BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF022D11

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    287   2e-87   Nicotiana tomentosiformis
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    286   4e-87   Solanum lycopersicum
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    282   1e-85   Nicotiana tomentosiformis
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    282   1e-85   Nicotiana tomentosiformis
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    282   1e-85   Solanum tuberosum [potatoes]
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    280   2e-84   Nicotiana sylvestris
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    279   3e-84   
ref|XP_007144120.1|  hypothetical protein PHAVU_007G1305001g            257   2e-83   Phaseolus vulgaris [French bean]
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    276   3e-83   Citrus sinensis [apfelsine]
ref|XP_008224159.1|  PREDICTED: uncharacterized protein LOC103323...    272   6e-83   
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    274   2e-82   Pyrus x bretschneideri [bai li]
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    274   2e-82   Pyrus x bretschneideri [bai li]
emb|CDO99279.1|  unnamed protein product                                272   7e-82   Coffea canephora [robusta coffee]
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    272   9e-82   Prunus mume [ume]
ref|XP_009388278.1|  PREDICTED: phytoene desaturase-like                254   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             271   2e-81   Prunus persica
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    270   5e-81   Prunus mume [ume]
emb|CAN68017.1|  hypothetical protein VITISV_025151                     270   8e-81   Vitis vinifera
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    270   9e-81   Citrus sinensis [apfelsine]
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    269   1e-80   Nelumbo nucifera [Indian lotus]
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    268   2e-80   Populus euphratica
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    268   2e-80   Populus euphratica
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    268   2e-80   Populus euphratica
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    268   3e-80   Fragaria vesca subsp. vesca
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         267   7e-80   Jatropha curcas
ref|XP_010650130.1|  PREDICTED: uncharacterized protein LOC100249...    263   9e-80   
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    266   1e-79   
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    266   2e-79   
ref|XP_004171362.1|  PREDICTED: protoporphyrinogen oxidase, chlor...    246   3e-79   
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          265   3e-79   
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    265   4e-79   
ref|XP_002528810.1|  methyltransferase, putative                        265   5e-79   Ricinus communis
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    264   5e-79   
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    265   5e-79   Theobroma cacao [chocolate]
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    263   1e-78   Eucalyptus grandis [rose gum]
ref|XP_010936016.1|  PREDICTED: uncharacterized protein LOC105055...    260   2e-78   
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    263   2e-78   Vitis vinifera
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    263   3e-78   Populus euphratica
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    263   3e-78   Populus euphratica
ref|XP_007035213.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    257   5e-78   
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    262   5e-78   
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    262   5e-78   Phoenix dactylifera
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   261   6e-78   Citrus sinensis [apfelsine]
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    261   6e-78   
ref|XP_007035212.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    258   1e-77   
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    260   2e-77   Elaeis guineensis
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    259   3e-77   Nicotiana tomentosiformis
ref|XP_009586646.1|  PREDICTED: uncharacterized protein LOC104084...    258   5e-77   
ref|XP_006606355.1|  PREDICTED: uncharacterized protein LOC100815...    257   5e-77   Glycine max [soybeans]
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    259   6e-77   Glycine max [soybeans]
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    259   8e-77   Nicotiana tomentosiformis
emb|CBI23694.3|  unnamed protein product                                259   1e-76   Vitis vinifera
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    258   1e-76   Nicotiana tomentosiformis
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    258   2e-76   Nicotiana tomentosiformis
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    258   2e-76   
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    257   3e-76   Glycine max [soybeans]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    256   7e-76   Cucumis melo [Oriental melon]
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           256   9e-76   Medicago truncatula
gb|AAT74602.1|  cyclopropane fatty acid synthase                        256   9e-76   Gossypium hirsutum [American cotton]
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       256   1e-75   Cucumis sativus [cucumbers]
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       255   2e-75   Cucumis sativus [cucumbers]
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                254   5e-75   Erythranthe guttata [common monkey flower]
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           253   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    253   8e-75   
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    253   1e-74   
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    253   1e-74   
gb|ABG37642.1|  cyclopropane fatty acid synthase                        257   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008460675.1|  PREDICTED: uncharacterized protein LOC103499...    250   3e-74   Cucumis melo [Oriental melon]
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    255   5e-74   
emb|CDX77504.1|  BnaA07g06420D                                          250   1e-73   
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    249   2e-73   Solanum lycopersicum
emb|CDX85109.1|  BnaC07g07970D                                          249   2e-73   
ref|XP_006350408.1|  PREDICTED: uncharacterized protein LOC102579...    248   3e-73   Solanum tuberosum [potatoes]
gb|KJB38367.1|  hypothetical protein B456_006G251800                    249   3e-73   Gossypium raimondii
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             249   3e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    249   3e-73   Brassica rapa
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    248   4e-73   
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             249   4e-73   Arabidopsis lyrata subsp. lyrata
dbj|BAD44154.1|  unnamed protein product                                249   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57657.1|  AT3g23510/MEE5_5                                        249   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         248   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    248   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    248   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             248   6e-73   Capsella rubella
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    248   7e-73   Solanum tuberosum [potatoes]
dbj|BAB01742.1|  unnamed protein product                                246   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    246   3e-72   Citrus sinensis [apfelsine]
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    246   4e-72   Eucalyptus grandis [rose gum]
ref|XP_006431328.1|  hypothetical protein CICLE_v10030464mg             241   4e-72   
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         246   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    245   9e-72   Sesamum indicum [beniseed]
gb|KJB28512.1|  hypothetical protein B456_005G052900                    244   1e-71   Gossypium raimondii
gb|KJB28513.1|  hypothetical protein B456_005G052900                    244   1e-71   Gossypium raimondii
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    244   2e-71   Eucalyptus grandis [rose gum]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    243   4e-71   Gossypium raimondii
gb|KJB28510.1|  hypothetical protein B456_005G052900                    239   4e-71   Gossypium raimondii
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    243   6e-71   Tarenaya hassleriana [spider flower]
gb|KJB28511.1|  hypothetical protein B456_005G052900                    239   9e-71   Gossypium raimondii
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    242   1e-70   Sesamum indicum [beniseed]
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    242   1e-70   
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    239   1e-69   
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    234   6e-68   Tarenaya hassleriana [spider flower]
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    234   1e-67   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI23697.3|  unnamed protein product                                233   2e-67   Vitis vinifera
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    232   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    231   2e-66   
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   229   6e-66   Zea mays [maize]
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    228   9e-66   Tarenaya hassleriana [spider flower]
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    228   2e-65   
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             227   3e-65   
gb|EEE67149.1|  hypothetical protein OsJ_24210                          224   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   224   2e-64   
gb|EEC82010.1|  hypothetical protein OsI_25960                          224   3e-64   Oryza sativa Indica Group [Indian rice]
gb|KDO54089.1|  hypothetical protein CISIN_1g037740mg                   206   6e-64   Citrus sinensis [apfelsine]
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    223   8e-64   
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    223   1e-63   Brassica rapa
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    222   1e-63   Setaria italica
dbj|BAJ93367.1|  predicted protein                                      222   2e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX92987.1|  BnaA03g37090D                                          221   6e-63   
emb|CDX94854.1|  BnaC03g43340D                                          220   1e-62   
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             219   3e-62   
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    216   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    216   2e-61   Brassica rapa
ref|XP_002862680.1|  predicted protein                                  196   3e-59   
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      207   3e-58   
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         204   4e-57   Sterculia foetida
gb|AAT74600.1|  cyclopropane fatty acid synthase                        203   9e-57   Gossypium hirsutum [American cotton]
gb|AAT74601.1|  cyclopropane fatty acid synthase                        202   3e-56   Gossypium hirsutum [American cotton]
gb|KJB70810.1|  hypothetical protein B456_011G092100                    201   3e-56   Gossypium raimondii
gb|KJB12596.1|  hypothetical protein B456_002G026100                    201   3e-56   Gossypium raimondii
gb|KJB70811.1|  hypothetical protein B456_011G092100                    201   3e-56   Gossypium raimondii
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    201   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             201   5e-56   Selaginella moellendorffii
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                200   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_010532687.1|  PREDICTED: uncharacterized protein LOC104808...    199   1e-55   Tarenaya hassleriana [spider flower]
gb|KJB12595.1|  hypothetical protein B456_002G026100                    200   1e-55   Gossypium raimondii
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    200   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    199   2e-55   Sesamum indicum [beniseed]
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    199   2e-55   Tarenaya hassleriana [spider flower]
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           198   4e-55   Medicago truncatula
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          194   1e-53   Sorghum bicolor [broomcorn]
gb|KGN61576.1|  hypothetical protein Csa_2G172460                       179   9e-53   Cucumis sativus [cucumbers]
gb|KGN61579.1|  hypothetical protein Csa_2G172490                       176   6e-52   Cucumis sativus [cucumbers]
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    189   7e-52   Zea mays [maize]
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    189   8e-52   Zea mays [maize]
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    185   2e-50   Setaria italica
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    185   3e-50   
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    184   4e-50   Setaria italica
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    183   8e-50   Nicotiana tomentosiformis
ref|XP_001769171.1|  predicted protein                                  181   7e-49   
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    179   4e-48   
gb|KHG28468.1|  putative fatty acid methyltransferase                   177   9e-48   Gossypium arboreum [tree cotton]
gb|KHG28467.1|  putative fatty acid methyltransferase                   177   1e-47   Gossypium arboreum [tree cotton]
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    178   1e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70161.1|  hypothetical protein M569_04599                         176   5e-47   Genlisea aurea
gb|KJB12590.1|  hypothetical protein B456_002G025800                    176   5e-47   Gossypium raimondii
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  174   1e-46   Citrus sinensis [apfelsine]
ref|XP_008677861.1|  PREDICTED: uncharacterized protein LOC103652...    173   3e-46   Zea mays [maize]
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  172   5e-46   Citrus sinensis [apfelsine]
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    173   5e-46   Zea mays [maize]
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    171   1e-45   Nicotiana tomentosiformis
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    167   6e-44   
ref|XP_004172280.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   7e-44   
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     166   2e-43   Eucalyptus grandis [rose gum]
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg             163   2e-42   
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    161   5e-42   
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          161   7e-42   
ref|XP_006421139.1|  hypothetical protein CICLE_v10004346mg             159   1e-41   
gb|EMT01204.1|  Cyclopropane-fatty-acyl-phospholipid synthase           159   1e-41   
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...    159   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             158   1e-40   
gb|KCW60260.1|  hypothetical protein EUGRSUZ_H029681                    152   3e-40   Eucalyptus grandis [rose gum]
ref|XP_009388196.1|  PREDICTED: uncharacterized protein LOC103975010    144   8e-40   
gb|KJB38366.1|  hypothetical protein B456_006G251800                    155   9e-40   Gossypium raimondii
emb|CDX77513.1|  BnaA07g06510D                                          154   3e-39   
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    154   4e-39   Sesamum indicum [beniseed]
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...    152   2e-38   Solanum lycopersicum
ref|XP_009766520.1|  PREDICTED: uncharacterized protein LOC104217...    142   6e-38   Nicotiana sylvestris
ref|XP_009766538.1|  PREDICTED: uncharacterized protein LOC104217...    141   8e-38   Nicotiana sylvestris
ref|XP_009766530.1|  PREDICTED: uncharacterized protein LOC104217...    141   1e-37   Nicotiana sylvestris
dbj|BAK05129.1|  predicted protein                                      148   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY67346.1|  BnaCnng54610D                                          142   1e-36   Brassica napus [oilseed rape]
dbj|BAC83502.1|  putative cyclopropane synthase                         146   2e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CDX77514.1|  BnaA07g06520D                                          145   3e-36   
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    145   4e-36   
dbj|BAK05892.1|  predicted protein                                      145   5e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           141   1e-34   Triticum urartu
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           139   5e-34   
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    139   9e-34   
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    137   2e-33   
ref|XP_002183150.1|  predicted protein                                  138   2e-33   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   137   3e-33   
ref|WP_035725299.1|  NADH-ubiquinone oxidoreductase subunit 6           134   4e-33   
ref|XP_005824669.1|  hypothetical protein GUITHDRAFT_165417             137   7e-33   Guillardia theta CCMP2712
ref|WP_027873283.1|  NADH-ubiquinone oxidoreductase subunit 6           132   1e-32   Spongiibacter marinus
ref|WP_035824801.1|  NADH-ubiquinone oxidoreductase subunit 6           131   4e-32   Janthinobacterium sp. RA13
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      133   9e-32   Bathycoccus prasinos
ref|XP_005648777.1|  cyclopropane fatty acid synthase                   133   1e-31   Coccomyxa subellipsoidea C-169
ref|WP_034784946.1|  NADH-ubiquinone oxidoreductase subunit 6           128   4e-31   Janthinobacterium lividum
ref|WP_018334542.1|  hypothetical protein                               128   6e-31   Actinomycetospora chiangmaiensis
ref|WP_016347695.1|  amine oxidase                                      128   6e-31   Burkholderia insecticola
ref|WP_034748929.1|  NADH-ubiquinone oxidoreductase subunit 6           127   7e-31   Janthinobacterium lividum
ref|WP_038500647.1|  NADH-ubiquinone oxidoreductase subunit 6           127   9e-31   Janthinobacterium agaricidamnosum
ref|WP_010394901.1|  NADH-ubiquinone oxidoreductase subunit 6           127   1e-30   Janthinobacterium lividum
ref|WP_026989223.1|  NADH-ubiquinone oxidoreductase subunit 6           127   1e-30   Fodinicurvata sediminis
ref|WP_035507039.1|  NADH-ubiquinone oxidoreductase subunit 6           127   1e-30   Caballeronia jiangsuensis
emb|CDG85105.1|  flavin containing amine oxidoreductase family pr...    127   2e-30   Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
ref|WP_038570879.1|  NADH-ubiquinone oxidoreductase subunit 6           126   2e-30   Burkholderia cepacia complex
ref|WP_012218188.1|  NADH-ubiquinone oxidoreductase subunit 6           126   2e-30   Burkholderia multivorans
ref|WP_043631329.1|  NADH-ubiquinone oxidoreductase subunit 6           126   2e-30   Chromobacterium haemolyticum
ref|WP_027232012.1|  NADH-ubiquinone oxidoreductase subunit 6           126   3e-30   
ref|WP_008889725.1|  NADH-ubiquinone oxidoreductase subunit 6           126   3e-30   Thalassospira profundimaris
ref|WP_025662389.1|  NADH-ubiquinone oxidoreductase subunit 6           125   4e-30   Rhizobium sp. IBUN
ref|WP_040661572.1|  NADH-ubiquinone oxidoreductase subunit 6           125   5e-30   
gb|EAR60721.1|  hypothetical protein MED92_13638                        125   5e-30   Neptuniibacter caesariensis
ref|WP_034951396.1|  NADH-ubiquinone oxidoreductase subunit 6           125   6e-30   
ref|WP_043614801.1|  NADH-ubiquinone oxidoreductase subunit 6           125   6e-30   Chromobacterium violaceum
ref|WP_017510251.1|  hypothetical protein                               125   7e-30   beta proteobacterium L13
gb|ERJ39944.1|  Amine oxidase, flavin-containing                        124   8e-30   Burkholderia sp. AU4i
ref|WP_042973675.1|  NADH-ubiquinone oxidoreductase subunit 6           124   9e-30   Burkholderia sp. AU4i
ref|WP_011880041.1|  NADH-ubiquinone oxidoreductase subunit 6           124   9e-30   Burkholderia vietnamiensis
gb|EGD05972.1|  amine oxidase                                           124   9e-30   Burkholderia sp. TJI49
ref|WP_041568750.1|  NADH-ubiquinone oxidoreductase subunit 6           124   9e-30   
ref|WP_041912257.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   
gb|EJN00550.1|  putative NAD/FAD-binding protein                        124   1e-29   Phyllobacterium sp. YR531
ref|WP_017923872.1|  NADH-ubiquinone oxidoreductase subunit 6           122   1e-29   
ref|WP_039370008.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   Burkholderia
ref|WP_036551677.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   
ref|WP_025097256.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   Burkholderia sp. A1
gb|ACV37205.1|  FAD dependent oxidoreductase                            124   1e-29   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
ref|WP_034203531.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   Burkholderia cepacia
ref|WP_027331137.1|  FAD-dependent oxidoreductase                       124   1e-29   Marinimicrobium agarilyticum
ref|WP_017918374.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    124   1e-29   Burkholderia gladioli
ref|WP_011349277.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   Burkholderia lata
ref|WP_008347203.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    124   1e-29   Burkholderiaceae
ref|WP_018152743.1|  hypothetical protein                               124   1e-29   Leeia oryzae
ref|WP_036039189.1|  NADH-ubiquinone oxidoreductase subunit 6           124   1e-29   Burkholderia gladioli
ref|WP_043581068.1|  NADH-ubiquinone oxidoreductase subunit 6           124   2e-29   Chromobacterium
ref|WP_013699783.1|  NADH-ubiquinone oxidoreductase subunit 6           124   2e-29   Burkholderia gladioli
ref|WP_003163823.1|  NADH-ubiquinone oxidoreductase subunit 6           124   2e-29   Brevundimonas
ref|WP_028880747.1|  NADH-ubiquinone oxidoreductase subunit 6           124   2e-29   
ref|WP_019104394.1|  NADH-ubiquinone oxidoreductase subunit 6           124   2e-29   Chromobacterium sp. C-61
ref|WP_017234374.1|  hypothetical protein                               124   2e-29   Pandoraea sp. B-6
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    126   2e-29   Oryza brachyantha
gb|EFA79548.1|  hypothetical protein PPL_07599                          124   2e-29   Heterostelium album PN500
emb|CDY09021.1|  BnaC01g30700D                                          126   2e-29   Brassica napus [oilseed rape]
ref|WP_014725774.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   Burkholderia sp. KJ006
ref|WP_043590453.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   Chromobacterium haemolyticum
ref|WP_043596502.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   Chromobacterium violaceum
gb|EYR84639.1|  putative NAD/FAD-binding protein                        123   3e-29   Shinella sp. DD12
ref|WP_040855695.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   
ref|WP_043420888.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   
ref|WP_037404758.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   
ref|WP_028369081.1|  NADH-ubiquinone oxidoreductase subunit 6           123   3e-29   Burkholderia sp. UYPR1.413
ref|WP_044827279.1|  NADH-ubiquinone oxidoreductase subunit 6           123   4e-29   Thalassospira sp. HJ
ref|XP_002502708.1|  predicted protein                                  125   4e-29   Micromonas commoda
gb|KEI70136.1|  NADH-ubiquinone oxidoreductase subunit 6                123   4e-29   Endozoicomonas elysicola
ref|WP_033403562.1|  NADH-ubiquinone oxidoreductase subunit 6           122   4e-29   
ref|WP_009340169.1|  NADH-ubiquinone oxidoreductase subunit 6           122   4e-29   Afipia
ref|WP_021079312.1|  16S rRNA (-2'-O)-methyltransferase                 122   5e-29   
ref|WP_044459099.1|  NADH-ubiquinone oxidoreductase subunit 6           122   5e-29   Rhizobium
ref|WP_022731757.1|  NADH-ubiquinone oxidoreductase subunit 6           122   5e-29   Thalassospira lucentensis
ref|WP_034199245.1|  NADH-ubiquinone oxidoreductase subunit 6           122   6e-29   Burkholderia sp. MSh2
ref|WP_013761036.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    122   6e-29   Rhizobium/Agrobacterium group
ref|WP_002717506.1|  hypothetical protein                               122   6e-29   Afipia felis
ref|WP_011295863.1|  NADH-ubiquinone oxidoreductase subunit 6           122   6e-29   Cupriavidus pinatubonensis
ref|WP_043621892.1|  NADH-ubiquinone oxidoreductase subunit 6           122   6e-29   
ref|WP_038014651.1|  NADH-ubiquinone oxidoreductase subunit 6           122   6e-29   
ref|WP_019566747.1|  NADH-ubiquinone oxidoreductase subunit 6           122   7e-29   Agrobacterium
ref|WP_004431402.1|  NADH-ubiquinone oxidoreductase subunit 6           122   7e-29   Agrobacterium tumefaciens
ref|WP_034192796.1|  NADH-ubiquinone oxidoreductase subunit 6           122   7e-29   Burkholderia
ref|WP_025594884.1|  NADH-ubiquinone oxidoreductase subunit 6           122   7e-29   Agrobacterium tumefaciens
ref|WP_025871998.1|  NADH-ubiquinone oxidoreductase subunit 6           122   7e-29   Methylobacillus glycogenes
ref|WP_019254489.1|  NADH-ubiquinone oxidoreductase subunit 6           122   9e-29   Burkholderia thailandensis
ref|WP_035200438.1|  NADH-ubiquinone oxidoreductase subunit 6           122   1e-28   Agrobacterium tumefaciens
dbj|GAM27527.1|  hypothetical protein SAMD00019534_107030               122   1e-28   Acytostelium subglobosum LB1
ref|WP_022563112.1|  conserved hypothetical protein; putative oxi...    122   1e-28   Rhizobium
ref|WP_004433137.1|  amine oxidase, flavin-containing                   122   1e-28   Agrobacterium tumefaciens
ref|WP_035210178.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   Acidithiobacillus thiooxidans
ref|WP_010637102.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_024894758.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_012733707.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_042317992.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_012432094.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_028116906.1|  FAD-dependent oxidoreductase                       121   1e-28   
ref|WP_035208627.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_037092074.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_034497400.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   
ref|WP_014189646.1|  NADH-ubiquinone oxidoreductase subunit 6           121   2e-28   
ref|WP_009668089.1|  NADH-ubiquinone oxidoreductase subunit 6           121   2e-28   
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          123   2e-28   
ref|WP_037138296.1|  NADH-ubiquinone oxidoreductase subunit 6           121   2e-28   
ref|WP_031400557.1|  NADH-ubiquinone oxidoreductase subunit 6           120   2e-28   
ref|XP_005851729.1|  hypothetical protein CHLNCDRAFT_29187              120   2e-28   
ref|WP_035310951.1|  NADH-ubiquinone oxidoreductase subunit 6           120   2e-28   
ref|WP_039245159.1|  NADH-ubiquinone oxidoreductase subunit 6           120   2e-28   
ref|WP_020694301.1|  hypothetical protein                               120   2e-28   
ref|WP_021160956.1|  Amine oxidase, flavin-containing                   120   2e-28   
ref|WP_030898331.1|  amine oxidase                                      120   3e-28   
ref|WP_007878405.1|  putative amine oxidase                             120   3e-28   
ref|WP_022958759.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_030103211.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_006699863.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_021222243.1|  amine oxidase                                      120   3e-28   
ref|WP_037990410.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_034640061.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_018115447.1|  NADH-ubiquinone oxidoreductase subunit 6           120   3e-28   
ref|WP_039398472.1|  NADH-ubiquinone oxidoreductase subunit 6           120   4e-28   
ref|WP_011487298.1|  NADH-ubiquinone oxidoreductase subunit 6           120   4e-28   
ref|WP_040705051.1|  NADH-ubiquinone oxidoreductase subunit 6           120   4e-28   
ref|WP_010484313.1|  amine oxidase                                      120   4e-28   
ref|WP_009451675.1|  NADH-ubiquinone oxidoreductase subunit 6           120   4e-28   
gb|KIY98773.1|  hypothetical protein MNEG_9189                          122   4e-28   
ref|WP_034453592.1|  amine oxidase                                      120   4e-28   
ref|WP_019655032.1|  NADH-ubiquinone oxidoreductase subunit 6           120   4e-28   
ref|WP_016832821.1|  hypothetical protein                               120   4e-28   
ref|WP_035996342.1|  NADH-ubiquinone oxidoreductase subunit 6           119   5e-28   
dbj|GAK70358.1|  putative amine oxidase                                 120   5e-28   
ref|WP_036861967.1|  NADH-ubiquinone oxidoreductase subunit 6           120   5e-28   
ref|WP_011871814.1|  NADH-ubiquinone oxidoreductase subunit 6           119   5e-28   
ref|WP_042275006.1|  NADH-ubiquinone oxidoreductase subunit 6           119   5e-28   
ref|WP_039789083.1|  NADH-ubiquinone oxidoreductase subunit 6           119   5e-28   
ref|WP_035693570.1|  NADH-ubiquinone oxidoreductase subunit 6           119   6e-28   
ref|WP_013233084.1|  NADH-ubiquinone oxidoreductase subunit 6           119   6e-28   
ref|WP_034893435.1|  NADH-ubiquinone oxidoreductase subunit 6           119   6e-28   
gb|EXI74856.1|  protoporphyrinogen oxidase                              119   7e-28   
ref|WP_041643943.1|  NADH-ubiquinone oxidoreductase subunit 6           119   7e-28   
ref|WP_007278304.1|  amine oxidase                                      119   7e-28   
ref|WP_017451245.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    119   7e-28   
ref|WP_028639776.1|  NADH-ubiquinone oxidoreductase subunit 6           119   7e-28   
ref|WP_008259909.1|  NADH-ubiquinone oxidoreductase subunit 6           119   7e-28   
gb|EMT30662.1|  hypothetical protein F775_16247                         117   8e-28   
ref|WP_012325386.1|  amine oxidase                                      119   8e-28   
emb|CAL95925.1|  conserved hypothetical amine oxidoreductase            119   8e-28   
ref|WP_017503882.1|  NADH-ubiquinone oxidoreductase subunit 6           119   8e-28   
ref|WP_044542063.1|  NADH-ubiquinone oxidoreductase subunit 6           119   8e-28   
ref|WP_043815399.1|  NADH-ubiquinone oxidoreductase subunit 6           119   9e-28   
ref|WP_027456573.1|  NADH-ubiquinone oxidoreductase subunit 6           119   9e-28   
ref|WP_028444633.1|  NADH-ubiquinone oxidoreductase subunit 6           119   9e-28   
gb|KEQ08421.1|  NADH-ubiquinone oxidoreductase subunit 6                119   9e-28   
ref|WP_035015201.1|  FAD-dependent oxidoreductase                       119   9e-28   
ref|WP_032926853.1|  NADH-ubiquinone oxidoreductase subunit 6           119   1e-27   
ref|WP_025390591.1|  FAD-dependent oxidoreductase                       119   1e-27   
ref|WP_034936602.1|  NADH-ubiquinone oxidoreductase subunit 6           119   1e-27   
ref|WP_017037535.1|  hypothetical protein                               119   1e-27   
ref|WP_006465178.1|  dehydrogenase                                      119   1e-27   
ref|WP_032893652.1|  FAD-dependent oxidoreductase                       119   1e-27   
ref|WP_026187915.1|  NADH-ubiquinone oxidoreductase subunit 6           119   1e-27   
ref|WP_019620433.1|  hypothetical protein                               119   1e-27   
ref|WP_043566519.1|  NADH-ubiquinone oxidoreductase subunit 6           119   1e-27   
gb|EPR40262.1|  amine oxidase                                           118   1e-27   
ref|WP_014430674.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   
ref|WP_029573245.1|  FAD-dependent oxidoreductase                       114   1e-27   
ref|WP_030479110.1|  amine oxidase                                      118   1e-27   
ref|WP_041696044.1|  NADH-ubiquinone oxidoreductase subunit 6           119   1e-27   
ref|WP_040415203.1|  FAD-dependent oxidoreductase                       118   1e-27   
ref|WP_037494015.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   
ref|WP_003188372.1|  amine oxidase                                      118   1e-27   
ref|WP_034190985.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   
ref|WP_020302483.1|  MULTISPECIES: putative oxidoreductase              118   1e-27   
ref|WP_014716842.1|  MULTISPECIES: amine oxidase                        118   1e-27   
ref|WP_026439795.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   
ref|WP_018411529.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   
ref|WP_032903980.1|  FAD-dependent oxidoreductase                       118   1e-27   
ref|WP_012567205.1|  NADH-ubiquinone oxidoreductase subunit 6           118   2e-27   
ref|WP_035852078.1|  NADH-ubiquinone oxidoreductase subunit 6           118   2e-27   
ref|XP_001695321.1|  cyclopropane fatty acid synthase                   121   2e-27   
ref|WP_034128074.1|  FAD-dependent oxidoreductase                       118   2e-27   
ref|WP_013346488.1|  amine oxidase                                      118   2e-27   
ref|WP_007089223.1|  NADH-ubiquinone oxidoreductase subunit 6           118   2e-27   
ref|WP_042457343.1|  cyclopropane-fatty-acyl-phospholipid synthase      118   2e-27   
ref|WP_025565552.1|  FAD-dependent oxidoreductase                       118   2e-27   
ref|WP_039365608.1|  NADH-ubiquinone oxidoreductase subunit 6           118   2e-27   
ref|WP_035864519.1|  NADH-ubiquinone oxidoreductase subunit 6           118   2e-27   
ref|WP_009541056.1|  Amine oxidase, flavin-containing                   118   2e-27   
ref|WP_032553645.1|  FAD-dependent oxidoreductase                       117   2e-27   
ref|WP_008326156.1|  NADH-ubiquinone oxidoreductase subunit 6           117   2e-27   
ref|WP_028160094.1|  NADH-ubiquinone oxidoreductase subunit 6           117   2e-27   
ref|WP_025264845.1|  FAD-dependent oxidoreductase                       117   2e-27   
ref|WP_015487919.1|  amine oxidase                                      117   2e-27   
ref|WP_037950552.1|  amine oxidase                                      117   2e-27   
ref|WP_037106477.1|  NADH-ubiquinone oxidoreductase subunit 6           117   2e-27   
ref|WP_004672198.1|  NADH-ubiquinone oxidoreductase subunit 6           117   2e-27   
ref|WP_043253197.1|  FAD-dependent oxidoreductase                       117   3e-27   
ref|WP_026283740.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_033379455.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_036186404.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_042296695.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_043355115.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
gb|EGH81115.1|  amine oxidase, flavin-containing                        114   3e-27   
ref|WP_039125355.1|  NAD/FAD-binding protein                            117   3e-27   
ref|WP_033068007.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_040010353.1|  NAD/FAD-binding protein                            117   3e-27   
ref|WP_036972017.1|  FAD-dependent oxidoreductase                       117   3e-27   
ref|WP_027616715.1|  FAD-dependent oxidoreductase                       117   3e-27   
ref|WP_007815668.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_036249795.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_035552365.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_042115913.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_036234320.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_011827837.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   
ref|WP_025977669.1|  NADH-ubiquinone oxidoreductase subunit 6           117   4e-27   
ref|WP_040568260.1|  NADH-ubiquinone oxidoreductase subunit 6           117   4e-27   
ref|WP_007670477.1|  NADH-ubiquinone oxidoreductase subunit 6           117   4e-27   
gb|EWS58624.1|  protoporphyrinogen oxidase                              117   4e-27   
ref|WP_029013942.1|  NADH-ubiquinone oxidoreductase subunit 6           117   4e-27   
ref|WP_011903806.1|  NADH-ubiquinone oxidoreductase subunit 6           117   4e-27   
ref|WP_009769616.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_007742446.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_037065787.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_036547878.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_042327676.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_009839402.1|  Flavin containing amine oxidoreductas              111   5e-27   
ref|WP_013124010.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
gb|AAQ60890.1|  probable dehydrogenase                                  116   5e-27   
ref|WP_034916515.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_043855709.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_012757181.1|  NADH-ubiquinone oxidoreductase subunit 6           117   5e-27   
ref|WP_010428680.1|  amine oxidase                                      116   5e-27   
ref|WP_041630414.1|  dehydrogenase                                      116   5e-27   
ref|WP_022734977.1|  Flavin containing amine oxidoreductase             116   5e-27   
ref|WP_024583618.1|  NADH-ubiquinone oxidoreductase subunit 6           117   6e-27   
ref|WP_029873041.1|  NADH-ubiquinone oxidoreductase subunit 6           116   6e-27   
dbj|GAM98350.1|  amine oxidase                                          116   6e-27   
ref|WP_003507671.1|  NADH-ubiquinone oxidoreductase subunit 6           117   6e-27   
ref|WP_004406948.1|  amine oxidase                                      116   6e-27   
ref|WP_044311960.1|  FAD-dependent oxidoreductase                       116   6e-27   
ref|WP_024665587.1|  FAD-dependent oxidoreductase                       116   6e-27   
ref|WP_013106784.1|  putative NAD(FAD)-dependent dehydrogenase/ox...    116   6e-27   
ref|WP_003538847.1|  NADH-ubiquinone oxidoreductase subunit 6           116   6e-27   
ref|WP_024652617.1|  FAD-dependent oxidoreductase                       116   6e-27   
ref|WP_011588051.1|  MULTISPECIES: amine oxidase                        116   6e-27   
ref|WP_020009386.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    116   6e-27   
ref|WP_044343955.1|  FAD-dependent oxidoreductase                       116   6e-27   
ref|WP_035224034.1|  NADH-ubiquinone oxidoreductase subunit 6           116   6e-27   
ref|WP_024640153.1|  FAD-dependent oxidoreductase                       116   7e-27   
ref|WP_011266740.1|  amine oxidase                                      116   7e-27   
ref|WP_017277943.1|  amine oxidase                                      116   7e-27   
ref|WP_024661277.1|  FAD-dependent oxidoreductase                       116   7e-27   
ref|WP_012483567.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    116   7e-27   
ref|WP_028455401.1|  NADH-ubiquinone oxidoreductase subunit 6           116   7e-27   
ref|WP_024641570.1|  FAD-dependent oxidoreductase                       116   7e-27   
ref|WP_039331876.1|  NADH-ubiquinone oxidoreductase subunit 6           116   7e-27   
dbj|GAK46215.1|  amine oxidase                                          116   7e-27   
ref|WP_016957376.1|  hypothetical protein                               116   7e-27   
ref|WP_044323449.1|  FAD-dependent oxidoreductase                       116   7e-27   
ref|WP_009855773.1|  NADH-ubiquinone oxidoreductase subunit 6           116   7e-27   
gb|EGH44448.1|  amine oxidase, flavin-containing                        115   7e-27   
ref|WP_044588091.1|  NADH-ubiquinone oxidoreductase subunit 6           116   7e-27   
emb|CCF21451.1|  Amine oxidase flavin-containing                        116   8e-27   
ref|WP_024271493.1|  putative NAD/FAD-binding protein                   116   8e-27   
ref|WP_016567261.1|  Putative NAD/FAD-binding protein                   116   8e-27   
ref|WP_044835350.1|  FAD-dependent oxidoreductase                       116   8e-27   
ref|WP_044271419.1|  FAD-dependent oxidoreductase                       116   8e-27   
ref|WP_044319718.1|  FAD-dependent oxidoreductase                       116   8e-27   
ref|WP_008495386.1|  NADH-ubiquinone oxidoreductase subunit 6           116   8e-27   
gb|AIU25495.1|  NADH-ubiquinone oxidoreductase subunit 6                116   9e-27   
ref|WP_044309896.1|  FAD-dependent oxidoreductase                       116   9e-27   
ref|WP_024661426.1|  FAD-dependent oxidoreductase                       116   9e-27   
ref|WP_042618059.1|  NADH-ubiquinone oxidoreductase subunit 6           116   9e-27   
ref|XP_005708372.1|  cyclopropane-fatty-acyl-phospholipid synthase      118   9e-27   
ref|WP_019917409.1|  NADH-ubiquinone oxidoreductase subunit 6           116   9e-27   
ref|WP_028630132.1|  FAD-dependent oxidoreductase                       116   9e-27   
ref|WP_027606875.1|  FAD-dependent oxidoreductase                       116   9e-27   
ref|WP_003365606.1|  amine oxidase                                      116   9e-27   
ref|WP_024647593.1|  FAD-dependent oxidoreductase                       116   9e-27   
ref|WP_003433713.1|  amine oxidase, flavin-containing                   116   9e-27   
gb|EET19869.1|  NAD/FAD-binding protein                                 111   9e-27   
ref|WP_006997242.1|  Flavin containing amine oxidoreductase             115   9e-27   
ref|WP_027306686.1|  flavin containing amine oxidoreductas              115   9e-27   
ref|WP_020169184.1|  Flavin containing amine oxidoreductase             115   9e-27   
ref|WP_010323291.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
ref|WP_011281854.1|  flavin containing amine oxidoreductas              115   1e-26   
ref|WP_035527085.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
ref|WP_043702973.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
ref|WP_007175869.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
ref|WP_034134407.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_025109339.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_040664588.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
emb|CDW94292.1|  Amine oxidase                                          115   1e-26   
ref|WP_012977821.1|  NADH-ubiquinone oxidoreductase subunit 6           116   1e-26   
ref|WP_008058110.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_022980196.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_023874324.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    115   1e-26   
ref|WP_028732152.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_024695393.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_024686044.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_005777971.1|  amine oxidase                                      115   1e-26   
ref|WP_010660331.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_037112614.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_019742549.1|  amine oxidase                                      115   1e-26   
ref|WP_044321097.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_005746217.1|  amine oxidase                                      115   1e-26   
ref|WP_011167850.1|  amine oxidase                                      115   1e-26   
ref|WP_037162878.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    115   1e-26   
ref|WP_027693326.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_017991153.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_036128962.1|  FAD-dependent oxidoreductase                       115   1e-26   
ref|WP_026227859.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_035715304.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   287 bits (734),  Expect = 2e-87, Method: Composition-based stats.
 Identities = 132/152 (87%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  121  EIIKFKQDVISYLEALDNNPDIDRNETLGHFI  152



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   286 bits (732),  Expect = 4e-87, Method: Composition-based stats.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VA+VGAGISGLVSAY LAK GA +V+YEKEDY+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1    MKVAIVGAGISGLVSAYELAKSGAKIVIYEKEDYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI++FK DV+SYLEE DNNPD+DRN+TLG FI
Sbjct  121  EIIRFKQDVISYLEELDNNPDIDRNETLGHFI  152



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   282 bits (722),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 131/152 (86%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  121  EIIKFKRDVISYLEALDNNPDIDRNETLGHFI  152



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   282 bits (722),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 131/152 (86%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  121  EIIKFKRDVISYLEALDNNPDIDRNETLGHFI  152



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   282 bits (722),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 128/152 (84%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLVSAY LAK G  VV+Y+KE+Y+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKSGVKVVIYDKENYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI++FK DV+SYLEE DNNPD+DRN+TLG FI
Sbjct  121  EIIRFKQDVISYLEELDNNPDIDRNETLGHFI  152



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   280 bits (715),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT++ VDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVEVVVYEKEDYLGGHAKTVTVNDVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGVDMEISDMSFSVSLD G+G EWGSR G SGLFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVDMEISDMSFSVSLDKGYGCEWGSRTGLSGLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLEE DNNPD+DRN+TLG FI
Sbjct  121  EIIKFKQDVISYLEELDNNPDIDRNETLGHFI  152



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   279 bits (713),  Expect = 3e-84, Method: Composition-based stats.
 Identities = 127/152 (84%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+LNPYFW+M+R
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLNPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+
Sbjct  121  EIIKFKDDVLSYLEMLENNPDVDRNETLGKFV  152



>ref|XP_007144120.1| hypothetical protein PHAVU_007G1305001g, partial [Phaseolus vulgaris]
 gb|ESW16114.1| hypothetical protein PHAVU_007G1305001g, partial [Phaseolus vulgaris]
Length=166

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR+AVVGAGISGL SAYVLAK G  VV+YEKED+LGGHAKTV  DGVD+DLGFMVFNRVT
Sbjct  1    MRIAVVGAGISGLASAYVLAKSGVNVVLYEKEDWLGGHAKTVNADGVDVDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE++GVDME+SDMSFSVSLD G G EWGSR+G SGLFAQK+N++NPYFWQMIR
Sbjct  61   YPNMMEFFENIGVDMELSDMSFSVSLDRGRGCEWGSRSGLSGLFAQKRNVMNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+SYL+  DNNPD+DRN+ LGEFI
Sbjct  121  EIVKFKDDVISYLDMLDNNPDIDRNEPLGEFI  152



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   276 bits (706),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KMRVAV+GAGISGLVSAYVLAK G  VV+YEK+DYLGGHAKTVT DGVDLDLGFMVFNRV
Sbjct  4    KMRVAVIGAGISGLVSAYVLAKAGVEVVLYEKDDYLGGHAKTVTFDGVDLDLGFMVFNRV  63

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+
Sbjct  64   TYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQML  123

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK+DVL YL+E ++NPD+DR++TLG+F+
Sbjct  124  REIIKFKDDVLGYLKELESNPDIDRSETLGQFV  156



>ref|XP_008224159.1| PREDICTED: uncharacterized protein LOC103323914 isoform X3 [Prunus 
mume]
Length=689

 Score =   272 bits (695),  Expect = 6e-83, Method: Composition-based stats.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5    KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65   TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI KFK+D ++YLEE +NNPD+DRN+TLG+FI
Sbjct  125  REITKFKHDAINYLEELENNPDIDRNETLGQFI  157



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   274 bits (701),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 125/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D ++YLEE +NNPD+DR++TLG+FI
Sbjct  121  EITKFKHDAINYLEELENNPDIDRSETLGQFI  152



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   274 bits (700),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 125/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D ++YLEE +NNPD+DR++TLG+FI
Sbjct  121  EITKFKHDAINYLEELENNPDIDRSETLGQFI  152



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   272 bits (696),  Expect = 7e-82, Method: Composition-based stats.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            K+RVAVVGAGISGLV+A+VLAK G  VV+YEKEDYLGGHAKTVT+DG+DLDLGFMVFNRV
Sbjct  3    KLRVAVVGAGISGLVAAHVLAKEGVDVVIYEKEDYLGGHAKTVTMDGIDLDLGFMVFNRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMMELFE+LGVDME+SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNP FWQMI
Sbjct  63   TYPNMMELFENLGVDMELSDMSFSVSLDKGKGCEWGSRNGLSSLFAQKKNVLNPKFWQMI  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DV+SY+EE + NPD+DRN+TLG FI
Sbjct  123  REIVKFKADVISYVEELEKNPDLDRNETLGHFI  155



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   272 bits (696),  Expect = 9e-82, Method: Composition-based stats.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5    KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65   TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI KFK+D ++YLEE +NNPD+DRN+TLG+FI
Sbjct  125  REITKFKHDAINYLEELENNPDIDRNETLGQFI  157



>ref|XP_009388278.1| PREDICTED: phytoene desaturase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=200

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAGISGL SAY LAK G  VV+YEKEDYLGGHAKTVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLASAYTLAKAGVDVVLYEKEDYLGGHAKTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM+E FE+LGVDMEISDMSFSVSLD G G EWGSRNG S LFAQK N  NP FW+MIR
Sbjct  61   YPNMVEFFETLGVDMEISDMSFSVSLDEGKGCEWGSRNGLSSLFAQKTNAFNPSFWRMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DVL YLEE +NNPDMDR++TL  FI
Sbjct  121  EIVKFKGDVLMYLEEHENNPDMDRSETLEHFI  152



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   271 bits (694),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61   YPNMMELFERLGVDMETSDMSFSASLDKGQGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D ++YLEE +NNPD+DRN+TLG+FI
Sbjct  121  EITKFKHDAINYLEELENNPDIDRNETLGQFI  152



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   270 bits (691),  Expect = 5e-81, Method: Composition-based stats.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61   YPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D ++YLEE +NNPD+DRN+TLG+FI
Sbjct  121  EITKFKHDAINYLEELENNPDIDRNETLGQFI  152



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   270 bits (689),  Expect = 8e-81, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+ME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61   YPNMMEFFETLGVBMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +++KFK+DVL YLEE +NNPDMDRN TLG+FI
Sbjct  121  DVIKFKDDVLKYLEELENNPDMDRNQTLGDFI  152



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   270 bits (689),  Expect = 9e-81, Method: Composition-based stats.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+G GISGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLDL FMVFNRVT
Sbjct  1    MRAAVIGGGISGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDLCFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM+R
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KF +DVLSYLE+ +NN D+DRN+TLG+F+
Sbjct  121  EIIKFNDDVLSYLEDLENNADIDRNETLGQFV  152



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   269 bits (688),  Expect = 1e-80, Method: Composition-based stats.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGLVSAYVLA  G  VV+YEKEDYLGGH++TVT+DG+DLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLANAGVDVVLYEKEDYLGGHSRTVTIDGLDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGV+ME SDMSFSVSLD GH YEWGSRNG + LFAQK N LNPYFW+M+R
Sbjct  61   YPNMMEFFESLGVEMETSDMSFSVSLDKGHDYEWGSRNGLASLFAQKTNALNPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV  YLEE +NNPD+DRN+TLG FI
Sbjct  121  EIIKFKEDVFKYLEELENNPDLDRNETLGHFI  152



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   268 bits (686),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 122/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+
Sbjct  123  REIVKFKDDVLSYLEVLENNPVVDRNETLGQFV  155



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+
Sbjct  121  EIIKFKDDVLSYLEMLENNPDVDRNETLGKFV  152



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+
Sbjct  121  EIIKFKDDVLSYLEMLENNPDVDRNETLGKFV  152



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   268 bits (685),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG+GISGLV+AYVLAK G  V +YEKEDYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLVAAYVLAKDGVEVDLYEKEDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGV+MEISDMSFS SLD G GYEWGSRNG S LFAQK N+LNPYFWQM+R
Sbjct  61   YPNMMEFFESLGVEMEISDMSFSASLDKGKGYEWGSRNGLSSLFAQKSNVLNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D LSYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EITKFKHDALSYLEVRENNPDIDRNETLGKFI  152



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   267 bits (683),  Expect = 7e-80, Method: Composition-based stats.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAY-VLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            +MRVAV+G GISGL+SAY V++  GA VV+YEKEDYLGGHA+TV+ DGVDLDLGFMVFNR
Sbjct  3    RMRVAVIGGGISGLISAYYVVSNSGAEVVLYEKEDYLGGHARTVSFDGVDLDLGFMVFNR  62

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMMELFESLGVDME+SDMSFSVSLD G+GYEWGSRNG SG+FAQKKN+LNPYFWQM
Sbjct  63   VTYPNMMELFESLGVDMELSDMSFSVSLDKGNGYEWGSRNGLSGVFAQKKNILNPYFWQM  122

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +REI+KFK+DVLSYL   + NPD+DR++TLG FI
Sbjct  123  LREIIKFKDDVLSYLGTLEKNPDIDRSETLGHFI  156



>ref|XP_010650130.1| PREDICTED: uncharacterized protein LOC100249441 isoform X3 [Vitis 
vinifera]
Length=678

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61   YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +++KFK+DVL YLEE +NNPDMDRN TLG+FI
Sbjct  121  DVIKFKDDVLKYLEELENNPDMDRNQTLGDFI  152



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   266 bits (681),  Expect = 1e-79, Method: Composition-based stats.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+GAG+SGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGMSGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG S LFAQK NL+NPYFWQM+R
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSSLFAQKTNLINPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D ++YLEE +NN D+DR++TLG+FI
Sbjct  121  EITKFKHDAINYLEELENNQDIDRSETLGQFI  152



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   266 bits (679),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KMRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V
Sbjct  4    KMRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHV  63

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
             YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+
Sbjct  64   EYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQML  123

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            RE++KFK+DVLSY+EE +NNPD+DRN+TLG FI
Sbjct  124  REMMKFKDDVLSYVEELENNPDIDRNETLGHFI  156



>ref|XP_004171362.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic/mitochondrial-like, 
partial [Cucumis sativus]
Length=166

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV +YLE  +NN D+DRN+TLG+FI
Sbjct  121  EIVKFKDDVTNYLEVLENNSDIDRNETLGQFI  152



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   265 bits (678),  Expect = 3e-79, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAV+G GISGLVS+YVLAK G  V +YEKEDYLGGHA+TV LDGVDLDLGFMVFNRVT
Sbjct  1    MKVAVIGGGISGLVSSYVLAKAGVSVTLYEKEDYLGGHARTVKLDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLG+DMEISDMSFSVSLD G GYEWGSR+G +GLFAQK N LNP+FW+M+R
Sbjct  61   YPNMMEFFESLGIDMEISDMSFSVSLDGGQGYEWGSRSGLAGLFAQKSNALNPHFWRMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++ FK DVL Y+EE +NNPD+DRN+TLG FI
Sbjct  121  ELIVFKEDVLKYIEELENNPDLDRNETLGHFI  152



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            +MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSRNGFSGLFAQKKN LNPYFW+M+
Sbjct  63   TYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSRNGFSGLFAQKKNALNPYFWKML  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK+DVLSYLE  +N+P +DRN+TLG+F+
Sbjct  123  REIVKFKDDVLSYLEVLENDPVVDRNETLGQFV  155



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFN VT
Sbjct  1    MRVAVVGGGISGLVSAYVLAKDGVEVVLYEKEEYLGGHAKTVCFDGVDLDLGFMVFNCVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME+SDMSFSVSLDNG GYEWGSRNG  GLFAQK N  NPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMELSDMSFSVSLDNGKGYEWGSRNGLPGLFAQKTNAFNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVLSYLE  +NNPD+DRN+TLG FI
Sbjct  121  EVIKFKDDVLSYLEVLENNPDIDRNETLGNFI  152



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   264 bits (674),  Expect = 5e-79, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAV+G GISGLVS YVLA+ G  VV+YEKE+Y+GGHAKTV  DGV+LDLGFMVFNRVT
Sbjct  1    MKVAVIGGGISGLVSTYVLARNGVKVVLYEKEEYIGGHAKTVCFDGVELDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM E FESLGVD+E+SDMSFSVSLD+G GYEWGSRNG SGLFAQK N +NPYFWQMIR
Sbjct  61   YPNMTEFFESLGVDLELSDMSFSVSLDHGKGYEWGSRNGLSGLFAQKTNAINPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DVLSYLE  +NNPD+DRN+TL  FI
Sbjct  121  EIIKFKDDVLSYLEVLENNPDIDRNETLENFI  152



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   265 bits (676),  Expect = 5e-79, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EISKFKDDVISYLEVLENNPDIDRNETLGQFI  152



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   263 bits (673),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+V V+G G+SGLV+AY  A+GGA VVVYEKEDYLGGHAKTV+++GVDLDLGFMVFNRVT
Sbjct  1    MKVGVIGGGMSGLVAAYEAARGGAKVVVYEKEDYLGGHAKTVSVNGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLGV+MEISDMS SVSLD G GYEWGSRNG   LFAQK NLLNPYFWQM+R
Sbjct  61   YPNMMELFESLGVEMEISDMSISVSLDEGQGYEWGSRNGLLSLFAQKTNLLNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK DVLSYLE  ++NPD+DR++TLG+FI
Sbjct  121  EVIKFKEDVLSYLEGLESNPDIDRSETLGQFI  152



>ref|XP_010936016.1| PREDICTED: uncharacterized protein LOC105055750 isoform X3 [Elaeis 
guineensis]
Length=677

 Score =   260 bits (664),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1    MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+ YL+E +NNPD+D ++TL  FI
Sbjct  121  EIFKFKHDVIKYLDEHENNPDLDHDETLEHFI  152



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61   YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +++KFK+DVL YLEE +NNPDMDRN TLG+FI
Sbjct  121  DVIKFKDDVLKYLEELENNPDMDRNQTLGDFI  152



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+
Sbjct  123  REIVKFKDDVLSYLEVLENNPVVDRNETLGQFV  155



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+
Sbjct  123  REIVKFKDDVLSYLEVLENNPVVDRNETLGQFV  155



>ref|XP_007035213.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
 gb|EOY06139.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
Length=604

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EISKFKDDVISYLEVLENNPDIDRNETLGQFI  152



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   262 bits (670),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+ YLE+++NNPD+DRN+TLG FI
Sbjct  121  EIVKFKHDVIRYLEKYENNPDLDRNETLGHFI  152



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   262 bits (669),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+ YLE+++NNPD+DRN+TLG FI
Sbjct  121  EIVKFKHDVIRYLEKYENNPDLDRNETLGHFI  152



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   261 bits (668),  Expect = 6e-78, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V 
Sbjct  1    MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVE  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+R
Sbjct  61   YPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVLSY+EE +N+PD+DRN+TLG FI
Sbjct  121  EMMKFKDDVLSYVEELENSPDIDRNETLGHFI  152



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   261 bits (667),  Expect = 6e-78, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+ YLE+++NNPD+DRN+TLG FI
Sbjct  121  EIVKFKHDVIRYLEKYENNPDLDRNETLGHFI  152



>ref|XP_007035212.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
 gb|EOY06138.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
Length=672

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EISKFKDDVISYLEVLENNPDIDRNETLGQFI  152



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   260 bits (665),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1    MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+ YL+E +NNPD+D ++TL  FI
Sbjct  121  EIFKFKHDVIKYLDEHENNPDLDHDETLEHFI  152



>ref|XP_009586643.1| PREDICTED: uncharacterized protein LOC104084479 isoform X4 [Nicotiana 
tomentosiformis]
Length=824

 Score =   259 bits (663),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK DV SYLE  DNNPD+D + T+G+FI
Sbjct  121  EISKFKQDVTSYLEALDNNPDIDCDKTIGQFI  152



>ref|XP_009586646.1| PREDICTED: uncharacterized protein LOC104084479 isoform X6 [Nicotiana 
tomentosiformis]
Length=744

 Score =   258 bits (658),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1    MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLE  DNNPD+D ++TL +FI
Sbjct  121  EIIKFKQDVISYLEALDNNPDIDCDETLWQFI  152



>ref|XP_006606355.1| PREDICTED: uncharacterized protein LOC100815937 isoform X2 [Glycine 
max]
Length=741

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFI
Sbjct  121  EIVKFKDDVISYLDMLENNPDIDRNEPLGEFI  152



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM++ FE+LGVDME+SDMSFSVSLD G G EWGSRNG + LFAQK+N+LNPYFWQMIR
Sbjct  61   YPNMLDFFENLGVDMELSDMSFSVSLDKGRGCEWGSRNGLTSLFAQKRNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFI
Sbjct  121  EIVKFKDDVISYLDMLENNPDIDRNEPLGEFI  152



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   259 bits (661),  Expect = 8e-77, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK DV SYLE  DNNPD+D + T+G+FI
Sbjct  121  EISKFKQDVTSYLEALDNNPDIDCDKTIGQFI  152



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   259 bits (661),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61   YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVL YLEE +NNPD+DRN TLG+FI
Sbjct  121  EMIKFKDDVLKYLEELENNPDIDRNQTLGDFI  152



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   258 bits (660),  Expect = 1e-76, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK DV SYLE  DNNPD+D + T+G+FI
Sbjct  121  EISKFKQDVTSYLEALDNNPDIDCDKTIGQFI  152



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   258 bits (658),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1    MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK DV+SYLE  DNNPD+D ++TL +FI
Sbjct  121  EIIKFKQDVISYLEALDNNPDIDCDETLWQFI  152



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   258 bits (658),  Expect = 2e-76, Method: Composition-based stats.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61   YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVL YLEE +NNPD+DRN TLG+FI
Sbjct  121  EMIKFKDDVLKYLEELENNPDIDRNQTLGDFI  152



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61   YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFI
Sbjct  121  EIVKFKDDVISYLDMLENNPDIDRNEPLGEFI  152



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   256 bits (655),  Expect = 7e-76, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV++YLE  +NN D+DRN+TLG+FI
Sbjct  121  EIVKFKDDVINYLEVIENNSDIDRNETLGQFI  152



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG GISGLVSAYVLAKGG  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGGGISGLVSAYVLAKGGVNVVLYEKEDYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGV+ME+SDMSFSVSLD G G EWGSR+  SGLFAQK+N LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVEMELSDMSFSVSLDKGRGCEWGSRS-LSGLFAQKRNALNPYFWQMIR  119

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+D +SY++ F+NNPDMD N++LG+F+
Sbjct  120  EIVKFKDDAISYIDMFENNPDMDHNESLGQFL  151



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AV+G GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVIGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME  DMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPFDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   256 bits (653),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV++YLE  +NN D+DRN+TLG+FI
Sbjct  121  EIVKFKDDVINYLEVLENNSDVDRNETLGQFI  152



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   255 bits (652),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV +YLE  +NN D+DRN+TLG+FI
Sbjct  121  EIVKFKDDVTNYLEVLENNSDIDRNETLGQFI  152



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   254 bits (649),  Expect = 5e-75, Method: Composition-based stats.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KMRVAVVG G+SGLVSAYV+AKGG  VVVYEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4    KMRVAVVGGGVSGLVSAYVVAKGGVEVVVYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR GFSGLFAQKKN +NPYFW+MI
Sbjct  64   TYPNMMEFFETLGVEMEISDMSFSVSLDKGQGCEWGSRTGFSGLFAQKKNAINPYFWKMI  123

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +EILKFK+DV++Y+EE DNNPD DRN+TLG FI
Sbjct  124  KEILKFKDDVINYVEELDNNPDFDRNETLGHFI  156



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   253 bits (647),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL Y+EE + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFL  153



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG+GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLVSAYVLAKAGVNVVLYEKENYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FESLGVDME+SDMSFSVSLD G G EWGSRNG SGLFAQK+N+LNPYFWQMIR
Sbjct  61   YPNMMEFFESLGVDMELSDMSFSVSLDKGRGCEWGSRNGLSGLFAQKRNVLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+D +SY+   +NN  +D N++LG+F+
Sbjct  121  EIIKFKDDAISYIAMIENNLQIDHNESLGQFL  152



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   253 bits (646),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  389
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             E++KFK+DVL YLEE +NNPD+DRN TLG+FI
Sbjct  121  GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFI  153



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   253 bits (646),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  389
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             E++KFK+DVL YLEE +NNPD+DRN TLG+FI
Sbjct  121  GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFI  153



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   257 bits (657),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 126/175 (72%), Positives = 139/175 (79%), Gaps = 23/175 (13%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV-  389
            MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV 
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRVV  60

Query  390  ----------------------TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  503
                                  TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSR
Sbjct  61   GFVTNLRVGLIDLEGYWDHEQVTYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSR  120

Query  504  NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            NGFSGLFAQKKN LNPYFW+M+REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+
Sbjct  121  NGFSGLFAQKKNALNPYFWKMLREIVKFKDDVLSYLEVLENNPVVDRNETLGQFV  175



>ref|XP_008460675.1| PREDICTED: uncharacterized protein LOC103499444 isoform X2 [Cucumis 
melo]
Length=740

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61   YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFK+DV++YLE  +NN D+DRN+TLG+FI
Sbjct  121  EIVKFKDDVINYLEVIENNSDIDRNETLGQFI  152



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   255 bits (652),  Expect = 5e-74, Method: Composition-based stats.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  207  LKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            + M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN 
Sbjct  772  VAMKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNT  831

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQM
Sbjct  832  VTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQM  891

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREI+KFK+DV +YLE  +NN D+DRN+TLG+FI
Sbjct  892  IREIVKFKDDVTNYLEVLENNSDIDRNETLGQFI  925


 Score =   241 bits (614),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 118/175 (67%), Positives = 134/175 (77%), Gaps = 23/175 (13%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN---  383
            M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN   
Sbjct  1    MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVL  60

Query  384  --------------------RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  503
                                +VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR
Sbjct  61   PLHFHLSLSLYDYEYSFGFEQVTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSR  120

Query  504  NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            NG S LF+QKKNLLNPYFWQMIREI+KFK+DV++YLE  +NN D+DRN+TLG+FI
Sbjct  121  NGLSSLFSQKKNLLNPYFWQMIREIVKFKDDVINYLEVLENNSDVDRNETLGQFI  175



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRCDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y+EE + NPD+DR++TLGEF+
Sbjct  121  REIVKFKEDVLRYIEELEANPDIDRSETLGEFL  153



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   249 bits (637),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+V VVGAGI+GL+SAY LAK G  VV+YEKE ++GGHAKTV +DGV+LDLGF++FNRVT
Sbjct  1    MKVGVVGAGINGLISAYALAKCGVKVVIYEKEHFIGGHAKTVAVDGVELDLGFIIFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YP MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIR
Sbjct  61   YPYMMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI++FK DV+SYLEE DNNPD+D N+TLG+FI
Sbjct  121  EIIRFKQDVISYLEEVDNNPDIDCNETLGQFI  152



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y+EE + NPD+DR++TLGEF+
Sbjct  121  REIVKFKEDVLRYIEELEANPDIDRSETLGEFL  153



>ref|XP_006350408.1| PREDICTED: uncharacterized protein LOC102579763 isoform X2 [Solanum 
tuberosum]
Length=812

 Score =   248 bits (634),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  389
            M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1    MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61   TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DV+SYLEE DNNPD+DRN TLG+FI
Sbjct  121  REIIRFKQDVISYLEELDNNPDIDRNKTLGQFI  153



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   249 bits (636),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 114/152 (75%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AV+G GISGL+SAYVL K G  VV+YEKE  LGGHA TVT   VD DLGFMVFNRVT
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVVLYEKEGDLGGHANTVTFHDVDSDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL NPYFWQMIR
Sbjct  61   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNPYFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFKNDV+SYL+  +NNPD DRN+TLG+F+
Sbjct  121  EIIKFKNDVISYLKVLENNPDFDRNETLGQFV  152



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMM+ FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61   TYPNMMDFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y+EE ++NPD+ RN+TLGEF+
Sbjct  121  REIVKFKEDVLKYIEELESNPDISRNETLGEFL  153



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y+EE + NPD+DR++TLGEF+
Sbjct  121  REIVKFKEDVLRYIEELEANPDIDRSETLGEFL  153



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   248 bits (632),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4    KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+
Sbjct  64   TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQML  123

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             EI +FK+D L Y+EE +NNPD++RN+TLG+F+
Sbjct  124  WEINQFKDDALRYIEELENNPDINRNETLGQFL  156



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGISGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL Y+EE + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFL  153



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL Y+EE + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFL  153



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL Y+EE + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFL  153



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL Y+EE + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFL  153



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAVVG+GISGL SAYVLA  G   +V+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVVGSGISGLGSAYVLANQGVEEIVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE LGV+ME+SDMSFSVSLDNG G EWGSRNG SGLF+QKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFEKLGVEMEVSDMSFSVSLDNGKGCEWGSRNGVSGLFSQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y++E + NPD+DRN+TLGEF+
Sbjct  121  REIVKFKEDVLKYIDELEGNPDIDRNETLGEFL  153



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MI
Sbjct  61   TYPNMMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y++E + NPD+DRN+TLGEF+
Sbjct  121  REIVKFKEDVLKYIKELEGNPDIDRNETLGEFL  153



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNMME FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQK N+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKTNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK DVL Y+EE + NPD+DRN TLG+F+
Sbjct  121  REIVKFKEDVLKYIEELEGNPDIDRNQTLGDFL  153



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   248 bits (633),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  389
            M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1    MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61   TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DV+SYLEE DNNPD+DRN TLG+FI
Sbjct  121  REIIRFKQDVISYLEELDNNPDIDRNKTLGQFI  153



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL+Y+E+ + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFL  153



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   246 bits (629),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4    KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+
Sbjct  64   TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQML  123

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             EI +FK+D L Y+EE +NNPD++RN+TLG+F+
Sbjct  124  WEINQFKDDALRYIEELENNPDINRNETLGQFL  156



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   246 bits (628),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  255  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  434
            +AY  A+GGA VVVYEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVTYPNMMELFESL VD
Sbjct  15   AAYEAARGGAKVVVYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVTYPNMMELFESLRVD  74

Query  435  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  614
            MEISDMSFSVSLD G G EWGSRNG  GLFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75   MEISDMSFSVSLDEGRGCEWGSRNGLLGLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  615  EFDNNPDMDRNDTLGEFI  668
              + NPD+DRN+TLG+F+
Sbjct  135  GLERNPDIDRNETLGQFV  152



>ref|XP_006431328.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
 gb|ESR44568.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
Length=585

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1    MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
             PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKN LNPYFWQM+R
Sbjct  61   SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNFLNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+D L Y++E +NNPD++RN+TLG+F+
Sbjct  121  EINKFKDDALRYIDELENNPDINRNETLGQFL  152



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++FK DVL+Y+E+ + NPD+DR +TLGEF+
Sbjct  121  REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFL  153



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   245 bits (625),  Expect = 9e-72, Method: Composition-based stats.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  258  AYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVDM  437
            AY+L  GG  VV+YEKEDYLGGHAKTVT+DG  LDLGFMVFNRVTYPNMME FE+LGVDM
Sbjct  20   AYILEGGGVEVVLYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRVTYPNMMEFFETLGVDM  79

Query  438  EISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEE  617
            E+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MIREI+KFK+DVL+YLE+
Sbjct  80   ELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMIREIIKFKDDVLNYLEQ  139

Query  618  FDNNPDMDRNDTLGEFI  668
             DNNPD+DR +TLG F+
Sbjct  140  LDNNPDIDRTETLGHFV  156



>gb|KJB28512.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=828

 Score =   244 bits (623),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>gb|KJB28513.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=816

 Score =   244 bits (623),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   244 bits (623),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  255  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  434
            +AY   +GGA VVVYEKEDYLGGHAKTV++DGVDLDLGFMVFNRVTYPNMMELFESLGVD
Sbjct  15   AAYEAVRGGAKVVVYEKEDYLGGHAKTVSIDGVDLDLGFMVFNRVTYPNMMELFESLGVD  74

Query  435  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  614
            MEISDMSFSVSLD G G EWG RNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75   MEISDMSFSVSLDEGQGCEWGGRNGLWSLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  615  EFDNNPDMDRNDTLGEFI  668
              + NPD+DRN+TLG+F+
Sbjct  135  GLERNPDIDRNETLGQFV  152



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   243 bits (621),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>gb|KJB28510.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=620

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   243 bits (619),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 107/152 (70%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+G GISGL +A+VLA+ G  VV+YEKE+ LGGHA+TV  DGVD+D+GFMVFNRVT
Sbjct  1    MRVAVIGGGISGLGAAHVLARDGVEVVLYEKEENLGGHARTVRFDGVDVDIGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE LGVD+E+SD SFSVSLD+G G EWGSRNG S LFAQK N+ NP+FWQMIR
Sbjct  61   YPNMMEFFEDLGVDLEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVFNPHFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVL Y+EE ++NP++DR +TLG+F+
Sbjct  121  EMVKFKDDVLRYIEELESNPNLDRTETLGQFL  152



>gb|KJB28511.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=681

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKNDV+SYLE  +NNPD+DRN+TLG+FI
Sbjct  121  EILKFKNDVISYLELLENNPDIDRNETLGQFI  152



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   242 bits (618),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            +MR+AVVG G+SGL +AYVLAK GA VVVYEKED LGG AKT T+DG  LDLGFMVF+RV
Sbjct  3    RMRMAVVGGGVSGLAAAYVLAKDGAEVVVYEKEDRLGGQAKTATIDGTPLDLGFMVFSRV  62

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
             YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW MI
Sbjct  63   IYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNMI  122

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KFK D  +Y+EE +NNPD+DRN+TL ++I
Sbjct  123  REIIKFKGDASAYVEELENNPDIDRNETLEDYI  155



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   242 bits (617),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  255  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  434
            +AY  A+GGA VVVYEKEDYLGGHAKTV+ +GVDLDLGFMVFNRVTYPNMMELFESLGV+
Sbjct  15   AAYEAARGGAKVVVYEKEDYLGGHAKTVSFNGVDLDLGFMVFNRVTYPNMMELFESLGVE  74

Query  435  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  614
            MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75   MEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  615  EFDNNPDMDRNDTLGEFI  668
              ++NPD++R++TLG+FI
Sbjct  135  GLESNPDINRSETLGQFI  152



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +3

Query  228  VGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNM  404
            +G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRVTYPNM
Sbjct  1    IGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRVTYPNM  60

Query  405  MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILK  584
            ME FE L VDME+SDMSF+VSLDNG G EWGSRNG SGLFAQ+KN+LNPYFW+MIREI+K
Sbjct  61   MEFFEKLAVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQRKNVLNPYFWRMIREIVK  120

Query  585  FKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            FK DVL Y+EE + NPD+DRN+TLGEF+
Sbjct  121  FKEDVLKYIEELEGNPDIDRNETLGEFL  148



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAV+G G SGL +A+VLA+ G  VV+YEKE+ LGGHAKTV  DGVD+D+GFMVFNRV 
Sbjct  1    MRVAVIGGGTSGLGAAHVLARDGVEVVLYEKEENLGGHAKTVRFDGVDVDIGFMVFNRVM  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMME FE LGVDME+SD SFSVSLD+G G EWGSRNG S LFAQK N+LNP+FWQMIR
Sbjct  61   YPNMMEFFEDLGVDMEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVLNPHFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DVL Y+E  ++NP++DR +TLG+FI
Sbjct  121  EMVKFKDDVLRYIEALESNPNLDRTETLGQFI  152



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   234 bits (596),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  255  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  434
            +AY LAK G  VV++EKEDYLGGHAKTV  DG+DLDLGFMVFNRVTYPNMMELFESLG++
Sbjct  15   AAYELAKAGVNVVLHEKEDYLGGHAKTVHFDGIDLDLGFMVFNRVTYPNMMELFESLGIE  74

Query  435  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  614
            ME+SDMSFSVSLD G G EWGSRNG  GLFAQK N +NPYFW+MI+EI+KFKN+V+ YLE
Sbjct  75   MELSDMSFSVSLDKGRGCEWGSRNGLRGLFAQKANAVNPYFWKMIQEIIKFKNEVIMYLE  134

Query  615  EFDNNPDMDRNDTLGEFI  668
            E +NN D+DR +TLG FI
Sbjct  135  ELENNADIDRTETLGHFI  152



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 132/175 (75%), Gaps = 23/175 (13%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGF-------  371
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV   LGF       
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVTGILGFRNGTIMS  60

Query  372  ----------------MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  503
                            M+   VTYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSR
Sbjct  61   VNFVLLGTYILLDLIGMMARDVTYPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSR  120

Query  504  NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            NG S LFAQKKN+LNPYFWQMI +++KFK+DVL YLEE +NNPDMDRN TLG+FI
Sbjct  121  NGLSSLFAQKKNILNPYFWQMIGDVIKFKDDVLKYLEELENNPDMDRNQTLGDFI  175



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG GISGL SAYVLA+ G  VV+YE+++ LGGHAKTV  DG D+DLGFM+FNRVT
Sbjct  1    MRVAVVGGGISGLGSAYVLAREGVEVVLYERDENLGGHAKTVRFDGADVDLGFMIFNRVT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME+SDMSFSVSL+NG G EWGSRNGFS LFAQK N+ N +FWQMIR
Sbjct  61   YPNMMELFEDLGVDMEVSDMSFSVSLENGGGLEWGSRNGFSSLFAQKSNVFNTHFWQMIR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KF +DV  Y++  ++NP++DR +TLG+F+
Sbjct  121  EIVKFPDDVSRYIDPLESNPNLDRTETLGQFL  152



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   231 bits (588),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 2/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  389
            MRVAV+G GISGL SAYVLAK GA VVVYEKED LGGHA KTV   GVD+DLGF+ FN  
Sbjct  1    MRVAVIGGGISGLASAYVLAKAGAEVVVYEKEDCLGGHANKTVNYKGVDVDLGFLAFNPA  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            +YPNM E FES+GVDME+SDMSFSVS+D G GYEWGSR G S LFAQKKN  NPYFWQM+
Sbjct  61   SYPNM-EFFESIGVDMELSDMSFSVSIDKGKGYEWGSRKGLSSLFAQKKNSFNPYFWQML  119

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            R+I KFK+D LSYLE+ +NN D++ N+ LG+FI
Sbjct  120  RDINKFKHDALSYLEQIENNTDINENERLGQFI  152



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   229 bits (584),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 113/162 (70%), Positives = 131/162 (81%), Gaps = 10/162 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDGVD------LDLGF  371
            MRVAVVGAG+SGL +A+ LA+ GG+ V VYEKEDYLGGHA+TV ++  D      LDLGF
Sbjct  1    MRVAVVGAGVSGLAAAHELARSGGSRVTVYEKEDYLGGHARTVAVEDADAASTVQLDLGF  60

Query  372  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNL  542
            MVFNRVTYPNM+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N 
Sbjct  61   MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNA  120

Query  543  LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            L+P FW+MIREILKFKND L YLE+ +NNPDMDRN+TLG+FI
Sbjct  121  LSPSFWRMIREILKFKNDALRYLEDHENNPDMDRNETLGQFI  162



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   228 bits (582),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 115/155 (74%), Positives = 131/155 (85%), Gaps = 3/155 (2%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK---GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN  383
            MRVAV+G GISGL SAYVLA    GG  VV+YEK+D LGGHAKTV  D  D+DLGFMVFN
Sbjct  1    MRVAVIGGGISGLGSAYVLATRHGGGDEVVLYEKDDALGGHAKTVRFDSADVDLGFMVFN  60

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
            RVTYPNMME FE LGVDME+SDMSFSVSLD+G G EWGSRNGFSGLFAQK N  NPYFW+
Sbjct  61   RVTYPNMMEFFEELGVDMEVSDMSFSVSLDDGRGCEWGSRNGFSGLFAQKSNAFNPYFWK  120

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MIREI+KFK+DVL Y+E  + NPD+DR++TLG+F+
Sbjct  121  MIREIVKFKDDVLRYIESRELNPDLDRSETLGQFL  155



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 127/160 (79%), Gaps = 0/160 (0%)
 Frame = +3

Query  189  RRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLG  368
            R++ E  +MRVAV+G GI GLVSAYVLAK G  VVVYEK    GGHA+TV    +DLDL 
Sbjct  55   RQQTEYYRMRVAVIGGGIRGLVSAYVLAKAGVNVVVYEKGKQFGGHARTVNFHAIDLDLA  114

Query  369  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  548
            FM  N   +PN+++ F  LGVD+E SD+SFSVSLDNG GYEWG++ GFS LFAQKKN+ N
Sbjct  115  FMFLNPAKHPNVLDFFTGLGVDVETSDVSFSVSLDNGQGYEWGNQKGFSSLFAQKKNVFN  174

Query  549  PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            PYFWQM+REI++FK+DV+SYL+E +NNPD  RN+T+G+FI
Sbjct  175  PYFWQMLREIIRFKDDVVSYLQELENNPDTGRNETMGQFI  214



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   227 bits (578),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 106/156 (68%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDL--GFMVF  380
            M+VAV+G GISGLVSA+VLA+  G   +V++EKE+ LGGHAKTV  DGVDLDL  GF+ F
Sbjct  1    MKVAVIGGGISGLVSAFVLAREDGVEELVLFEKEETLGGHAKTVRFDGVDLDLDLGFIAF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            NR+TYP+MME F++LGVD+E+ DMSFSVSLD+G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   NRITYPSMMEFFKNLGVDLEVLDMSFSVSLDSGKGCEWGSRNGLSSLFAQKKNILNPYFW  120

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +MI E +KFK DV  Y+EE ++NPD+DR +TLGEF+
Sbjct  121  KMITENMKFKKDVEKYIEELEHNPDIDRKETLGEFV  156



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   224 bits (570),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 10/161 (6%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  377
            RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3    RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  545
            FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63   FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F+
Sbjct  123  SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFV  163



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   224 bits (572),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M  AV+G GI GLVSAYVLAK G  VVVYEKED  GGHAKTV    +DLDLGF+  N  T
Sbjct  1    MGFAVIGGGIRGLVSAYVLAKAGVNVVVYEKEDQFGGHAKTVNFHAIDLDLGFLFLNPAT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDN-GHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            YP M+ELF+ LGVD+E SD+SFSVS D  GHGYEWG+ +GFS LFA +KN+LNPYFWQ++
Sbjct  61   YPTMLELFDILGVDVEASDVSFSVSHDKLGHGYEWGTHHGFSSLFAHRKNMLNPYFWQVL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KF++D +SYL   +NNPD+DRN+TLG+FI
Sbjct  121  REIIKFRDDAISYLHMLENNPDIDRNETLGQFI  153



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   224 bits (572),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 10/161 (6%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  377
            RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3    RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  545
            FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63   FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F+
Sbjct  123  SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFV  163



>gb|KDO54089.1| hypothetical protein CISIN_1g037740mg, partial [Citrus sinensis]
Length=130

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1    MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
             PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+ 
Sbjct  61   SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQMLW  120

Query  573  EILKFKNDVL  602
            EI KFK+D L
Sbjct  121  EINKFKDDAL  130



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   223 bits (568),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 106/155 (68%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  383
            MRVAV+G G+ GL SAYVLA+  G   VV++EKE+  LGGHAKT+ LDGVDLD+GF+V N
Sbjct  1    MRVAVIGGGVCGLGSAYVLAREDGIEEVVLFEKEESVLGGHAKTMRLDGVDLDVGFIVCN  60

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
             VT+PNMME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQ
Sbjct  61   PVTHPNMMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQ  120

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MI E  KF  D L Y+EE + NPD DRN+TLGEF+
Sbjct  121  MITEFYKFNKDALKYIEEMERNPDTDRNETLGEFL  155



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   223 bits (567),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IRE  KFK DV  YLE+ + N D+DR DTLGEF+
Sbjct  121  IRETKKFKEDVQKYLEDLERNLDVDRTDTLGEFL  154



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   222 bits (566),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 10/162 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAG--VVVYEKEDYLGGHAKTVTLDG-----VDLDLGF  371
            MRVAVVGAG+SGL +A+ LA+ GAG  V VYEKED LGGHA+TV ++      V LDLGF
Sbjct  1    MRVAVVGAGVSGLAAAHELARSGAGARVTVYEKEDCLGGHARTVAVEDAAAGTVHLDLGF  60

Query  372  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG---YEWGSRNGFSGLFAQKKNL  542
            MVFNRVTYPNM+E FE LGV+MEISDMSFSVS   G G    EWGSRNG SGL AQK N 
Sbjct  61   MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTQLGTGGSRCEWGSRNGISGLLAQKSNA  120

Query  543  LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            ++P FW MIREILKFK+D L YLE+ +NNPDMDRN+TLG+FI
Sbjct  121  ISPSFWCMIREILKFKDDALKYLEDRENNPDMDRNETLGQFI  162



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   222 bits (565),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVGAG+SGL +A+ LA+G A V VYE E+ LGGHA+T  +DGV LDLGFMVFNRVT
Sbjct  5    MRVAVVGAGVSGLAAAHELARGAARVTVYEAEEALGGHARTADVDGVHLDLGFMVFNRVT  64

Query  393  YPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            YPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N + P FW M
Sbjct  65   YPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNAVRPAFWHM  124

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREILKFK D L YLE+ ++NPD+DR++TLG+FI
Sbjct  125  IREILKFKEDALKYLEDHESNPDLDRHETLGQFI  158



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   221 bits (562),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IRE  +FK DV  YLE+ + N D+DR +TLGEF+
Sbjct  121  IRETKRFKEDVQKYLEDLERNLDVDRTETLGEFL  154



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   220 bits (560),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNP+FWQM
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPFFWQM  120

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IRE  KFK DV  YLE+ + N D+DR +TLGEF+
Sbjct  121  IRETKKFKEDVQKYLEDLERNLDVDRTETLGEFL  154



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   219 bits (557),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            MRVAV+G+GISGL SAYVLAK  G   +V++EKE+ LGGHAKT+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGSGISGLGSAYVLAKEDGIEELVLFEKENSLGGHAKTMRFDGVDLDLGFTVFNP  60

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT PNMME F++LGVD+E+S+MS SVSLDNG G EWGSRNG S LFAQKKN+LNPYFW+M
Sbjct  61   VTSPNMMEFFKNLGVDLEVSEMSLSVSLDNGTGCEWGSRNGLSSLFAQKKNVLNPYFWKM  120

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            + E  KFK DV  Y+EE +  PD+DRN+TLGEF+
Sbjct  121  LIENNKFKEDVEKYIEELERKPDIDRNETLGEFL  154



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   216 bits (551),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 107/156 (69%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  386
            RVAVVGAG+SGL +A+ L + G     V VYE E+ LGGHA+T  +DGV LDLGFMVFNR
Sbjct  7    RVAVVGAGVSGLAAAHELCRAGGNGVRVTVYEAEERLGGHARTADVDGVQLDLGFMVFNR  66

Query  387  VTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L P FW
Sbjct  67   VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPGFW  126

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             MIREILKFK DVLSYL   +NNPD+DRN+TLGEFI
Sbjct  127  HMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFI  162



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   216 bits (550),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 101/155 (65%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  383
            M+VAV+G G+SGL SA+ LA+  G   VV++EKE+ + GGH KT+  +GVDLD+GF+VFN
Sbjct  1    MKVAVIGGGVSGLGSAHDLAREDGIKEVVLFEKEESFFGGHGKTMRFEGVDLDIGFIVFN  60

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
             VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW 
Sbjct  61   PVTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWH  120

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MI E  KFK D L+Y+EE + NPD DRN+TL EF+
Sbjct  121  MITEFNKFKEDALNYIEEMERNPDTDRNETLREFV  155



>ref|XP_002862680.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=181

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 113/146 (77%), Gaps = 18/146 (12%)
 Frame = +3

Query  234  AGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMME  410
            +GISGL SAYVLA  G   VV+YEKE+ LGGHAKTVT                 YPNMME
Sbjct  19   SGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVT-----------------YPNMME  61

Query  411  LFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFK  590
             FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMIREI++FK
Sbjct  62   FFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMIREIVRFK  121

Query  591  NDVLSYLEEFDNNPDMDRNDTLGEFI  668
             DVL Y+EE + NPD+DR +TLGEF+
Sbjct  122  EDVLKYIEELEGNPDIDRKETLGEFL  147



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   207 bits (527),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 101/152 (66%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M+VAV+G GI GLVSA VLAK GA VVVYEKE+ +GG AKT   +G+DLDLGF+ FN   
Sbjct  1    MKVAVIGGGIGGLVSACVLAKAGANVVVYEKEEQVGGQAKT--FNGIDLDLGFITFNPAM  58

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
             P+ +ELF+SLGVD+E  +MSFSVSLDNG  YEWG+RNGFS LFAQK+N+LNPYFW+M+R
Sbjct  59   NPSTLELFDSLGVDVEACNMSFSVSLDNGQDYEWGTRNGFSSLFAQKQNVLNPYFWKMLR  118

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E++KFK+DV+SYL+  +NNPD+D  +TLG+FI
Sbjct  119  ELIKFKDDVISYLQMLENNPDIDGYETLGQFI  150



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GLVSAYVLAK G  VVVYEKE+ +GGHAKTV+ D VDLDLG +  N   
Sbjct  1    MGVAVIGGGIQGLVSAYVLAKAGVNVVVYEKEEQVGGHAKTVSFDAVDLDLGLLFLNPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YP M+ELF+SL VD+E +D+SFSVS D G+GYEW S+ GFS   A KK +LNPY WQ +R
Sbjct  61   YPTMLELFDSLEVDVEATDVSFSVSHDKGNGYEWCSQYGFSNFLAHKKKMLNPYNWQDLR  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            E +KF NDV SYLE  + NPD+DRN+TLG F+
Sbjct  121  ETIKFGNDVNSYLESLEKNPDIDRNETLGHFV  152



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   203 bits (516),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GL+SAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLLSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            Y  ++ +F+SLGVD+E SD+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61   YATLLHMFDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQSL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KF NDV SYL   +NNPD+DR +TLG+FI
Sbjct  121  REIIKFGNDVESYLGSLENNPDIDRTETLGQFI  153



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   202 bits (513),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            Y  ++++ +SLGVD+E SD+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61   YATLLDIIDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++F NDV SYL   +NNPD+DR +TLG+FI
Sbjct  121  REIIRFSNDVESYLGSLENNPDIDRTETLGQFI  153



>gb|KJB70810.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=838

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  219  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  398
            VAV+G GI GLVSAYV+AKGG  VVVYEKE  LG HA TV  D  DLDL F+  N  +Y 
Sbjct  4    VAVIGGGIRGLVSAYVVAKGGVDVVVYEKEKQLGRHAITVNFDATDLDLRFLFLNPASYA  63

Query  399  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREI  578
             M+E+FESLGVD+E SD+SFSVS D G+GYEW S+ GFS  FAQKK LLNP+ W+ +REI
Sbjct  64   TMLEMFESLGVDVETSDVSFSVSHDKGNGYEWSSQYGFSNYFAQKKKLLNPFNWRNLREI  123

Query  579  LKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +KF NDV SYLE  +NNPD+DRN+T G+F+
Sbjct  124  IKFGNDVESYLELLENNPDIDRNETFGQFL  153



>gb|KJB12596.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=820

 Score =   201 bits (512),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            Y  ++++ +SLGVD+E  D+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61   YATLLDIIDSLGVDVETPDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++F NDV SYL   +NNPD+DR +TLG+FI
Sbjct  121  REIIRFSNDVESYLGSLENNPDIDRTETLGQFI  153



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  219  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  398
            VAV+G GI GLVSAYV+AKGG  VVVYEKE  LG HA TV  D  DLDL F+  N  +Y 
Sbjct  4    VAVIGGGIRGLVSAYVVAKGGVDVVVYEKEKQLGRHAITVNFDATDLDLRFLFLNPASYA  63

Query  399  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREI  578
             M+E+FESLGVD+E SD+SFSVS D G+GYEW S+ GFS  FAQKK LLNP+ W+ +REI
Sbjct  64   TMLEMFESLGVDVETSDVSFSVSHDKGNGYEWSSQYGFSNYFAQKKKLLNPFNWRNLREI  123

Query  579  LKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +KF NDV SYLE  +NNPD+DRN+T G+F+
Sbjct  124  IKFGNDVESYLELLENNPDIDRNETFGQFL  153



>ref|XP_010532686.1| PREDICTED: uncharacterized protein LOC104808653 isoform X2 [Tarenaya 
hassleriana]
Length=887

 Score =   201 bits (512),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +3

Query  210  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  383
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MIREI KFK+D   Y++E + + D+DR +TLG+F+
Sbjct  124  MIREIAKFKDDASIYVDERERDRDLDRTETLGQFL  158



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   201 bits (511),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 96/153 (63%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            R+AV+GAG+SGLV+AY L K G   VV+YEKE+Y GGHA+T   +G+ +DLGFMVFN+VT
Sbjct  3    RIAVIGAGVSGLVAAYTLCKAGCHEVVLYEKENYFGGHARTEDANGIAVDLGFMVFNQVT  62

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNM+ LF+ LGVDME SDMSFSVSLD G G EWGS  G + +FAQK NL+NPYF +MIR
Sbjct  63   YPNMVSLFDELGVDMETSDMSFSVSLDGGKGCEWGS-TGLAAVFAQKSNLVNPYFLRMIR  121

Query  573  EILKFKNDVLSYLEEFDNNPD-MDRNDTLGEFI  668
            EI+KF++DVL+YL + +   D +D N TLG F+
Sbjct  122  EIVKFQDDVLNYLNKLEQGDDAVDPNQTLGSFL  154



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG-HAKTVT-LDGVDLDLGFMVFNR  386
            MRVAVVG G SGL+S Y+LAK G  VV+YEKE  LGG HA TVT  DG +LD+G + F  
Sbjct  1    MRVAVVGGGTSGLISGYILAKEGVKVVLYEKETRLGGGHANTVTATDGTELDIGLIGFCN  60

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT PN  EL ESLG++M  +D SFSVSL  G G EWG+RNGFS LFAQKKNLLNPYFW+M
Sbjct  61   VTNPNTTELLESLGIEMGPTDTSFSVSLSGGQGCEWGNRNGFSSLFAQKKNLLNPYFWKM  120

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +REI KF +D + Y+ E +NN D+DRN+TL  F+
Sbjct  121  VREITKFNDDAIKYIAELENNQDVDRNETLDHFV  154



>ref|XP_010532687.1| PREDICTED: uncharacterized protein LOC104808653 isoform X3 [Tarenaya 
hassleriana]
Length=717

 Score =   199 bits (506),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +3

Query  210  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  383
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MIREI KFK+D   Y++E + + D+DR +TLG+F+
Sbjct  124  MIREIAKFKDDASIYVDERERDRDLDRTETLGQFL  158



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            Y  ++++ +SLGVD+E  D+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61   YATLLDIIDSLGVDVETPDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI++F NDV SYL   +NNPD+DR +TLG+FI
Sbjct  121  REIIRFSNDVESYLGSLENNPDIDRTETLGQFI  153



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   200 bits (508),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 0/152 (0%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MR AV+G GISGL +A+ LAK G  VV+YEKE+ LGGHA+ V ++G+D+DL FMVFNRV+
Sbjct  1    MRFAVIGGGISGLGAAFELAKAGVEVVLYEKEELLGGHAQIVNVNGIDVDLNFMVFNRVS  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YP+  ELF+ LG+D++  DMS SVSLD G G EWGSRNGF  LFAQ  N L P FW+M++
Sbjct  61   YPHTTELFDGLGIDVDAFDMSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFWRMVQ  120

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI KFK+DV+ YL+  + NP++DR +T G FI
Sbjct  121  EIKKFKDDVIMYLDGLELNPEIDRAETFGHFI  152



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   199 bits (506),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 105/153 (69%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            MRVAVVG G+SGL +AYVLAK G  VVVYEKED LGG AKTV + G  LDLGF VF RV 
Sbjct  1    MRVAVVGGGVSGLAAAYVLAKDGVEVVVYEKEDALGGRAKTVDIGGTLLDLGFTVFTRVM  60

Query  393  YPNMMELFESLGVDMEISDMS-FSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            +P  +EL ESLGVD E+ DMS FSVSLD G G EWG+RNG S LFA+K N LNPYFW MI
Sbjct  61   HPETIELLESLGVDRELCDMSSFSVSLDEGQGCEWGTRNGVSSLFARKTNALNPYFWNMI  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            RE++KFKND  SY+EE ++NPD+DRN+TL  FI
Sbjct  121  REMVKFKNDASSYVEELESNPDIDRNETLEHFI  153



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   199 bits (506),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +3

Query  210  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  383
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  564  MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            MIREI KFK+D   Y++E + + D+DR +TLG+F+
Sbjct  124  MIREIAKFKDDASIYVDERERDRDLDRTETLGQFL  158



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   198 bits (504),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 98/156 (63%), Positives = 120/156 (77%), Gaps = 5/156 (3%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG---HAKTVTLDGVDLD-LGFMVF  380
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKED+LG    H  T      D D +GFM+ 
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVNVVLYEKEDHLGEEGIHGNTQQY-AFDFDHMGFMLL  59

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN++NPYFW
Sbjct  60   NPVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNVINPYFW  119

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +MI+E+ KFK DVLSYL+  + N D++ N+T+  FI
Sbjct  120  KMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFI  155



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =   194 bits (494),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 11/160 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  374
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKE++LGG AKTV ++G     V +D+ FM
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEEHLGG-AKTVAVNGGSSGPVLVDVDFM  60

Query  375  VFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLN  548
            VFNRVTYPNMME FE LGV+ME SDMSFS SL  + G+G+EWGSRNG S +  QK N L+
Sbjct  61   VFNRVTYPNMMEWFERLGVEMETSDMSFSASLRLNKGNGFEWGSRNGISSVLVQKSNFLS  120

Query  549  PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            P FW MI EI KFKN  L YLE+   NP  D+N+TLG+FI
Sbjct  121  PRFWLMINEIFKFKNHALKYLEDHARNP--DQNETLGQFI  158



>gb|KGN61576.1| hypothetical protein Csa_2G172460 [Cucumis sativus]
Length=160

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  389
            M+VAV+GAGI GLV +YVLAK G  VV++E+E+YLG H  +T+T DG DLDL  MVFN V
Sbjct  1    MKVAVIGAGIKGLVCSYVLAKAGVEVVLFEREEYLGSHRYRTITFDGFDLDLAIMVFNPV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T+PN M L E L V+ME S+MSFS+S+D G GYEWG+RNG S LFAQK N+L+  FWQMI
Sbjct  61   THPNTMALLEDLEVEMEESNMSFSISIDKGRGYEWGTRNGVSSLFAQKNNILDLSFWQMI  120

Query  570  REILKFKNDVLSYL  611
            REI KF +DV  Y+
Sbjct  121  REITKFNDDVTEYV  134



>gb|KGN61579.1| hypothetical protein Csa_2G172490 [Cucumis sativus]
Length=143

 Score =   176 bits (446),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  389
            M+VAV+GAGI GLV +YVLAK G  VV++E+E+YLG H  +T+T DG DLDL  MVFN V
Sbjct  1    MKVAVIGAGIKGLVCSYVLAKAGVEVVLFEREEYLGSHRYRTITFDGFDLDLAIMVFNPV  60

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            T+PN M L E L V+ME S+MSFS+S+D G GYEWG+RN F+ LFAQK N+L+  FWQMI
Sbjct  61   THPNTMALLEDLEVEMEESNMSFSISIDKGRGYEWGTRNCFASLFAQKNNILDLSFWQMI  120

Query  570  REILKFKNDV  599
            REI KF +DV
Sbjct  121  REITKFNDDV  130



>ref|XP_008664677.1| PREDICTED: uncharacterized protein LOC103643302 isoform X2 [Zea 
mays]
 tpg|DAA49063.1| TPA: hypothetical protein ZEAMMB73_143484 [Zea mays]
Length=873

 Score =   189 bits (481),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 10/159 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  377
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  551
            FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61   FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  552  YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             FW MI EI KFKN  L Y E++  NP  D+N+T G+FI
Sbjct  121  RFWLMINEIFKFKNHALKYQEDYARNP--DKNETFGQFI  157



>ref|XP_008664676.1| PREDICTED: uncharacterized protein LOC103643302 isoform X1 [Zea 
mays]
Length=875

 Score =   189 bits (481),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 10/159 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  377
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  551
            FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61   FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  552  YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             FW MI EI KFKN  L Y E++  NP  D+N+T G+FI
Sbjct  121  RFWLMINEIFKFKNHALKYQEDYARNP--DKNETFGQFI  157



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   185 bits (470),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 11/161 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  371
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  372  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  545
            MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62   MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +P FW +IREI+KFKN  L YLE+   NP  DRN+TLG+FI
Sbjct  122  SPRFWLVIREIIKFKNHALKYLEDHGRNP--DRNETLGQFI  160



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   185 bits (470),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 11/161 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  371
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  372  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  545
            MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62   MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +P FW +IREI+KFKN  L YLE+   NP  DRN+TLG+FI
Sbjct  122  SPRFWLVIREIIKFKNHALKYLEDHGRNP--DRNETLGQFI  160



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =   184 bits (468),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 12/161 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  374
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG  KT+ +D      V  DLG M
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGG--KTMAVDDGAGGRVPADLGCM  59

Query  375  VFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKNLL  545
            VFNR+T PNMM  FE LGV++E SDMSFS SL   D G G+EWGS NG SG+ AQK NLL
Sbjct  60   VFNRMTCPNMMRWFEDLGVEVETSDMSFSASLRLDDKGGGFEWGSHNGISGVLAQKSNLL  119

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +P FW +IREI+KFKN  L YLEE D+  + DRN+TLG+FI
Sbjct  120  SPRFWLVIREIIKFKNHALKYLEE-DHGRNPDRNETLGQFI  159



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2    VTYPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  62   IREIIKFKQDVISYLEALDNNPDIDRNETLGHFI  95



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   181 bits (459),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +3

Query  249  LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  428
            L +A+ LA  G  V +YEKEDY+GGHA+T+   G+ LD GFMVFNRVTYPNM++ FE  G
Sbjct  13   LTAAHTLASAGIQVTLYEKEDYVGGHARTIHDVGIGLDTGFMVFNRVTYPNMIDFFEQAG  72

Query  429  VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  608
            V+ME SDMSFSVSL+ G G EWGS     GLFAQK+N++NP+F+QMIREI++FK+DVLSY
Sbjct  73   VEMEESDMSFSVSLNGGKGCEWGS-TSLGGLFAQKRNMINPFFFQMIREIVRFKDDVLSY  131

Query  609  LEEFDNNPDMDRND-TLGEFI  668
            LE+ ++  +  R D TLGEF+
Sbjct  132  LEKIESGDESIRQDETLGEFL  152



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   179 bits (453),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 79/94 (84%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2    VTYPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  62   IREIIKFKRDVISYLEALDNNPDIDRNETLGHFI  95



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   177 bits (450),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 103/152 (68%), Gaps = 32/152 (21%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+
Sbjct  89   EIIKFKNDVICYLKVLESNPDFDRNETLGQFV  120



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 103/152 (68%), Gaps = 32/152 (21%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+
Sbjct  89   EIIKFKNDVICYLKVLESNPDFDRNETLGQFV  120



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   178 bits (451),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLG--GHAKTVTLDGVDLD--LGFMV  377
            MR+AV+G GI G+  A+ LAK G   VV+Y+K+DYLG   H KTV +DGVDLD  LGFM 
Sbjct  1    MRIAVIGGGICGVGVAFELAKAGIHQVVLYDKDDYLGETTHTKTVNIDGVDLDIDLGFMF  60

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FNRV+YPN+ EL +SLG+D+  SDMSFSVSL+ G G EWG+RNG   L+AQK N L P +
Sbjct  61   FNRVSYPNLTELMDSLGIDIVASDMSFSVSLNKGQGCEWGNRNGLRSLYAQKSNALKPSY  120

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            W M++EI KF++DV+ YLE  ++NPDMDR +TL  FI
Sbjct  121  WGMLQEIKKFEDDVILYLEGLESNPDMDRTETLSHFI  157



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   176 bits (446),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 84/140 (60%), Positives = 105/140 (75%), Gaps = 6/140 (4%)
 Frame = +3

Query  249  LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  428
            L +A VL   G  VV+YE+E++    A T T+DG  +D+GF+  N VTY NM+ELFESLG
Sbjct  12   LTAARVLKDAGVDVVIYEREEW----APTFTVDGTRIDIGFL--NPVTYSNMVELFESLG  65

Query  429  VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  608
            ++ E+SD+SFSVSLDNG GYEWG RNG S LFAQKKN+ NPY+W M+REI KF  DV+SY
Sbjct  66   LEAELSDVSFSVSLDNGRGYEWGIRNGLSSLFAQKKNVFNPYYWTMLREIRKFSGDVISY  125

Query  609  LEEFDNNPDMDRNDTLGEFI  668
            L+    N D+DRN+TLG FI
Sbjct  126  LQVIGENADVDRNETLGHFI  145



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   176 bits (446),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M VAV+G GI GLVSAYVLAK G   VVYEKE+ LGG+AKTV  D +DLDLGF+  +   
Sbjct  1    MGVAVIGGGIKGLVSAYVLAKAGVDAVVYEKEEQLGGYAKTVNFDALDLDLGFLFLDPAR  60

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            Y  ++ +F+ LGVD+E SD+SFSVS D G +GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61   YATLLNMFDCLGVDVETSDVSFSVSHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQSL  120

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            REI+KF NDV SYL   +NNPD+DR +TLG+FI
Sbjct  121  REIIKFGNDVESYLGSLENNPDIDRTETLGQFI  153



>gb|KDO54097.1| hypothetical protein CISIN_1g0029283mg, partial [Citrus sinensis]
Length=748

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM
Sbjct  1    VTYPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQM  60

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +REI+KF +DVLSYLE+ +NN D+DRN+TLG+F+
Sbjct  61   LREIIKFNDDVLSYLEDLENNADIDRNETLGQFV  94



>ref|XP_008677861.1| PREDICTED: uncharacterized protein LOC103652693 isoform X2 [Zea 
mays]
Length=834

 Score =   173 bits (439),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 13/163 (8%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  368
            +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18   EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  369  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  539
             +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77   PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  540  LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            LL+P FW ++ EI KFKN  L YLE+  + P  +RN+TLG+FI
Sbjct  137  LLSPRFWLVVHEIFKFKNHALKYLEDHRSGP--NRNETLGQFI  177



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   172 bits (437),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 74/94 (79%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM
Sbjct  1    VTYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQM  60

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +REI+KFK+DVL YLEE ++NPD+DR++TLG+F+
Sbjct  61   LREIIKFKDDVLGYLEELESNPDIDRSETLGQFV  94



>ref|XP_008677860.1| PREDICTED: uncharacterized protein LOC103652693 isoform X1 [Zea 
mays]
Length=887

 Score =   173 bits (439),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 13/163 (8%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  368
            +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18   EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  369  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  539
             +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77   PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  540  LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            LL+P FW ++ EI KFKN  L YLE+  + P  +RN+TLG+FI
Sbjct  137  LLSPRFWLVVHEIFKFKNHALKYLEDHRSGP--NRNETLGQFI  177



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            M+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1    MLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  61   KFKQDVISYLEALDNNPDIDRNETLGHFI  89



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   167 bits (422),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1    MMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DV+SYLE  DNNPD+DRN+TLG FI
Sbjct  61   KFKRDVISYLEALDNNPDIDRNETLGHFI  89



>ref|XP_004172280.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213850, 
partial [Cucumis sativus]
Length=483

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMME FE+LGV+ME SDMSFSVSLDNG G EWGSRNG S LFAQKKNLLNPYFWQM
Sbjct  1    VTYPNMMEFFENLGVEMETSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKKNLLNPYFWQM  60

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREI+KFK+DV++YLE  +NN D+DRN+TLG+FI
Sbjct  61   IREIVKFKDDVINYLEVLENNSDVDRNETLGQFI  94



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   166 bits (419),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VTYPNMMELFESLGV+MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM
Sbjct  1    VTYPNMMELFESLGVEMEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQM  60

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +REI+KFK DVLSYLE  ++NPD++R++TLG+FI
Sbjct  61   LREIIKFKEDVLSYLEGLESNPDINRSETLGQFI  94



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =   163 bits (412),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1    MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK+DVLSYLEE ++NPD+DR++TLG+F+
Sbjct  61   KFKDDVLSYLEELESNPDIDRSETLGQFV  89



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =   161 bits (408),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE+LGVDME+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MIREI+
Sbjct  1    MMEFFETLGVDMELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMIREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK+DVL+YLE+ DNNPD+DR +TLG F+
Sbjct  61   KFKDDVLNYLEQLDNNPDIDRTETLGHFV  89



>ref|XP_002451282.1| hypothetical protein SORBIDRAFT_05g026910 [Sorghum bicolor]
 gb|EES10270.1| hypothetical protein SORBIDRAFT_05g026910 [Sorghum bicolor]
Length=761

 Score =   161 bits (407),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 87/149 (58%), Positives = 102/149 (68%), Gaps = 15/149 (10%)
 Frame = +3

Query  258  AYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDG-------VDLDLGFMVFNRVTYPNMM  407
            A+ LA+ G G   V VYEKEDYLGG AKTV +DG       V +DLG MVFN V  PNMM
Sbjct  16   AHELARSGGGGVRVTVYEKEDYLGG-AKTVAVDGGAAADGRVAVDLGLMVFNPVRSPNMM  74

Query  408  ELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            E FE LGV+M+ SDMSFS S  L+ G G+EWGSRNG S +  QK NLL+P FW +I EI 
Sbjct  75   EWFERLGVEMDTSDMSFSASMRLNKGKGFEWGSRNGMSSVLVQKSNLLSPRFWLVIHEIF  134

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFKN  L YLE+ + +PD   N TLG+FI
Sbjct  135  KFKNHALKYLEDHERDPDW--NQTLGQFI  161



>ref|XP_006421139.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34379.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=650

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1    MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK+DVLSYLEE ++NPD+DR++TLG+F+
Sbjct  61   KFKDDVLSYLEELESNPDIDRSETLGQFV  89



>gb|EMT01204.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=563

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 7/137 (5%)
 Frame = +3

Query  279  GAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMVFNRVTYPNMMELFESLGVDMEIS  446
            G  V +YE+ED LGG A TV +D     V LDLGF++FN+VTY +MME  E LGV+ME S
Sbjct  27   GVRVTLYEEEDRLGGRASTVAVDDGAGRVHLDLGFLIFNQVTYSHMMEWLEGLGVEMERS  86

Query  447  DMSFSVSLDN---GHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEE  617
            DMSFSVS  +     G EWG+ NG S L AQK N+L   FW+M+REILKFKND L+YLE 
Sbjct  87   DMSFSVSTQSDGGSRGCEWGNGNGISSLLAQKANILKTSFWRMVREILKFKNDALTYLEY  146

Query  618  FDNNPDMDRNDTLGEFI  668
             ++NPD+D N+TLG+FI
Sbjct  147  HEHNPDVDCNETLGQFI  163



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =   159 bits (402),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MIREI+
Sbjct  1    MMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMIREIV  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DVL Y++E + NPD+DRN+TLGEF+
Sbjct  61   KFKEDVLKYIKELEGNPDIDRNETLGEFL  89



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   158 bits (399),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLN YFWQM+REI+
Sbjct  1    MMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNLYFWQMLREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KF +DVLSYLE+ +NN D+DRN+TLG+F+
Sbjct  61   KFNDDVLSYLEDLENNADIDRNETLGQFV  89



>gb|KCW60260.1| hypothetical protein EUGRSUZ_H029681, partial [Eucalyptus grandis]
Length=344

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MMELFESLGV+MEISDMS SVSLD G GYEWGSRNG   LFAQK NLLNPYFWQM+RE++
Sbjct  1    MMELFESLGVEMEISDMSISVSLDEGQGYEWGSRNGLLSLFAQKTNLLNPYFWQMLREVI  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DVLSYLE  ++NPD+DR++TLG+FI
Sbjct  61   KFKEDVLSYLEGLESNPDIDRSETLGQFI  89



>ref|XP_009388196.1| PREDICTED: uncharacterized protein LOC103975010, partial [Musa 
acuminata subsp. malaccensis]
Length=137

 Score =   144 bits (364),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            M+E FE+LGVDME+SDMSFSVSLD G G EWGSRNG SGLFAQK N LNP FW+MIREI+
Sbjct  1    MVEFFETLGVDMELSDMSFSVSLDEGKGCEWGSRNGLSGLFAQKTNALNPSFWRMIREIV  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DVL YLEE +NNPDMDR++TL  FI
Sbjct  61   KFKGDVLMYLEEHENNPDMDRSETLEHFI  89



>gb|KJB38366.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=802

 Score =   155 bits (392),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL NPYFWQMIREI+
Sbjct  1    MMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNPYFWQMIREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFKNDV+SYL+  +NNPD DRN+TLG+F+
Sbjct  61   KFKNDVISYLKVLENNPDFDRNETLGQFV  89



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   154 bits (388),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW M
Sbjct  11   VTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWHM  70

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            I E  +FK D L+Y+EE + NPD DRN+TL EF+
Sbjct  71   ITEFKRFKEDALNYIEEMERNPDTDRNETLREFV  104



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   154 bits (388),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 66/94 (70%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  566
            V YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW M
Sbjct  8    VIYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNM  67

Query  567  IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            IREI+KFK D  +Y+EE +NNPD+DRN+TL ++I
Sbjct  68   IREIIKFKGDASAYVEELENNPDIDRNETLEDYI  101



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIREI+
Sbjct  1    MMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIREII  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +FK DV+SYLEE DNNPD+D N+TLG+FI
Sbjct  61   RFKQDVISYLEEVDNNPDIDCNETLGQFI  89



>ref|XP_009766520.1| PREDICTED: uncharacterized protein LOC104217886 isoform X1 [Nicotiana 
sylvestris]
Length=218

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE LGV MEIS+MSFSVSLD G G +WG+RNG S LFAQKKN+LNPYFWQMIREI+
Sbjct  1    MMEFFEFLGV-MEISNMSFSVSLDQGRGCKWGTRNGISSLFAQKKNVLNPYFWQMIREII  59

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DV+SYLE  DNNPD+ R++T+G+FI
Sbjct  60   KFKQDVISYLEALDNNPDIGRDETIGQFI  88



>ref|XP_009766538.1| PREDICTED: uncharacterized protein LOC104217886 isoform X3 [Nicotiana 
sylvestris]
Length=189

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE LGV MEIS+MSFSVSLD G G +WG+RNG S LFAQKKN+LNPYFWQMIREI+
Sbjct  1    MMEFFEFLGV-MEISNMSFSVSLDQGRGCKWGTRNGISSLFAQKKNVLNPYFWQMIREII  59

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DV+SYLE  DNNPD+ R++T+G+FI
Sbjct  60   KFKQDVISYLEALDNNPDIGRDETIGQFI  88



>ref|XP_009766530.1| PREDICTED: uncharacterized protein LOC104217886 isoform X2 [Nicotiana 
sylvestris]
Length=213

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME FE LGV MEIS+MSFSVSLD G G +WG+RNG S LFAQKKN+LNPYFWQMIREI+
Sbjct  1    MMEFFEFLGV-MEISNMSFSVSLDQGRGCKWGTRNGISSLFAQKKNVLNPYFWQMIREII  59

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DV+SYLE  DNNPD+ R++T+G+FI
Sbjct  60   KFKQDVISYLEALDNNPDIGRDETIGQFI  88



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   148 bits (374),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 91/166 (55%), Positives = 115/166 (69%), Gaps = 14/166 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  359
            MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1    MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  360  DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  530
            DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EWG+ NG S L AQ
Sbjct  61   DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ  120

Query  531  KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI
Sbjct  121  KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFI  166



>emb|CDY67346.1| BnaCnng54610D [Brassica napus]
Length=350

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MMELF++LGVDME+SD SFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW MI E  
Sbjct  1    MMELFKNLGVDMEVSDTSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWHMITEFN  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK D L Y+EE + NPD DRN+TL EF+
Sbjct  61   KFKEDALKYIEEMERNPDTDRNETLREFL  89



>dbj|BAC83502.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
 dbj|BAC83939.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
Length=798

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 4/99 (4%)
 Frame = +3

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLLNP  551
            +VTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N ++P
Sbjct  11   QVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAVSP  70

Query  552  YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F+
Sbjct  71   AFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFV  109



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   145 bits (367),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            MME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQMI E  
Sbjct  1    MMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQMITEFY  60

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KF  D L Y+EE + NPD DRN+TLGEF+
Sbjct  61   KFNKDALKYIEEMERNPDTDRNETLGEFL  89



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   145 bits (366),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 71/100 (71%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +3

Query  375  VFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLN  548
            +FN VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L 
Sbjct  9    IFN-VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALR  67

Query  549  PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            P FW MIREILKFK DVLSYL   +NNPD+DRN+TLGEFI
Sbjct  68   PGFWHMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFI  107



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   145 bits (366),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 14/166 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  359
            MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1    MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  360  DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  530
            DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EW + NG S L AQ
Sbjct  61   DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWENSNGISSLLAQ  120

Query  531  KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI
Sbjct  121  KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFI  166



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   141 bits (356),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9    QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            W MIREILKFK D L YLE+ ++NPD+DR++TLG+FI
Sbjct  69   WHMIREILKFKEDALKYLEDHESNPDLDRHETLGQFI  105



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   139 bits (351),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9    QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            W MIREILKFK D L YLE+ ++NPD++R++TLG+FI
Sbjct  69   WHMIREILKFKEDALKYLEDHESNPDLNRHETLGQFI  105



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   139 bits (349),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            M+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N L+P FW+MIR
Sbjct  1    MLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNALSPSFWRMIR  60

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            EILKFKND L YLE+ +NNPDMDRN+TLG+FI
Sbjct  61   EILKFKNDALRYLEDHENNPDMDRNETLGQFI  92



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFW  560
            +VTYPNMME FE LGV+ME SDMSFSVS        EWGSRNG +GL AQK N ++P FW
Sbjct  2    QVTYPNMMEWFEELGVEMERSDMSFSVSTRGEEINVEWGSRNGLAGLLAQKSNAVSPAFW  61

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +MIREI+ FK+DVL Y+EE + NPD+DRN+TLG+FI
Sbjct  62   RMIREIVYFKDDVLKYVEEHERNPDLDRNETLGQFI  97



>ref|XP_002183150.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45368.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=949

 Score =   138 bits (347),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 66/144 (46%), Positives = 97/144 (67%), Gaps = 2/144 (1%)
 Frame = +3

Query  204  LLKMRVAVVGAGISGLVSAYVLA-KGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVF  380
            L   +VA+VG G++GL +A+ L+   GA V ++E E  LGGHA T  +DGVD+D+GFMV+
Sbjct  10   LTDQKVAIVGGGVAGLSAAWHLSVNTGAHVQLFEAESRLGGHAYTTNVDGVDVDIGFMVY  69

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N   YPNM+E F +LGV  E SDMS SVSLD G   EW S +G  GLFA ++ L++P F+
Sbjct  70   NETNYPNMVEWFRTLGVTQEDSDMSLSVSLDGGDTVEWSS-DGLDGLFANRRQLVSPPFY  128

Query  561  QMIREILKFKNDVLSYLEEFDNNP  632
            + ++++++F     + L   D++P
Sbjct  129  RFLKDMIRFNQQAANILLLTDDDP  152



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  369  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  548
             ++  +V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN++N
Sbjct  14   LLITKQVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNVIN  73

Query  549  PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            PYFW+MI+E+ KFK DVLSYL+  + N D++ N+T+  FI
Sbjct  74   PYFWKMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFI  113



>ref|WP_035725299.1| NADH-ubiquinone oxidoreductase subunit 6 [Fodinicurvata fenggangensis]
Length=442

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 100/145 (69%), Gaps = 12/145 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTL--DG--VDLDLGFMVF  380
            MR+A+VGAGI+GL +A++L++    V ++E ED LGGH+ TV+   DG  +D+D GF+V+
Sbjct  1    MRIAIVGAGITGLSAAWLLSRRHE-VTLFEAEDRLGGHSNTVSFQEDGRSIDVDTGFIVY  59

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N + YPN++ LF+ LGV  E SDMSF+VS DNG  +E+       GL AQ++NLL P FW
Sbjct  60   NELNYPNLVALFDHLGVASEPSDMSFAVSADNG-AFEYA--GSLPGLIAQRRNLLRPRFW  116

Query  561  QMIREILKFKNDVLSYLEEFDNNPD  635
            +M REIL+F  +     E+F N PD
Sbjct  117  RMTREILRFYREA----EQFLNAPD  137



>ref|XP_005824669.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
 gb|EKX37689.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
Length=1146

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 8/152 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT-VTLDGVDLDLGFMVFNRVT  392
            RVA++G+GISGL +A+++ K G  V +YE EDY GGH  T  T+ GV +DLGF VFNR T
Sbjct  8    RVAIIGSGISGLAAAWLMQKSGWKVTLYEAEDYFGGHTLTDETIPGVPVDLGFQVFNRTT  67

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            Y +  +  E+LGVD E SDMSF++S+D+G   EWGS N  S +FAQ++NL++P F  MIR
Sbjct  68   YGHFEQFLEALGVDSEESDMSFALSVDDGK-VEWGSHN-LSTIFAQRRNLVSPKFLLMIR  125

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            ++L+F  +    L E +   DM    TLGE++
Sbjct  126  DVLRFGKEAPKVLVE-EQYADM----TLGEYL  152



>ref|WP_027873283.1| NADH-ubiquinone oxidoreductase subunit 6 [Melitea salexigens]
Length=446

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 102/157 (65%), Gaps = 11/157 (7%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV----TLDGVDLDLGFMV  377
            K R+A++G+GISGL  A++L + G  + V+EK+D LGGH+ TV    T     +D GF+V
Sbjct  4    KQRIAIIGSGISGLSCAWLLQRSGHAITVFEKDDRLGGHSNTVEISTTAGTTAVDTGFIV  63

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN   YPN++ LF+ LGVD   +DMSF VSLD+G   E+   N  + +FAQK+NLL P F
Sbjct  64   FNDKCYPNLVNLFKQLGVDSLATDMSFGVSLDDGR-LEYSGSNSLATMFAQKRNLLRPRF  122

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            W+M+ ++L+F  +  +++E     PD   + +LGE +
Sbjct  123  WKMLADLLRFYRESENWMETL---PD---SMSLGELL  153



>ref|WP_035824801.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium sp. 
RA13]
Length=437

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 97/161 (60%), Gaps = 14/161 (9%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  380
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  545
            N  TYPN+++LF+ LGV+   SDMSFSV +  G        EW   N    +FAQ+ NLL
Sbjct  61   NHATYPNLVQLFDELGVEAADSDMSFSVKMPLGTASDARVLEWAGAN-LDTVFAQRSNLL  119

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             P F +M+R+IL+F     +        P M     LGEF+
Sbjct  120  RPAFLRMLRDILRFNRQASALATASVPAPAM----PLGEFL  156



>ref|XP_007512428.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
 emb|CCO17028.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
Length=1056

 Score =   133 bits (335),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 81/161 (50%), Positives = 101/161 (63%), Gaps = 17/161 (11%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLGGHA----KTVTLDGVDLDLGFM  374
            K  V V+GAGISGL +AY+L +  A  V VYE E   GGHA    K+     +D+DLGF 
Sbjct  23   KQTVCVIGAGISGLSAAYLLHQSNAFAVTVYESEPTAGGHALTREKSKHAGELDVDLGFQ  82

Query  375  VFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPY  554
            VFN  TYP+++ LFE L V  E SDMSFS+  +     EWGS  G SG+FAQK+NL+NP 
Sbjct  83   VFNLTTYPHLVGLFEELRVKHEQSDMSFSLQSERT---EWGSL-GLSGIFAQKRNLINPK  138

Query  555  FWQMIREILKF---KNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            FW MIREILKF   K+DVLS      +  +     TLGE++
Sbjct  139  FWNMIREILKFKKVKHDVLS-----GSKKEYWEKKTLGEYL  174



>ref|XP_005648777.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24233.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
Length=1165

 Score =   133 bits (335),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            + RVAVVG+GI+GL +A++L + GA V +YE E   GGH  T    G  +DLGF V+N  
Sbjct  8    RKRVAVVGSGITGLSAAWLLHRSGASVTLYESESRCGGHTLTDDSPGYPVDLGFQVYNLT  67

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN++ L E LGVD E SDMSF +S+D G   EWGSR G   +FAQ++NLL+P F +MI
Sbjct  68   TYPNLVGLLEELGVDTEPSDMSFGLSIDGG-ALEWGSR-GLGAIFAQRRNLLSPGFLRMI  125

Query  570  REILKF  587
             ++++F
Sbjct  126  WDVIRF  131



>ref|WP_034784946.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
 gb|KHA77131.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
Length=436

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 14/161 (9%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  380
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQSGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  545
            N  TYP++++LF+ LGV+   SDMSFSV +  G        EW   N    +FAQ+ NLL
Sbjct  61   NHATYPHLVQLFQELGVEAADSDMSFSVKMPLGATPDARVLEWAGAN-LGTVFAQRSNLL  119

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             P F +M+R+IL+F     +        P +    +LGEF+
Sbjct  120  RPAFLRMLRDILRFNRQASALATASVPAPAL----SLGEFL  156



>ref|WP_018334542.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=414

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 93/151 (62%), Gaps = 5/151 (3%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTY  395
            RVAV+GAG+SGL +AYVL +    V ++E E  LGGHA T  L+ V +D GF+V N  TY
Sbjct  5    RVAVIGAGVSGLTAAYVLQRAH-DVTLFEAESRLGGHAHTHDLEHVSVDSGFIVHNHATY  63

Query  396  PNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIRE  575
            PN++ LF  LGV  + S+MS SV  D+  G E+    G +GLFAQK+NL NP    M+ E
Sbjct  64   PNLIRLFGELGVATQDSEMSMSVR-DDATGLEYAGARGAAGLFAQKRNLANPRHLAMLAE  122

Query  576  ILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +L+F       L     + D+D   TLGEF+
Sbjct  123  VLRFHRAARRVLA---GHTDLDDEVTLGEFL  150



>ref|WP_016347695.1| amine oxidase [Burkholderia sp. RPE64]
 dbj|BAN26986.1| amine oxidase [Burkholderia sp. RPE64]
Length=427

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 95/144 (66%), Gaps = 7/144 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMV  377
              R+AV+GAGI+GL SAY+L++    V ++E  DYLGGHA TV   LDGV   +D GF+V
Sbjct  9    SQRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHAHTVDVELDGVRHPVDTGFLV  67

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LF+ LGV    SDM+FSVSLD G  +EW   N  + +FAQ+++L +P F
Sbjct  68   FNDRTYPNLVALFDELGVTTHRSDMTFSVSLDGGR-FEWAGTN-LNTVFAQRRHLFSPTF  125

Query  558  WQMIREILKFKNDVLSYLEEFDNN  629
              M+R+IL+F      +LE    N
Sbjct  126  IGMLRDILRFNASAQGHLEAASVN  149



>ref|WP_034748929.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
 gb|EZP40678.1| Amine oxidase, flavin-containing [Janthinobacterium lividum]
Length=436

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 97/161 (60%), Gaps = 14/161 (9%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  380
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  545
            N  TYPN+++LF+ LGV+   SDMSFSV +  G        EW   N    +F Q+ NLL
Sbjct  61   NHATYPNLVQLFDELGVEAADSDMSFSVKMPLGTASDARVLEWAGAN-LDTVFTQRSNLL  119

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             P F +M+R+I++F     +        P M    +LGE++
Sbjct  120  RPAFLRMLRDIVRFNRQASALATASVPAPAM----SLGEYL  156



>ref|WP_038500647.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium agaricidamnosum]
Length=429

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 11/157 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  380
            M++AVVGAGISGL  AY LA+ G  V ++E  DY GGH+ T  V+LDGV   +D GF+VF
Sbjct  1    MKIAVVGAGISGLSCAYQLAQAGQDVTLFEAGDYFGGHSHTVDVSLDGVTHGVDTGFLVF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLD-NGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            N  TYPN++ELFE L V+   SDMSFSV +   G   EW   N    +FAQ++NLL+P F
Sbjct  61   NHATYPNLVELFERLQVETADSDMSFSVKMPLGGRTLEWAGAN-LDTVFAQRRNLLSPQF  119

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             +M+ +I++F N   S L    + P      +LG+F+
Sbjct  120  LRMLSDIMRF-NRQASALAVSGDMP----QTSLGDFL  151



>ref|WP_010394901.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
Length=436

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 14/161 (9%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMVF  380
            M++AVVGAGI+GL  AY LA+ G  V +YE  +Y GGH+ TV  TLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGEYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  545
            N  TYPN+++LF+ LGV+   SDMSFSV +  G        EW   N    +FAQ+ NLL
Sbjct  61   NHATYPNLVQLFQELGVEAADSDMSFSVKMPLGTTPDARVLEWAGAN-LDTVFAQRSNLL  119

Query  546  NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             P F +M+R+I++F     +        P M    +LG+F+
Sbjct  120  RPAFLRMLRDIVRFNRQASALATASVPGPAM----SLGDFL  156



>ref|WP_026989223.1| NADH-ubiquinone oxidoreductase subunit 6 [Fodinicurvata sediminis]
Length=442

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 94/141 (67%), Gaps = 8/141 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTL--DG--VDLDLGFMVF  380
            MR+A+VGAGI+GL +A++L++    V ++E ED LGGH+ TV+   DG  +D+D GF+V+
Sbjct  1    MRIAIVGAGITGLSTAWLLSRQHE-VTLFEAEDRLGGHSNTVSFQEDGRSIDVDTGFIVY  59

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N   YPN++ LF+ L V  E SDMSF+VS D G     GS     GL AQ++NLL P  W
Sbjct  60   NEQNYPNLVALFDHLEVPTESSDMSFAVSADGGRFEYAGS---LPGLVAQRRNLLRPRLW  116

Query  561  QMIREILKFKNDVLSYLEEFD  623
            +M REIL+F  +   +LEE D
Sbjct  117  RMTREILRFYREAEKFLEEPD  137



>ref|WP_035507039.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. MP-1]
 gb|KAK44352.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. MP-1]
Length=433

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 7/144 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
            + R+AV+GAGI+GL SAY+L++    V ++E  DYLGGH  TV   LDG+   +D GF+V
Sbjct  9    QQRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHTHTVDVALDGMQHPVDTGFLV  67

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LF+ LGV    S+M+FSVSLD G  +EW   N  + +FAQ++NL +P F
Sbjct  68   FNDRTYPNLIALFDELGVLAHRSEMTFSVSLDGGR-FEWAGTN-LNTVFAQRRNLFSPSF  125

Query  558  WQMIREILKFKNDVLSYLEEFDNN  629
              M+R+IL+F     ++LE    N
Sbjct  126  LGMLRDILRFNASAHAHLERVSVN  149



>emb|CDG85105.1| flavin containing amine oxidoreductase family protein [Janthinobacterium 
agaricidamnosum NBRC 102515 = DSM 9628]
Length=448

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 11/157 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  380
            M++AVVGAGISGL  AY LA+ G  V ++E  DY GGH+ T  V+LDGV   +D GF+VF
Sbjct  20   MKIAVVGAGISGLSCAYQLAQAGQDVTLFEAGDYFGGHSHTVDVSLDGVTHGVDTGFLVF  79

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLD-NGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            N  TYPN++ELFE L V+   SDMSFSV +   G   EW   N    +FAQ++NLL+P F
Sbjct  80   NHATYPNLVELFERLQVETADSDMSFSVKMPLGGRTLEWAGAN-LDTVFAQRRNLLSPQF  138

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             +M+ +I++F N   S L    + P      +LG+F+
Sbjct  139  LRMLSDIMRF-NRQASALAVSGDMP----QTSLGDFL  170



>ref|WP_038570879.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia cenocepacia]
 gb|AIO38010.1| FAD dependent oxidoreductase family protein [Burkholderia cenocepacia]
Length=434

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 92/138 (67%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARQHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  129

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F     ++LE 
Sbjct  130  MLRDILRFNASAQAHLES  147



>ref|WP_012218188.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia multivorans]
 gb|ABX19491.1| amine oxidase [Burkholderia multivorans ATCC 17616]
 dbj|BAG47516.1| predicted NAD/FAD-binding protein [Burkholderia multivorans ATCC 
17616]
 gb|AIO72087.1| FAD dependent oxidoreductase family protein [Burkholderia multivorans]
Length=434

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 92/138 (67%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARQHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  129

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F     ++LE 
Sbjct  130  MLRDILRFNASAQAHLES  147



>ref|WP_043631329.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium haemolyticum]
Length=425

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEDADYLGGHAHTVDITIDGVRFAVDTGFLV  64

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            +N  TYPN++ LF  LG+    SDMSFSVSLD G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSVSLDQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  558  WQMIREILKFKNDVLSYLEEFDNNP  632
            W M+ +I++F       L+    +P
Sbjct  123  WGMLTDIIRFNRAAPRNLKRAVESP  147



>ref|WP_027232012.1| NADH-ubiquinone oxidoreductase subunit 6 [Phyllobacterium sp. 
UNC302MFCol5.2]
Length=449

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 98/135 (73%), Gaps = 6/135 (4%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG---VDLDLGFMVFN  383
            +++AV+G+GISG+ +A++L++    + VYE+E  +GGH+ TV + G   V +D GF+V+N
Sbjct  10   LKIAVIGSGISGMSAAWLLSQKHE-ITVYERETRIGGHSNTVIVPGEGGVAVDTGFIVYN  68

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN+  LF  LGV+   S+MSF+VSLD+G   E+ S  GFSGLFAQ++NL+NP FW 
Sbjct  69   EQTYPNLTALFALLGVETAASEMSFAVSLDSGR-LEY-SGTGFSGLFAQQRNLVNPRFWL  126

Query  564  MIREILKFKNDVLSY  608
            M+R++L+F  +  ++
Sbjct  127  MLRDLLRFYRETPAH  141



>ref|WP_008889725.1| NADH-ubiquinone oxidoreductase subunit 6 [Thalassospira profundimaris]
 gb|EKF08624.1| amine oxidase [Thalassospira profundimaris WP0211]
Length=447

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 93/136 (68%), Gaps = 3/136 (2%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
            K+ +AVVG+GISGL +A++L++    V +YEK+D  GGH+ TV      +D GF+V+N  
Sbjct  8    KLNIAVVGSGISGLSAAWLLSQS-HNVTLYEKDDRAGGHSNTVDAGQTPVDTGFIVYNTR  66

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
             YPN+  LF+ LG++   +DMSF+ S+D G G E+G  +  S LFAQK+NL  P FW+M+
Sbjct  67   CYPNLCALFDHLGIETTPTDMSFAASMDEG-GLEYGGGD-LSALFAQKRNLFRPRFWKMV  124

Query  570  REILKFKNDVLSYLEE  617
            R+IL+F  +  + LE+
Sbjct  125  RDILRFYREAPAALED  140



>ref|WP_025662389.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. IBUN]
Length=446

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 94/149 (63%), Gaps = 5/149 (3%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
             M++AVVG GI+GL +A++L+K    V V+E ++ +GGH  TV   GV +D GF+V+N  
Sbjct  12   PMKIAVVGTGIAGLSAAWLLSKRHE-VTVFEADNRVGGHCHTVNAGGVPVDTGFIVYNET  70

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN+  LF  L V  + SDMSF+VS+D G   E+   N  +GLFAQ+ NL NP FW M+
Sbjct  71   TYPNLTALFAHLDVSTKASDMSFAVSIDGGQ-LEYAGTN-LAGLFAQRSNLANPRFWSML  128

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTL  656
            R++++F  +  S +   D  P    ND L
Sbjct  129  RDLVRFYREAPSGVRNLD--PSASLNDYL  155



>ref|WP_040661572.1| NADH-ubiquinone oxidoreductase subunit 6 [Neptuniibacter caesariensis]
Length=456

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (63%), Gaps = 18/168 (11%)
 Frame = +3

Query  177  VHAVRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG--  350
            + A+R KK      +AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV  +   
Sbjct  3    IAALRPKK------IAVVGSGISGLSCAWLLNKA-HDVTLYEKDDRLGGHSNTVQFELEE  55

Query  351  --VDLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLF  524
              +D+D GF+VFN V YPN++ELF +L VD   +DMSF+VS++ G     G+  G SGL 
Sbjct  56   KLIDVDTGFIVFNPVNYPNLVELFNTLDVDTCDTDMSFAVSINRGQLEYSGT--GLSGLL  113

Query  525  AQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            AQK NLL P FW MIRE+L F      + E  +   D+D + +LG+ +
Sbjct  114  AQKSNLLKPSFWNMIRELLHF----YKHSEAINQRQDLD-HISLGDLL  156



>gb|EAR60721.1| hypothetical protein MED92_13638 [Neptuniibacter caesariensis]
Length=460

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (63%), Gaps = 18/168 (11%)
 Frame = +3

Query  177  VHAVRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG--  350
            + A+R KK      +AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV  +   
Sbjct  7    IAALRPKK------IAVVGSGISGLSCAWLLNKA-HDVTLYEKDDRLGGHSNTVQFELEE  59

Query  351  --VDLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLF  524
              +D+D GF+VFN V YPN++ELF +L VD   +DMSF+VS++ G     G+  G SGL 
Sbjct  60   KLIDVDTGFIVFNPVNYPNLVELFNTLDVDTCDTDMSFAVSINRGQLEYSGT--GLSGLL  117

Query  525  AQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            AQK NLL P FW MIRE+L F      + E  +   D+D + +LG+ +
Sbjct  118  AQKSNLLKPSFWNMIRELLHF----YKHSEAINQRQDLD-HISLGDLL  160



>ref|WP_034951396.1| NADH-ubiquinone oxidoreductase subunit 6 [Candidatus Accumulibacter 
sp. SK-02]
 gb|KFB75737.1| protoporphyrinogen oxidase [Candidatus Accumulibacter sp. SK-02]
Length=446

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 102/156 (65%), Gaps = 12/156 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVF  380
             R+AVVGAGISGL SA++L++  A V +YE  DYLGGH  TV  TLDGV   +D GF+V+
Sbjct  8    QRIAVVGAGISGLASAWLLSQKHA-VTLYEAGDYLGGHTHTVDVTLDGVCHPVDTGFLVY  66

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N  TYPN+  LF  LG+    ++MSF+VSL+   G EW   +  + +F QK+NLL   FW
Sbjct  67   NTHTYPNLTALFAHLGIASVETEMSFAVSLEEP-GIEWAG-SSLATVFGQKRNLLRGDFW  124

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +M+ +IL+F  D ++++E++      D   +L EF+
Sbjct  125  RMLADILRFNRDSIAWIEQYP-----DYGGSLREFL  155



>ref|WP_043614801.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium violaceum]
Length=428

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 93/147 (63%), Gaps = 9/147 (6%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
              R+AV+G+GISGL +A+ L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGSGISGLATAHFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-YEWGSRNGFSGLFAQKKNLLNPY  554
            FN  TYPN++ LF+ LG+    SDMSFSVSL  GHG  EW  RN    +F Q+ NLL+P 
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSL--GHGRLEWAGRN-LDSVFVQRGNLLSPG  122

Query  555  FWQMIREILKFKNDVLSYLEEFDNNPD  635
            FW M+ +IL+F  +    L      P 
Sbjct  123  FWGMLSDILRFNREAERNLRRAIEAPQ  149



>ref|WP_017510251.1| hypothetical protein [beta proteobacterium L13]
Length=436

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 97/156 (62%), Gaps = 11/156 (7%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGV--DLDLGFMVF  380
            M +AV GAGI+GL +A++LA+ G  V ++E   Y GGH+ T  VTLDGV   +D GF+V 
Sbjct  1    MHIAVAGAGIAGLSAAWLLARSGHQVTLFEAGRYAGGHSNTVDVTLDGVTAPVDTGFLVH  60

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N  TYPN++ LF  LGV +  ++M+FSV+LD     EW   + F+ LFAQK+NLL P FW
Sbjct  61   NDRTYPNLIRLFALLGVPVYHTEMTFSVALDQ-EKLEWAGSDLFT-LFAQKRNLLRPAFW  118

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             M+R+IL+      +  +E          DTLG+ +
Sbjct  119  HMLRDILRLHRQAPALRDEARAT-----GDTLGQLL  149



>gb|ERJ39944.1| Amine oxidase, flavin-containing [Burkholderia sp. AU4i]
Length=428

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  7    RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVELDGARHPVDTGFLVFN  65

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  66   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  123

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F      +LE 
Sbjct  124  MLRDILRFNASAQDHLES  141



>ref|WP_042973675.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. AU4i]
Length=434

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  129

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F      +LE 
Sbjct  130  MLRDILRFNASAQDHLES  147



>ref|WP_011880041.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia vietnamiensis]
 gb|ABO58835.1| amine oxidase [Burkholderia vietnamiensis G4]
Length=436

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  14   RIAVVGAGIAGLASAYLLARRHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  72

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  73   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  130

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  131  MLRDILRFNAAARDHLE  147



>gb|EGD05972.1| amine oxidase [Burkholderia sp. TJI49]
Length=428

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  7    RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGARHPVDTGFLVFN  65

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  66   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  123

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F      +LE 
Sbjct  124  MLRDILRFNASAQDHLES  141



>ref|WP_041568750.1| NADH-ubiquinone oxidoreductase subunit 6, partial [Candidatus 
Accumulibacter phosphatis]
Length=433

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 12/156 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVF  380
             R+AVVGAGISGL SA++L++  A V +YE  DYLGGH  TV  TLDGV   +D GF+V+
Sbjct  8    QRIAVVGAGISGLASAWLLSQRHA-VTLYEAGDYLGGHTNTVDVTLDGVCHPVDTGFLVY  66

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N  TYPN+  LF  LGV    ++MSF+VSL+     EW   +  + +F QK+NLL P FW
Sbjct  67   NTHTYPNLTALFAHLGVASVETEMSFAVSLEEP-AIEWAG-SSLATVFGQKRNLLRPDFW  124

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +M+ +IL+F  + ++++E+   +PD     +L EF+
Sbjct  125  RMLADILRFNRESVAWIEQ---HPDY--GGSLREFL  155



>ref|WP_041912257.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. JGI 0001005-H05]
Length=446

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
             M++AVVG GI+GL +A++L+K    V V+E ++ +GGH  TV   GV +D GF+V+N  
Sbjct  12   PMKIAVVGTGIAGLSAAWLLSKRHE-VTVFEADNRVGGHCHTVNAGGVPVDTGFIVYNET  70

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN+  LF  L V  + SDMSF+VS+D G     G+    +GLFAQ+ NL NP FW M+
Sbjct  71   TYPNLTALFAHLDVSTKASDMSFAVSIDGGQLEYAGT--SLAGLFAQRSNLANPRFWSML  128

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTL  656
            R++++F  +  S +   D  P    ND L
Sbjct  129  RDLVRFYREAPSGVRNLD--PSASLNDYL  155



>gb|EJN00550.1| putative NAD/FAD-binding protein [Phyllobacterium sp. YR531]
Length=442

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 94/137 (69%), Gaps = 8/137 (6%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD-----GVDLDLGFMV  377
            M++AVVG GISG+ +A++L++    V VYE+E  +GGH+ T  ++      + +D GF+V
Sbjct  1    MKIAVVGTGISGMSAAWLLSQNN-DVTVYEREHRIGGHSNTFLIERDNERPLPVDTGFIV  59

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN+  LF  L V+   S+MSF+VSLD+G   E+ S  GFSGLFAQ++NL NP F
Sbjct  60   FNEHTYPNLTALFAHLDVETAASEMSFAVSLDSG-KLEY-SGTGFSGLFAQQRNLFNPRF  117

Query  558  WQMIREILKFKNDVLSY  608
            W M+R++L+F  D  S+
Sbjct  118  WMMLRDLLRFYRDTPSH  134



>ref|WP_017923872.1| NADH-ubiquinone oxidoreductase subunit 6, partial [Burkholderia 
glumae]
Length=259

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  +V   L+G+   +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHSVDVELEGMRHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    S MSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVPAHTSAMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPSFLG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F     ++LE
Sbjct  130  MLRDILRFNARAHAHLE  146



>ref|WP_039370008.1| NADH-ubiquinone oxidoreductase subunit 6 [Mumia flava]
 gb|KHL08659.1| NADH-ubiquinone oxidoreductase subunit 6 [Mumia flava]
Length=434

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGARHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  129

Query  564  MIREILKFKNDVLSYLEE  617
            M+R+IL+F      +LE 
Sbjct  130  MLRDILRFNASAQDHLES  147



>ref|WP_036551677.1| NADH-ubiquinone oxidoreductase subunit 6 [Neptunomonas japonica]
Length=462

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 107/168 (64%), Gaps = 18/168 (11%)
 Frame = +3

Query  177  VHAVRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD---  347
            + A+R KK      +AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV+ D   
Sbjct  3    ITAIRPKK------IAVVGSGISGLSCAWLLNKAHQ-VTLYEKDDRLGGHSNTVSFDLEN  55

Query  348  -GVDLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLF  524
              VD+D GF+VFN V YPN+++ F++L V    +DMSF +S++ G     G+  G SGL 
Sbjct  56   NHVDVDTGFIVFNPVNYPNLVKFFKTLDVTTCETDMSFGISVNQGELEYSGT--GLSGLL  113

Query  525  AQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            AQK+NL+ P FW+M++E+++F  +     E+     D+D+  TLGE +
Sbjct  114  AQKRNLIRPSFWRMVQELMRFYRES----EQVMQQQDLDQ-ITLGELL  156



>ref|WP_025097256.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. A1]
Length=433

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLVALFDELGVRTHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSFLG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  130  MLRDILRFNASAERHLE  146



>gb|ACV37205.1| FAD dependent oxidoreductase [Candidatus Accumulibacter phosphatis 
clade IIA str. UW-1]
Length=446

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 12/156 (8%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVF  380
             R+AVVGAGISGL SA++L++  A V +YE  DYLGGH  TV  TLDGV   +D GF+V+
Sbjct  8    QRIAVVGAGISGLASAWLLSQRHA-VTLYEAGDYLGGHTNTVDVTLDGVCHPVDTGFLVY  66

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N  TYPN+  LF  LGV    ++MSF+VSL+     EW   +  + +F QK+NLL P FW
Sbjct  67   NTHTYPNLTALFAHLGVASVETEMSFAVSLEEP-AIEWAG-SSLATVFGQKRNLLRPDFW  124

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +M+ +IL+F  + ++++E+   +PD     +L EF+
Sbjct  125  RMLADILRFNRESVAWIEQ---HPDY--GGSLREFL  155



>ref|WP_034203531.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia cepacia]
 gb|AIO43194.1| FAD dependent oxidoreductase family protein [Burkholderia cepacia]
 gb|KGC04716.1| FAD dependent oxidoreductase family protein [Burkholderia cepacia]
Length=434

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 7/142 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGACHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  129

Query  564  MIREILKFKNDVLSYLEEFDNN  629
            M+R+IL+F      +LE  +  
Sbjct  130  MLRDILRFNASAHDHLESANRQ  151



>ref|WP_027331137.1| FAD-dependent oxidoreductase [Marinimicrobium agarilyticum]
Length=425

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 13/166 (8%)
 Frame = +3

Query  186  VRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GV  353
            ++R       ++AV+G+GISGL +AYVLAK    V V+E    +GGH  T T++      
Sbjct  1    MKRSGSTETRKIAVIGSGISGLTAAYVLAKRHE-VTVFEAGPQIGGHTATKTVEVAGSTY  59

Query  354  DLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL-DNGHGYEWGSRNGFSGLFAQ  530
             +D GF+VFN  TYPN + L   LGV  +++DM FSV+  D+GH Y   S +G SGLFAQ
Sbjct  60   QVDTGFIVFNDRTYPNFIRLMSHLGVPSQVTDMGFSVTQPDHGHEY---SGSGLSGLFAQ  116

Query  531  KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            ++N   P  W+M+++I++F  D     E+   +P    N TLGE++
Sbjct  117  RRNWFRPAHWKMLKDIMRFNRDCTRAYEQNRIDP----NQTLGEYL  158



>ref|WP_017918374.1| MULTISPECIES: NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia]
 gb|KGC17323.1| FAD dependent oxidoreductase family protein [Burkholderia mallei]
Length=432

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSFLG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  130  MLRDILRFNASAERHLE  146



>ref|WP_011349277.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia lata]
 gb|ABB05633.1| FAD dependent oxidoreductase [Burkholderia lata]
Length=435

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDIELDGASHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ L + +GV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   ERTYPNLIALLDEIGVAAHPSDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPSFLG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  130  MLRDILRFNASAQRHLE  146



>ref|WP_008347203.1| MULTISPECIES: NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia]
 gb|EKS69427.1| Amine oxidase, flavin-containing [Burkholderia sp. SJ98]
 gb|KDR29703.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia zhejiangensis]
Length=433

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
            + R+AV+GAGI+GL SAY+L++    V ++E  DYLGGH  TV   LDGV   +D GF+V
Sbjct  9    QQRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHTHTVDVALDGVQHPVDTGFLV  67

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LF+ LGV    SDM+FSVSLD G  +EW   N  + +FAQ++NL +P F
Sbjct  68   FNDRTYPNLIALFDELGVAAHRSDMTFSVSLDGGR-FEWAGTN-LNTVFAQRRNLFSPSF  125

Query  558  WQMIREILKFKNDVLSYLEE  617
              M+ +IL+F       LE 
Sbjct  126  IGMLGDILRFNASAHRQLER  145



>ref|WP_018152743.1| hypothetical protein [Leeia oryzae]
Length=425

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 88/130 (68%), Gaps = 7/130 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMV  377
            + R+AV+G+GISGL SAY L +G   V ++E  +YLGGH  TV  TLDGV    D GF+V
Sbjct  5    RQRIAVIGSGISGLASAYFLNRGHE-VTLFEAGNYLGGHTHTVDVTLDGVTHPADTGFLV  63

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN+ TYPN++ LF  L V    +DMSF VS+D GH  EW   N    +FAQ++N+L+P F
Sbjct  64   FNQHTYPNLIALFAELAVSSHATDMSFGVSMDQGH-LEWAGTN-LDTVFAQRRNMLSPRF  121

Query  558  WQMIREILKF  587
              M+R+IL+F
Sbjct  122  LGMLRDILRF  131



>ref|WP_036039189.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
 gb|KGE06711.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
Length=432

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDGGR-LEWAGTN-LNTVFAQRRNLFSPSFLG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  130  MLRDILRFNASAERHLE  146



>ref|WP_043581068.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium subtsugae]
Length=428

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
              R+AV+G GI+GL +AY L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGGGIAGLATAYFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LF+ LG+    SDMSFSVSL  G   EW  R+    +F Q++NLL+P F
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSLGQGR-LEWAGRD-LDSVFVQRRNLLSPGF  123

Query  558  WQMIREILKFKNDVLSYLEEFDNNP  632
            W M+ +IL+F  +    L      P
Sbjct  124  WGMLSDILRFNREAERNLRRAIEAP  148



>ref|WP_013699783.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
 gb|AEA62470.1| amine oxidase [Burkholderia gladioli BSR3]
Length=432

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSFIG  129

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +LE
Sbjct  130  MLRDILRFNASAERHLE  146



>ref|WP_003163823.1| NADH-ubiquinone oxidoreductase subunit 6 [Brevundimonas diminuta]
 gb|EGF96495.1| flavin containing amine oxidoreductase family protein [Brevundimonas 
diminuta ATCC 11568]
Length=444

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 15/157 (10%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  377
             ++VAVVG+G++ L SA++L++    V +YEK + LGGH+ TVT       V +D GF+ 
Sbjct  12   PLKVAVVGSGVAALSSAWLLSQRHR-VTLYEKAERLGGHSNTVTAGTPQGEVPVDTGFIC  70

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LFE LG+    +DMSF+VSLD G  +E+ +     GLFAQ++NLL P F
Sbjct  71   FNDATYPNLIALFEHLGIATRATDMSFAVSLDQGR-FEYAA----PGLFAQRRNLLRPRF  125

Query  558  WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            W M+ EIL+F       L E   +P +    TLG+++
Sbjct  126  WSMLSEILRFYRQAPEDLSEL-TDPQL----TLGDYL  157



>ref|WP_028880747.1| NADH-ubiquinone oxidoreductase subunit 6 [Terasakiella pusilla]
Length=448

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 100/152 (66%), Gaps = 8/152 (5%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  392
            M++AV+G GI+G+ ++++L+     V +YEK+D +GGH  TV +DG  +D GF+V+N   
Sbjct  10   MKIAVIGTGIAGMSASWLLSTA-HDVTIYEKDDRIGGHTNTVDVDGTGVDTGFIVYNEKN  68

Query  393  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  572
            YPN++ LF+  GV+ + +DMSF VS+ NG  +E+   N F G+ AQK+N+L P FW M+R
Sbjct  69   YPNLIALFDHFGVETQKTDMSFGVSVGNGE-FEYAGTNLF-GMLAQKRNILRPRFWFMLR  126

Query  573  EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            +IL+F  +    L   D  P +    TLG+F+
Sbjct  127  DILRFYREAPDLL-AMDQMPSV----TLGDFL  153



>ref|WP_019104394.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium sp. 
C-61]
Length=425

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEAADYLGGHAHTVDITMDGVRFAVDTGFLV  64

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            +N  TYPN++ LF  LG+    SDMSFSVSL  G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSVSLGQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  558  WQMIREILKFKNDVLSYLEEFDNNP  632
            W M+ +I++F       L+    +P
Sbjct  123  WGMLADIIRFNRAAPRNLKRAVESP  147



>ref|WP_017234374.1| hypothetical protein [Pandoraea sp. B-6]
Length=434

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG--VDLDLGFMVF  380
             RVAVVGAGI+GL SAY LA+    V V+E  DY GGH  TV  TLDG    +D GF+VF
Sbjct  12   QRVAVVGAGIAGLASAYFLARKH-HVTVFEAGDYAGGHTNTVDVTLDGHCAPVDTGFLVF  70

Query  381  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            N  TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F 
Sbjct  71   NDRTYPNLIALFDELGVSAIASDMSFSVSVDGG-ALEWAGTN-LNTVFAQRRNLYSPRFL  128

Query  561  QMIREILKFKNDVLSYLEE  617
             M+R++L+F      +L+ 
Sbjct  129  GMLRDVLRFNATAEQHLQS  147



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   126 bits (317),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  387  VTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  560
            VT PNMM+ FE LG +ME SDMSFSV   LD G   EW S NG SGL AQK N LNP FW
Sbjct  17   VTCPNMMQWFEVLGANMERSDMSFSVRTQLDVGRACEWASGNGISGLLAQKSNALNPRFW  76

Query  561  QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             MI +ILKFK+D L YLE+  NNPD++ N+TLG+FI
Sbjct  77   CMISDILKFKSDALRYLEDRKNNPDLNLNETLGQFI  112



>gb|EFA79548.1| hypothetical protein PPL_07599 [Polysphondylium pallidum PN500]
Length=529

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 104/174 (60%), Gaps = 28/174 (16%)
 Frame = +3

Query  213  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG---VDLDLGFMV  377
            M++AVVG GISG+ SAY+L KGG  V V+EK DYLGGH  TV  T +G   V  D GF+V
Sbjct  1    MKIAVVGGGISGMSSAYLLTKGGHQVTVFEKGDYLGGHTNTVDATFEGVGTVKADTGFLV  60

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLD-NGHGY---------------EWGSRNG  509
            +N   YPN+M LF  L ++   SD+SF+ SL+  G+ Y               EWGS +G
Sbjct  61   YNEEHYPNLMRLFRELAIESADSDVSFAFSLNARGNSYANNGADQQAPVRNEVEWGS-DG  119

Query  510  FSGLFAQKKNLLNPYFWQMIREILKF-KNDVLSYLEEFDNNPDMDRNDTLGEFI  668
             S +FAQ  NL  P FW M+R++++F K   L+ LE     P+  +N T+ E++
Sbjct  120  ASTVFAQLGNLFRPKFWCMLRDMVRFHKEAPLTMLE-----PEKYKNITIAEYM  168



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   126 bits (316),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +3

Query  402  MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  581
            M+E F++LGVDME+SDMSFSVSLD+G G EWG R+  S LFAQK+N+ +PYFW+MI EI 
Sbjct  1    MIEFFKNLGVDMEVSDMSFSVSLDSGRGCEWGCRS-LSSLFAQKRNIFSPYFWKMITEIK  59

Query  582  KFKNDVLSYLEEFDNNPDMDRNDTLGEFI  668
            KFK DVL YLE+ + N DMDR  TLG F+
Sbjct  60   KFKEDVLKYLEDRERNLDMDRTKTLGGFL  88



>ref|WP_014725774.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. KJ006]
 gb|AFJ89735.1| Amine oxidase, flavin-containing [Burkholderia sp. KJ006]
Length=436

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  216  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  383
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  14   RIAVVGAGIAGLASAYLLARRHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  72

Query  384  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  563
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F  
Sbjct  73   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTFLG  130

Query  564  MIREILKFKNDVLSYLE  614
            M+R+IL+F      +L+
Sbjct  131  MLRDILRFNAAARDHLD  147



>ref|WP_043590453.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium haemolyticum]
Length=425

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEAADYLGGHAHTVDITMDGVRFAVDTGFLV  64

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            +N  TYPN++ LF  LG+    SDMSFS+SL  G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSISLGQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  558  WQMIREILKFKNDVLSYLEEFDNNP  632
            W M+ +I++F       L+    +P
Sbjct  123  WGMLADIIRFNRAAPRNLKRAVESP  147



>ref|WP_043596502.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium violaceum]
Length=428

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  377
              R+AV+G+GI+GL +A+ L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGSGIAGLATAHFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  378  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  557
            FN  TYPN++ LF+ LG+    SDMSFSVSL  G   EW  RN    +F Q+ NLL+P F
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSLGQGR-LEWAGRN-LDSVFVQRGNLLSPGF  123

Query  558  WQMIREILKFKNDVLSYLEEFDNNPD  635
            W M+ +IL+F  +    L      P 
Sbjct  124  WGMLSDILRFNREAERNLRRAIEAPQ  149



>gb|EYR84639.1| putative NAD/FAD-binding protein [Shinella sp. DD12]
Length=443

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 95/149 (64%), Gaps = 5/149 (3%)
 Frame = +3

Query  210  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  389
             +++AVVG GI+GL + ++LA+    V V+E ++ +GGH+ TV   G  +D GF+V+N  
Sbjct  10   PLKIAVVGTGIAGLSAGWLLAQRH-DVTVFEADNRIGGHSHTVQAGGAPVDTGFIVYNEA  68

Query  390  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  569
            TYPN+  LF  LGV  + SDMSFSVS+D+G   E+ + N  +GLFAQ+ NL +P FW M+
Sbjct  69   TYPNLTALFAHLGVPTKASDMSFSVSMDDGQ-LEYAATN-LAGLFAQRSNLASPRFWSML  126

Query  570  REILKFKNDVLSYLEEFDNNPDMDRNDTL  656
            R++++F     S +   D  P    ND L
Sbjct  127  RDLVRFYRHAPSGVRNLD--PAASLNDYL  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780