168



>ref|XP_004229669.1| PREDICTED: protein pns1 [Solanum lycopersicum]
Length=588

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +2

Query  89   MGASEPVVerennereaeerqrDVERGEMGFQAGGSYNYppappapagggggHGFHMGRM  268
            MGA EPVV+ EN E+E + R  DVE+GEM  Q  G +   P P       GG  FHM RM
Sbjct  1    MGAVEPVVDEENGEKETKIR--DVEKGEMDSQQRG-FQGQPTPAPAPAESGGENFHMSRM  57

Query  269  QRLSATNPLRLVMESAIRVA  328
            QRLSATNPLRLVM +  RVA
Sbjct  58   QRLSATNPLRLVMNAGTRVA  77


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  512  TVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
            T  VTPQ  +VITLNSR+YTNKFSLFLFL+H+I A
Sbjct  142  TPAVTPQP-SVITLNSRSYTNKFSLFLFLIHMIGA  175



>ref|XP_006345397.1| PREDICTED: CTL-like protein DDB_G0274487-like [Solanum tuberosum]
Length=597

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +2

Query  89   MGASEPVVere---nnereaeerqrDVERGEMGFQAGGSYNYppappapagggggHGFHM  259
            MGA EPVV+ E      +  +E +RDVE+G+M  Q  G +   P PP P    GG  FHM
Sbjct  1    MGAVEPVVDEENGEKETKIRDEEERDVEKGDMDSQQRG-FQGQPPPPPPPAEIGGENFHM  59

Query  260  GRMQRLSATNPLRLVMESAIRVA  328
             RMQRLSATNPLRLVM +  RVA
Sbjct  60   SRMQRLSATNPLRLVMNAGTRVA  82


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 3/37 (8%)
 Frame = +2

Query  506  TPTVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
            TP VT  P   +VITLNSR+YTNKFSLFLFL+H+I A
Sbjct  151  TPAVTPQP---SVITLNSRSYTNKFSLFLFLVHMIGA  184



>ref|XP_008461825.1| PREDICTED: CTL-like protein DDB_G0274487 isoform X2 [Cucumis 
melo]
Length=432

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  506  TPTVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
             P    TPQQ AVI LNS+AYT+K SLFLF++HL++A
Sbjct  113  VPLSVSTPQQPAVINLNSKAYTDKVSLFLFVMHLVLA  149



>ref|XP_008461824.1| PREDICTED: CTL-like protein DDB_G0274487 isoform X1 [Cucumis 
melo]
Length=561

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  506  TPTVTVTPQQRAVITLNSRAYTNKFSLFLFLLHLIVA  616
             P    TPQQ AVI LNS+AYT+K SLFLF++HL++A
Sbjct  113  VPLSVSTPQQPAVINLNSKAYTDKVSLFLFVMHLVLA  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500