BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021O24

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621780.1|  PREDICTED: probable LRR receptor-like serine...    300   4e-95   Nicotiana tomentosiformis
ref|XP_011081555.1|  PREDICTED: probable LRR receptor-like serine...    302   2e-94   Sesamum indicum [beniseed]
ref|XP_009621778.1|  PREDICTED: probable LRR receptor-like serine...    300   5e-94   Nicotiana tomentosiformis
ref|XP_009759487.1|  PREDICTED: probable LRR receptor-like serine...    299   9e-94   Nicotiana sylvestris
gb|KJB07626.1|  hypothetical protein B456_001G034000                    293   2e-91   Gossypium raimondii
gb|EYU20256.1|  hypothetical protein MIMGU_mgv1a002601mg                291   2e-90   Erythranthe guttata [common monkey flower]
gb|KDO61747.1|  hypothetical protein CISIN_1g006206mg                   276   2e-87   Citrus sinensis [apfelsine]
ref|XP_011039729.1|  PREDICTED: probable LRR receptor-like serine...    288   2e-87   Populus euphratica
ref|XP_006450417.1|  hypothetical protein CICLE_v10007687mg             276   2e-87   
ref|XP_002515504.1|  ATP binding protein, putative                      287   3e-87   
ref|XP_006450418.1|  hypothetical protein CICLE_v10007687mg             277   2e-86   
emb|CBI21051.3|  unnamed protein product                                280   3e-86   Vitis vinifera
gb|KDP33585.1|  hypothetical protein JCGZ_07156                         280   3e-86   Jatropha curcas
ref|XP_010648817.1|  PREDICTED: probable LRR receptor-like serine...    282   1e-85   
gb|KDO61744.1|  hypothetical protein CISIN_1g006206mg                   277   2e-85   Citrus sinensis [apfelsine]
ref|XP_006450419.1|  hypothetical protein CICLE_v10007687mg             278   2e-85   Citrus clementina [clementine]
ref|XP_006483373.1|  PREDICTED: probable LRR receptor-like serine...    277   3e-85   Citrus sinensis [apfelsine]
ref|XP_007224199.1|  hypothetical protein PRUPE_ppa017326mg             275   2e-84   Prunus persica
ref|XP_007011844.1|  Leucine-rich repeat transmembrane protein ki...    278   5e-84   
ref|XP_008219685.1|  PREDICTED: probable LRR receptor-like serine...    270   2e-82   
ref|XP_010040282.1|  PREDICTED: probable LRR receptor-like serine...    268   8e-82   Eucalyptus grandis [rose gum]
gb|KCW81385.1|  hypothetical protein EUGRSUZ_C02767                     266   3e-81   Eucalyptus grandis [rose gum]
ref|XP_011459850.1|  PREDICTED: probable LRR receptor-like serine...    265   7e-79   Fragaria vesca subsp. vesca
ref|XP_011036739.1|  PREDICTED: probable LRR receptor-like serine...    256   1e-76   Populus euphratica
ref|XP_002309634.2|  hypothetical protein POPTR_0006s27120g             203   3e-58   
ref|XP_010064052.1|  PREDICTED: probable LRR receptor-like serine...    196   2e-57   
ref|XP_010090613.1|  putative LRR receptor-like serine/threonine-...    199   2e-56   
ref|XP_010941603.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-56   Elaeis guineensis
ref|XP_010064059.1|  PREDICTED: probable LRR receptor-like serine...    203   3e-56   Eucalyptus grandis [rose gum]
ref|XP_002324865.1|  hypothetical protein POPTR_0018s01800g             194   2e-54   
ref|XP_010064058.1|  PREDICTED: probable LRR receptor-like serine...    195   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010065125.1|  PREDICTED: probable LRR receptor-like serine...    192   5e-53   
ref|XP_004243974.1|  PREDICTED: probable LRR receptor-like serine...    191   4e-52   Solanum lycopersicum
emb|CAD41883.2|  OSJNBa0093O08.2                                        191   6e-52   Oryza sativa Japonica Group [Japonica rice]
gb|AAV31389.1|  putative protein kinase                                 183   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KCW71353.1|  hypothetical protein EUGRSUZ_F04434                     189   2e-51   Eucalyptus grandis [rose gum]
gb|KCW71354.1|  hypothetical protein EUGRSUZ_F04434                     189   3e-51   Eucalyptus grandis [rose gum]
emb|CAJ86314.1|  H0525G02.11                                            188   3e-51   Oryza sativa [red rice]
ref|XP_003581672.1|  PREDICTED: probable LRR receptor-like serine...    189   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_006853337.1|  hypothetical protein AMTR_s00032p00079260          188   5e-51   
ref|XP_011097808.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    188   9e-51   
ref|XP_010093040.1|  putative LRR receptor-like serine/threonine-...    187   1e-50   
ref|XP_010064056.1|  PREDICTED: probable LRR receptor-like serine...    187   1e-50   
gb|KCW71208.1|  hypothetical protein EUGRSUZ_F04300                     181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010064055.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010064054.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006659917.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-50   Oryza brachyantha
ref|XP_010064741.1|  PREDICTED: probable LRR receptor-like serine...    186   3e-50   Eucalyptus grandis [rose gum]
ref|XP_008361918.1|  PREDICTED: probable LRR receptor-like serine...    175   3e-50   
gb|AFW56974.1|  putative leucine-rich repeat receptor-like protei...    184   4e-50   
ref|XP_008361917.1|  PREDICTED: probable LRR receptor-like serine...    175   5e-50   
ref|XP_004516049.1|  PREDICTED: probable LRR receptor-like serine...    185   7e-50   Cicer arietinum [garbanzo]
ref|XP_007214107.1|  hypothetical protein PRUPE_ppa017049mg             185   9e-50   Prunus persica
ref|XP_006855170.1|  hypothetical protein AMTR_s00051p00090280          172   9e-50   
gb|KEH19251.1|  LRR receptor-like kinase, putative                      185   1e-49   Medicago truncatula
ref|XP_006653770.1|  PREDICTED: probable LRR receptor-like serine...    185   1e-49   
ref|XP_007133315.1|  hypothetical protein PHAVU_011G169300g             185   1e-49   Phaseolus vulgaris [French bean]
gb|EEC78858.1|  hypothetical protein OsI_19210                          184   1e-49   Oryza sativa Indica Group [Indian rice]
emb|CAD41884.2|  OSJNBa0093O08.3                                        184   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010040869.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-49   
ref|XP_002267129.1|  PREDICTED: probable LRR receptor-like serine...    184   2e-49   Vitis vinifera
ref|XP_008662731.1|  PREDICTED: probable LRR receptor-like serine...    184   2e-49   
ref|XP_007022387.1|  Leucine-rich repeat transmembrane protein ki...    183   4e-49   
ref|XP_009412046.1|  PREDICTED: probable LRR receptor-like serine...    183   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006653769.1|  PREDICTED: probable LRR receptor-like serine...    182   5e-49   Oryza brachyantha
ref|XP_008226109.1|  PREDICTED: probable LRR receptor-like serine...    182   7e-49   Prunus mume [ume]
ref|XP_004976816.1|  PREDICTED: probable LRR receptor-like serine...    182   8e-49   Setaria italica
emb|CAD41800.2|  OSJNBa0008M17.16                                       182   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061225.1|  Os08g0203700                                       182   1e-48   
ref|XP_002310677.1|  leucine-rich repeat family protein                 181   1e-48   
ref|XP_009387671.1|  PREDICTED: probable LRR receptor-like serine...    180   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010324206.1|  PREDICTED: probable LRR receptor-like serine...    181   2e-48   
emb|CBI20016.3|  unnamed protein product                                182   2e-48   Vitis vinifera
ref|XP_010244460.1|  PREDICTED: probable LRR receptor-like serine...    182   2e-48   
ref|XP_009771802.1|  PREDICTED: probable LRR receptor-like serine...    181   3e-48   Nicotiana sylvestris
ref|XP_010065123.1|  PREDICTED: probable LRR receptor-like serine...    181   3e-48   
gb|KHM98859.1|  Putative LRR receptor-like serine/threonine-prote...    181   3e-48   Glycine soja [wild soybean]
gb|EMT28000.1|  Putative LRR receptor-like serine/threonine-prote...    179   9e-48   
gb|KDO61746.1|  hypothetical protein CISIN_1g006206mg                   176   1e-47   Citrus sinensis [apfelsine]
gb|EEE68220.1|  hypothetical protein OsJ_26392                          179   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|ABK23413.1|  unknown                                                 170   1e-47   Picea sitchensis
ref|XP_010942352.1|  PREDICTED: probable LRR receptor-like serine...    179   1e-47   Elaeis guineensis
ref|XP_006653768.1|  PREDICTED: probable LRR receptor-like serine...    178   1e-47   
emb|CAJ86313.1|  H0525G02.10                                            178   2e-47   Oryza sativa [red rice]
gb|KDO61621.1|  hypothetical protein CISIN_1g001658mg                   179   2e-47   Citrus sinensis [apfelsine]
gb|EAY95562.1|  hypothetical protein OsI_17410                          178   2e-47   Oryza sativa Indica Group [Indian rice]
gb|AHG54199.1|  LRR receptor-like protein kinase 1                      178   2e-47   Triticum aestivum [Canadian hard winter wheat]
gb|KJB14002.1|  hypothetical protein B456_002G105800                    178   2e-47   Gossypium raimondii
ref|XP_006654185.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-47   
gb|EEC78009.1|  hypothetical protein OsI_17412                          176   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_006448775.1|  hypothetical protein CICLE_v10014117mg             178   2e-47   Citrus clementina [clementine]
emb|CAD41882.2|  OSJNBa0093O08.1                                        177   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659922.1|  PREDICTED: probable LRR receptor-like serine...    177   3e-47   
emb|CAJ86312.1|  H0525G02.9                                             177   3e-47   Oryza sativa [red rice]
ref|XP_009608510.1|  PREDICTED: probable LRR receptor-like serine...    177   3e-47   Nicotiana tomentosiformis
emb|CAN83900.1|  hypothetical protein VITISV_034202                     177   4e-47   Vitis vinifera
gb|AHG54200.1|  LRR receptor-like protein kinase 2                      177   4e-47   Triticum aestivum [Canadian hard winter wheat]
gb|EEE61686.1|  hypothetical protein OsJ_16159                          177   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654184.1|  PREDICTED: probable LRR receptor-like serine...    177   4e-47   Oryza brachyantha
ref|XP_006468409.1|  PREDICTED: probable LRR receptor-like serine...    177   5e-47   Citrus sinensis [apfelsine]
gb|KEH19476.1|  LRR receptor-like kinase, putative                      175   5e-47   Medicago truncatula
ref|XP_004976813.1|  PREDICTED: probable LRR receptor-like serine...    177   6e-47   Setaria italica
ref|XP_007024834.1|  Leucine-rich repeat transmembrane protein ki...    177   7e-47   
ref|XP_003531816.1|  PREDICTED: probable LRR receptor-like serine...    176   9e-47   Glycine max [soybeans]
emb|CDP20736.1|  unnamed protein product                                176   1e-46   Coffea canephora [robusta coffee]
ref|XP_011460718.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-46   Fragaria vesca subsp. vesca
gb|KEH19475.1|  LRR receptor-like kinase, putative                      176   2e-46   Medicago truncatula
gb|KJB69992.1|  hypothetical protein B456_011G052600                    174   2e-46   Gossypium raimondii
gb|KJB69998.1|  hypothetical protein B456_011G052600                    174   2e-46   Gossypium raimondii
gb|EEC76964.1|  hypothetical protein OsI_15252                          174   3e-46   Oryza sativa Indica Group [Indian rice]
gb|KJB69997.1|  hypothetical protein B456_011G052600                    174   3e-46   Gossypium raimondii
gb|KJB69994.1|  hypothetical protein B456_011G052600                    174   3e-46   Gossypium raimondii
ref|NP_001053881.1|  Os04g0616700                                       174   3e-46   
ref|XP_009409824.1|  PREDICTED: probable LRR receptor-like serine...    173   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP36457.1|  hypothetical protein JCGZ_08587                         174   4e-46   Jatropha curcas
ref|XP_011006995.1|  PREDICTED: probable LRR receptor-like serine...    174   5e-46   Populus euphratica
gb|KJB69996.1|  hypothetical protein B456_011G052600                    174   5e-46   Gossypium raimondii
gb|EEE61690.1|  hypothetical protein OsJ_16163                          174   5e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KJB69993.1|  hypothetical protein B456_011G052600                    174   5e-46   Gossypium raimondii
gb|KJB69971.1|  hypothetical protein B456_011G052300                    172   6e-46   Gossypium raimondii
gb|KJB69991.1|  hypothetical protein B456_011G052600                    174   6e-46   Gossypium raimondii
ref|XP_006659919.1|  PREDICTED: probable LRR receptor-like serine...    174   7e-46   
gb|KJB69995.1|  hypothetical protein B456_011G052600                    174   7e-46   Gossypium raimondii
gb|KJB69970.1|  hypothetical protein B456_011G052300                    171   8e-46   Gossypium raimondii
ref|XP_004972616.1|  PREDICTED: probable LRR receptor-like serine...    173   1e-45   Setaria italica
ref|XP_004972615.1|  PREDICTED: probable LRR receptor-like serine...    173   1e-45   
ref|XP_004516050.1|  PREDICTED: probable LRR receptor-like serine...    172   2e-45   
gb|ACN59258.1|  leucine-rich repeat receptor-like protein kinase        169   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01148.1|  hypothetical protein F383_22594                         172   2e-45   Gossypium arboreum [tree cotton]
ref|XP_009341206.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-45   
gb|KCW68790.1|  hypothetical protein EUGRSUZ_F023912                    172   3e-45   Eucalyptus grandis [rose gum]
ref|XP_002444009.1|  hypothetical protein SORBIDRAFT_07g005820          172   3e-45   
gb|KJB69968.1|  hypothetical protein B456_011G052300                    172   3e-45   Gossypium raimondii
gb|KDO77509.1|  hypothetical protein CISIN_1g0380191mg                  170   3e-45   Citrus sinensis [apfelsine]
gb|KDP25093.1|  hypothetical protein JCGZ_22628                         172   4e-45   Jatropha curcas
ref|XP_008353269.1|  PREDICTED: probable LRR receptor-like serine...    169   7e-45   
ref|XP_010480178.1|  PREDICTED: probable LRR receptor-like serine...    171   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010480179.1|  PREDICTED: probable LRR receptor-like serine...    171   9e-45   
ref|XP_008225769.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    172   1e-44   
ref|XP_010480176.1|  PREDICTED: probable LRR receptor-like serine...    170   1e-44   Camelina sativa [gold-of-pleasure]
gb|KGN44274.1|  hypothetical protein Csa_7G237890                       170   1e-44   Cucumis sativus [cucumbers]
ref|XP_002894563.1|  predicted protein                                  171   1e-44   
ref|XP_008663599.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-44   Zea mays [maize]
ref|XP_004139892.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-44   
ref|NP_564709.2|  leucine-rich repeat transmembrane protein kinase      169   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AGT17045.1|  SHR5-receptor-like kinase                               169   3e-44   Saccharum hybrid cultivar R570
ref|XP_007214610.1|  hypothetical protein PRUPE_ppa000890mg             169   4e-44   
ref|NP_001055039.1|  Os05g0257100                                       166   4e-44   
ref|XP_004976815.1|  PREDICTED: probable LRR receptor-like serine...    169   4e-44   Setaria italica
ref|XP_002894560.1|  leucine-rich repeat family protein                 169   5e-44   
ref|XP_010501248.1|  PREDICTED: probable LRR receptor-like serine...    168   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_011069383.1|  PREDICTED: probable LRR receptor-like serine...    168   6e-44   Sesamum indicum [beniseed]
gb|EYU33781.1|  hypothetical protein MIMGU_mgv1a000612mg                168   8e-44   Erythranthe guttata [common monkey flower]
ref|XP_010480181.1|  PREDICTED: probable LRR receptor-like serine...    168   9e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008668884.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-43   
gb|EYU27557.1|  hypothetical protein MIMGU_mgv1a018669mg                167   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_006655140.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   
ref|XP_008371824.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-43   
ref|XP_009341192.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   
ref|XP_009105697.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-43   Brassica rapa
ref|XP_009106800.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   Brassica rapa
emb|CDY42407.1|  BnaA08g00070D                                          167   1e-43   Brassica napus [oilseed rape]
ref|XP_009106801.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   Brassica rapa
ref|XP_010657565.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   
ref|XP_009621779.1|  PREDICTED: probable LRR receptor-like serine...    164   2e-43   
gb|ACN59257.1|  leucine-rich repeat receptor-like protein kinase        163   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06735.1|  Putative LRR receptor-like serine/threonine-prote...    167   2e-43   
ref|NP_176008.4|  Leucine-rich repeat transmembrane protein kinase      167   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44732.1|  hypothetical protein AALP_AA1G295500                    167   2e-43   Arabis alpina [alpine rockcress]
ref|XP_002894562.1|  leucine-rich repeat family protein                 167   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_004976817.1|  PREDICTED: probable LRR receptor-like serine...    167   2e-43   Setaria italica
ref|XP_008363409.1|  PREDICTED: probable LRR receptor-like serine...    160   3e-43   
dbj|BAF01001.1|  putative receptor-like protein kinase                  165   3e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11604.1|  BnaC06g31350D                                          163   6e-43   Brassica napus [oilseed rape]
ref|NP_001052392.1|  Os04g0291900                                       166   7e-43   
ref|NP_001185247.1|  leucine-rich repeat transmembrane protein ki...    165   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243682.1|  PREDICTED: probable LRR receptor-like serine...    165   8e-43   
ref|NP_564710.1|  leucine-rich repeat transmembrane protein kinase      165   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243680.1|  PREDICTED: probable LRR receptor-like serine...    165   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_004955904.1|  PREDICTED: probable LRR receptor-like serine...    165   9e-43   Setaria italica
emb|CDY38804.1|  BnaA07g28760D                                          162   9e-43   Brassica napus [oilseed rape]
emb|CDY10508.1|  BnaC03g71060D                                          165   9e-43   Brassica napus [oilseed rape]
ref|XP_004955905.1|  PREDICTED: probable LRR receptor-like serine...    165   9e-43   Setaria italica
ref|XP_004955902.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-42   
ref|XP_004955903.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-42   
ref|NP_001055041.1|  Os05g0261700                                       161   1e-42   
ref|XP_009759495.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-42   Nicotiana sylvestris
ref|XP_002513383.1|  ATP binding protein, putative                      165   1e-42   
ref|XP_010246434.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-42   
ref|XP_006655141.1|  PREDICTED: probable LRR receptor-like serine...    164   1e-42   Oryza brachyantha
ref|XP_006390899.1|  hypothetical protein EUTSA_v10018064mg             164   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004955901.1|  PREDICTED: probable LRR receptor-like serine...    164   1e-42   Setaria italica
ref|XP_006306656.1|  hypothetical protein CARUB_v10008172mg             164   2e-42   Capsella rubella
gb|KFK35533.1|  hypothetical protein AALP_AA4G003000                    164   2e-42   Arabis alpina [alpine rockcress]
emb|CAD41886.2|  OSJNBa0093O08.5                                        164   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_176009.1|  putative LRR receptor-like serine/threonine-pro...    164   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663598.1|  PREDICTED: probable LRR receptor-like serine...    163   2e-42   Zea mays [maize]
gb|EEE68222.1|  hypothetical protein OsJ_26394                          164   2e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CDY03757.1|  BnaA02g14800D                                          165   2e-42   
gb|AFW59454.1|  putative leucine-rich repeat receptor-like protei...    162   2e-42   
ref|XP_007024832.1|  Leucine-rich repeat transmembrane protein ki...    164   2e-42   
ref|XP_008663594.1|  PREDICTED: probable LRR receptor-like serine...    163   2e-42   Zea mays [maize]
gb|KDP35216.1|  hypothetical protein JCGZ_09375                         163   3e-42   Jatropha curcas
ref|XP_006422235.1|  hypothetical protein CICLE_v10007054mg             163   3e-42   
gb|AFW59455.1|  putative leucine-rich repeat receptor-like protei...    163   4e-42   
gb|KDO77514.1|  hypothetical protein CISIN_1g0025621mg                  161   4e-42   Citrus sinensis [apfelsine]
ref|XP_006659920.1|  PREDICTED: probable LRR receptor-like serine...    163   4e-42   
ref|XP_006659921.1|  PREDICTED: probable LRR receptor-like serine...    163   5e-42   Oryza brachyantha
ref|XP_010463512.1|  PREDICTED: probable LRR receptor-like serine...    161   5e-42   
gb|EEC83077.1|  hypothetical protein OsI_28200                          163   5e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_008374903.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-42   
ref|XP_002526908.1|  ATP binding protein, putative                      162   6e-42   
ref|XP_009341189.1|  PREDICTED: probable LRR receptor-like serine...    162   7e-42   
ref|XP_006392561.1|  hypothetical protein EUTSA_v10012006mg             162   7e-42   
gb|AAG50909.1|AC069159_10  receptor protein kinase, putative            164   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101796.1|  PREDICTED: probable LRR receptor-like serine...    162   8e-42   
ref|XP_011465668.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    162   8e-42   Fragaria vesca subsp. vesca
emb|CDY22357.1|  BnaA06g36790D                                          162   9e-42   Brassica napus [oilseed rape]
ref|XP_010480195.1|  PREDICTED: probable LRR receptor-like serine...    162   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006392563.1|  hypothetical protein EUTSA_v10012222mg             162   1e-41   
ref|XP_010501250.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   Camelina sativa [gold-of-pleasure]
emb|CDY47811.1|  BnaC07g17020D                                          162   1e-41   Brassica napus [oilseed rape]
gb|AAG50912.1|AC069159_13  hypothetical protein, 3' partial             159   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010234449.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-41   
ref|XP_008366779.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-41   
emb|CDY59119.1|  BnaCnng34350D                                          161   1e-41   Brassica napus [oilseed rape]
ref|XP_009127785.1|  PREDICTED: probable LRR receptor-like serine...    161   1e-41   Brassica rapa
emb|CAN73893.1|  hypothetical protein VITISV_028202                     155   1e-41   Vitis vinifera
ref|XP_010501246.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010557130.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010234448.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   
ref|XP_010557141.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_006468414.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   Citrus sinensis [apfelsine]
ref|XP_010557133.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   Tarenaya hassleriana [spider flower]
gb|EEC83075.1|  hypothetical protein OsI_28198                          160   2e-41   Oryza sativa Indica Group [Indian rice]
gb|EEE68221.1|  hypothetical protein OsJ_26393                          160   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462494.1|  PREDICTED: probable LRR receptor-like serine...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008368372.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-41   
ref|XP_008447120.1|  PREDICTED: probable LRR receptor-like serine...    160   3e-41   Cucumis melo [Oriental melon]
emb|CDX67736.1|  BnaA07g17760D                                          160   3e-41   
ref|XP_009104133.1|  PREDICTED: probable LRR receptor-like serine...    160   3e-41   Brassica rapa
emb|CDY43003.1|  BnaC02g19770D                                          161   4e-41   Brassica napus [oilseed rape]
ref|NP_001061223.1|  Os08g0203400                                       160   4e-41   
ref|XP_006303851.1|  hypothetical protein CARUB_v10012587mg             160   4e-41   
ref|XP_011022401.1|  PREDICTED: probable LRR receptor-like serine...    160   5e-41   Populus euphratica
ref|XP_002270976.3|  PREDICTED: probable LRR receptor-like serine...    160   5e-41   Vitis vinifera
ref|XP_010045978.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-41   
ref|XP_011022400.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-41   Populus euphratica
ref|XP_010098477.1|  putative LRR receptor-like serine/threonine-...    159   6e-41   
ref|XP_002969397.1|  hypothetical protein SELMODRAFT_170829             153   6e-41   
ref|XP_010244447.1|  PREDICTED: probable LRR receptor-like serine...    159   7e-41   
ref|XP_010244450.1|  PREDICTED: probable LRR receptor-like serine...    159   8e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010240425.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    159   9e-41   
gb|EEE68215.1|  hypothetical protein OsJ_26387                          157   9e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684924.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011026778.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-40   Populus euphratica
ref|XP_007024836.1|  Leucine-rich repeat transmembrane protein ki...    159   1e-40   
gb|KJB69980.1|  hypothetical protein B456_011G052100                    159   1e-40   Gossypium raimondii
ref|XP_010480180.1|  PREDICTED: probable LRR receptor-like serine...    158   2e-40   
ref|XP_010274130.1|  PREDICTED: probable LRR receptor-like serine...    158   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002273016.1|  PREDICTED: probable LRR receptor-like serine...    158   2e-40   Vitis vinifera
dbj|BAD03117.1|  putative Receptor-like serine/threonine kinase(R...    158   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011069336.1|  PREDICTED: probable LRR receptor-like serine...    158   3e-40   
gb|KJB69978.1|  hypothetical protein B456_011G052000                    157   3e-40   Gossypium raimondii
emb|CDX98288.1|  BnaC06g16490D                                          157   3e-40   
ref|XP_006448777.1|  hypothetical protein CICLE_v10018038mg             157   4e-40   
emb|CDP13526.1|  unnamed protein product                                145   4e-40   Coffea canephora [robusta coffee]
ref|XP_011461379.1|  PREDICTED: probable LRR receptor-like serine...    149   5e-40   Fragaria vesca subsp. vesca
ref|XP_002894561.1|  leucine-rich repeat family protein                 157   5e-40   
gb|KFK35535.1|  hypothetical protein AALP_AA4G003200                    157   5e-40   Arabis alpina [alpine rockcress]
emb|CBI39030.3|  unnamed protein product                                157   8e-40   Vitis vinifera
ref|XP_006468413.1|  PREDICTED: probable LRR receptor-like serine...    156   9e-40   
ref|XP_010655871.1|  PREDICTED: probable LRR receptor-like serine...    156   1e-39   Vitis vinifera
gb|KCW71355.1|  hypothetical protein EUGRSUZ_F04436                     155   2e-39   Eucalyptus grandis [rose gum]
gb|EEC83074.1|  hypothetical protein OsI_28197                          154   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_008225767.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-39   
ref|XP_006448781.1|  hypothetical protein CICLE_v10018029mg             155   3e-39   
ref|XP_006306665.1|  hypothetical protein CARUB_v10008183mg             155   3e-39   Capsella rubella
ref|XP_002970734.1|  hypothetical protein SELMODRAFT_411551             153   3e-39   
ref|XP_010041056.1|  PREDICTED: probable LRR receptor-like serine...    154   4e-39   
ref|XP_008371826.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-39   
ref|XP_009106802.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_007133341.1|  hypothetical protein PHAVU_011G1716001g            145   6e-39   
ref|XP_008363411.1|  PREDICTED: probable LRR receptor-like serine...    148   7e-39   
ref|XP_007133342.1|  hypothetical protein PHAVU_011G1716001g            146   9e-39   
ref|XP_008779527.1|  PREDICTED: probable LRR receptor-like serine...    146   9e-39   
ref|XP_006306576.1|  hypothetical protein CARUB_v10008071mg             154   2e-38   
gb|KCW44835.1|  hypothetical protein EUGRSUZ_L01594                     152   2e-38   
emb|CDY10509.1|  BnaC03g71050D                                          152   2e-38   
ref|XP_008374902.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
ref|XP_010684922.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
gb|EEE68223.1|  hypothetical protein OsJ_26395                          152   3e-38   
ref|XP_006346232.1|  PREDICTED: probable LRR receptor-like serine...    152   4e-38   
gb|KFK35534.1|  hypothetical protein AALP_AA4G003100                    151   5e-38   
gb|EEE61687.1|  hypothetical protein OsJ_16160                          150   1e-37   
ref|XP_008465064.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_008465062.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
gb|EEE63026.1|  hypothetical protein OsJ_17834                          150   1e-37   
emb|CBI39037.3|  unnamed protein product                                150   1e-37   
ref|XP_003633055.2|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|XP_008465063.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
gb|AAF02838.1|AC009894_9  Similar to serine/threonine kinases           150   1e-37   
ref|XP_009123873.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_009123874.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
gb|KJB84220.1|  hypothetical protein B456_N011200                       150   2e-37   
emb|CAN83365.1|  hypothetical protein VITISV_032776                     141   2e-37   
ref|XP_009389705.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-37   
ref|XP_006448779.1|  hypothetical protein CICLE_v10017491mg             144   2e-37   
ref|XP_010645966.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
emb|CDY32961.1|  BnaA09g16320D                                          140   3e-37   
ref|XP_002272816.2|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_010670584.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-37   
ref|XP_010098478.1|  putative LRR receptor-like serine/threonine-...    149   4e-37   
emb|CDY68250.1|  BnaCnng58230D                                          149   4e-37   
emb|CBI20535.3|  unnamed protein product                                148   6e-37   
ref|XP_010645957.1|  PREDICTED: probable LRR receptor-like serine...    148   7e-37   
ref|XP_010645958.1|  PREDICTED: probable LRR receptor-like serine...    148   7e-37   
ref|XP_002271607.3|  PREDICTED: probable LRR receptor-like serine...    148   8e-37   
ref|XP_010480076.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_010678919.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
gb|EMT27999.1|  Putative LRR receptor-like serine/threonine-prote...    147   1e-36   
ref|XP_010557111.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
ref|XP_010557120.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
ref|XP_010557103.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-36   
gb|EEC83073.1|  hypothetical protein OsI_28196                          147   2e-36   
ref|XP_004149631.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-36   
ref|XP_010501251.1|  PREDICTED: probable LRR receptor-like serine...    146   4e-36   
ref|XP_009420913.1|  PREDICTED: probable LRR receptor-like serine...    142   4e-36   
ref|XP_010462496.1|  PREDICTED: probable LRR receptor-like serine...    146   4e-36   
emb|CAN66709.1|  hypothetical protein VITISV_006396                     145   6e-36   
dbj|BAJ95627.1|  predicted protein                                      145   6e-36   
ref|XP_006410027.1|  hypothetical protein EUTSA_v10016175mg             144   8e-36   
ref|XP_007203797.1|  hypothetical protein PRUPE_ppa000802mg             145   8e-36   
gb|EMT28001.1|  Putative LRR receptor-like serine/threonine-prote...    144   1e-35   
gb|EEE61685.1|  hypothetical protein OsJ_16158                          144   1e-35   
ref|XP_007214280.1|  hypothetical protein PRUPE_ppa026535mg             145   1e-35   
ref|XP_011461378.1|  PREDICTED: probable LRR receptor-like serine...    137   1e-35   
emb|CAJ86064.1|  H0818E11.1                                             145   1e-35   
ref|XP_006410026.1|  hypothetical protein EUTSA_v10016175mg             144   2e-35   
ref|XP_010243676.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
emb|CBI20020.3|  unnamed protein product                                138   2e-35   
gb|KFK41450.1|  hypothetical protein AALP_AA2G132100                    144   2e-35   
ref|XP_010243674.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
ref|XP_010243677.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
gb|AAF02839.1|AC009894_10  Similar to serine/threonine kinases          144   2e-35   
ref|XP_006388877.1|  hypothetical protein POPTR_0084s002302g            139   2e-35   
ref|XP_010243673.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
ref|XP_004972617.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
gb|EMT06666.1|  Putative LRR receptor-like serine/threonine-prote...    137   2e-35   
ref|XP_010064057.1|  PREDICTED: probable LRR receptor-like serine...    143   3e-35   
gb|EEC83072.1|  hypothetical protein OsI_28195                          143   3e-35   
ref|XP_007024833.1|  Leucine-rich repeat transmembrane protein ki...    144   3e-35   
ref|XP_011462047.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    143   4e-35   
emb|CAD41885.2|  OSJNBa0093O08.4                                        143   4e-35   
gb|EEE63023.1|  hypothetical protein OsJ_17831                          142   4e-35   
gb|EEC78859.1|  hypothetical protein OsI_19211                          143   5e-35   
gb|KJB69988.1|  hypothetical protein B456_011G052400                    142   8e-35   
gb|KJB69989.1|  hypothetical protein B456_011G052400                    142   8e-35   
gb|EEC83071.1|  hypothetical protein OsI_28194                          141   1e-34   
emb|CDY12693.1|  BnaA02g13610D                                          142   1e-34   
ref|XP_010487294.1|  PREDICTED: probable leucine-rich repeat rece...    141   2e-34   
gb|KDP35219.1|  hypothetical protein JCGZ_09378                         133   2e-34   
tpg|DAA36011.1|  TPA: putative leucine-rich repeat receptor-like ...    140   3e-34   
ref|XP_006659918.1|  PREDICTED: uncharacterized protein LOC102723075    141   3e-34   
gb|KDO77511.1|  hypothetical protein CISIN_1g0025811mg                  139   4e-34   
ref|XP_008663597.1|  PREDICTED: probable LRR receptor-like serine...    140   4e-34   
ref|XP_009127600.1|  PREDICTED: probable LRR receptor-like serine...    139   8e-34   
ref|XP_011002770.1|  PREDICTED: probable LRR receptor-like serine...    139   8e-34   
ref|XP_010462387.1|  PREDICTED: probable LRR receptor-like serine...    139   1e-33   
gb|AAY67902.1|  SHR5-receptor-like kinase                               138   2e-33   
ref|XP_010480075.1|  PREDICTED: probable LRR receptor-like serine...    138   3e-33   
ref|XP_010244449.1|  PREDICTED: probable LRR receptor-like serine...    137   3e-33   
ref|XP_006370081.1|  hypothetical protein POPTR_0001s393802g            132   3e-33   
gb|EEE61688.1|  hypothetical protein OsJ_16161                          137   4e-33   
ref|XP_011463567.1|  PREDICTED: probable leucine-rich repeat rece...    130   4e-33   
ref|XP_010480077.1|  PREDICTED: probable LRR receptor-like serine...    137   5e-33   
gb|EEC78008.1|  hypothetical protein OsI_17411                          137   6e-33   
ref|XP_010244454.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
ref|XP_006585736.1|  PREDICTED: probable LRR receptor-like serine...    136   8e-33   
ref|XP_006587157.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_002297945.2|  hypothetical protein POPTR_0001s11460g             135   2e-32   
ref|XP_010502195.1|  PREDICTED: probable leucine-rich repeat rece...    135   2e-32   
emb|CDX75791.1|  BnaC03g38740D                                          135   3e-32   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             134   6e-32   
ref|XP_010436541.1|  PREDICTED: probable leucine-rich repeat rece...    131   6e-32   
ref|XP_002448531.1|  hypothetical protein SORBIDRAFT_06g028560          134   7e-32   
ref|XP_011460364.1|  PREDICTED: probable LRR receptor-like serine...    134   8e-32   
gb|KJB69967.1|  hypothetical protein B456_011G052300                    133   1e-31   
ref|XP_009135398.1|  PREDICTED: probable leucine-rich repeat rece...    133   1e-31   
ref|XP_009135396.1|  PREDICTED: probable leucine-rich repeat rece...    133   1e-31   
ref|XP_009135397.1|  PREDICTED: probable leucine-rich repeat rece...    133   1e-31   
emb|CDX82466.1|  BnaA03g33550D                                          133   2e-31   
ref|XP_010499489.1|  PREDICTED: probable LRR receptor-like serine...    133   2e-31   
emb|CDX82465.1|  BnaA03g33560D                                          132   2e-31   
emb|CDX82464.1|  BnaA03g33570D                                          132   3e-31   
ref|XP_010244452.1|  PREDICTED: probable LRR receptor-like serine...    131   3e-31   
ref|XP_011102070.1|  PREDICTED: probable leucine-rich repeat rece...    127   4e-31   
ref|XP_011461827.1|  PREDICTED: probable leucine-rich repeat rece...    132   4e-31   
ref|XP_010465400.1|  PREDICTED: probable leucine-rich repeat rece...    131   4e-31   
gb|KJB34924.1|  hypothetical protein B456_006G091400                    131   5e-31   
ref|XP_008345119.1|  PREDICTED: probable LRR receptor-like serine...    124   5e-31   
emb|CBN79778.1|  LRR-GTPase of the ROCO family, putative pseudogene     131   6e-31   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    130   9e-31   
emb|CBI30742.3|  unnamed protein product                                130   9e-31   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    130   9e-31   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-30   
ref|XP_002448532.1|  hypothetical protein SORBIDRAFT_06g028570          130   1e-30   
gb|KJB09255.1|  hypothetical protein B456_001G131800                    124   1e-30   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             130   1e-30   
ref|XP_010460742.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-30   
ref|XP_010248482.1|  PREDICTED: probable leucine-rich repeat rece...    124   2e-30   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    129   2e-30   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    129   2e-30   
ref|XP_010243678.1|  PREDICTED: probable LRR receptor-like serine...    129   3e-30   
ref|XP_009146317.1|  PREDICTED: probable leucine-rich repeat rece...    129   3e-30   
emb|CDX75792.1|  BnaC03g38750D                                          129   3e-30   
ref|XP_010645965.1|  PREDICTED: probable LRR receptor-like serine...    129   3e-30   
ref|XP_011462076.1|  PREDICTED: probable leucine-rich repeat rece...    129   4e-30   
ref|XP_003596231.1|  Leucine-rich repeat family protein / protein...    129   4e-30   
emb|CDX97610.1|  BnaA05g24690D                                          129   5e-30   
gb|AES66482.2|  LRR receptor-like kinase                                128   5e-30   
gb|KEH38584.1|  LRR receptor-like kinase                                128   6e-30   
ref|XP_010451463.1|  PREDICTED: probable leucine-rich repeat rece...    126   6e-30   
gb|AAT73676.1|  putative receptor-like serine/threonine kinase (R...    128   6e-30   
gb|KJB12990.1|  hypothetical protein B456_002G048900                    127   7e-30   
ref|XP_010247771.1|  PREDICTED: probable leucine-rich repeat rece...    124   7e-30   
ref|XP_010657567.1|  PREDICTED: probable LRR receptor-like serine...    120   7e-30   
emb|CDY32338.1|  BnaC01g36570D                                          128   7e-30   
gb|KJB12989.1|  hypothetical protein B456_002G048900                    128   8e-30   
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...    128   8e-30   
ref|XP_008465065.1|  PREDICTED: probable LRR receptor-like serine...    127   9e-30   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...    127   9e-30   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...    127   9e-30   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...    127   1e-29   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...    127   1e-29   
ref|XP_006306727.1|  hypothetical protein CARUB_v10008256mg             127   1e-29   
ref|XP_010060750.1|  PREDICTED: probable leucine-rich repeat rece...    127   1e-29   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...    127   1e-29   
ref|XP_007133350.1|  hypothetical protein PHAVU_011G172000g             119   1e-29   
ref|XP_002979305.1|  hypothetical protein SELMODRAFT_418921             127   1e-29   
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...    127   1e-29   
ref|XP_008342440.1|  PREDICTED: probable leucine-rich repeat rece...    124   1e-29   
ref|XP_010501252.1|  PREDICTED: probable LRR receptor-like serine...    127   1e-29   
ref|XP_007133351.1|  hypothetical protein PHAVU_011G172000g             120   2e-29   
dbj|BAP57509.1|  hypothetical protein THII_3212                         124   2e-29   
emb|CBI20543.3|  unnamed protein product                                127   2e-29   
emb|CDX99849.1|  BnaC05g22710D                                          126   2e-29   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...    126   3e-29   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    126   3e-29   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g             126   3e-29   
ref|XP_010412785.1|  PREDICTED: probable LRR receptor-like serine...    121   3e-29   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    126   3e-29   
gb|EMT09506.1|  Putative LRR receptor-like serine/threonine-prote...    126   3e-29   
emb|CDX99848.1|  BnaC05g22700D                                          126   3e-29   
ref|XP_006370932.1|  putative receptor-like protein kinase RLPK1        124   3e-29   
gb|KHN36926.1|  Putative leucine-rich repeat receptor-like serine...    120   3e-29   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             126   4e-29   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...    126   4e-29   
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...    125   4e-29   
gb|EYU38244.1|  hypothetical protein MIMGU_mgv11b008016mg               122   4e-29   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...    125   4e-29   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    125   4e-29   
gb|AES66496.2|  LRR receptor-like kinase                                125   4e-29   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...    125   4e-29   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    125   5e-29   
emb|CBJ29199.1|  LRR-GTPase of the ROCO family                          125   5e-29   
emb|CDX97606.1|  BnaA05g24730D                                          125   5e-29   
emb|CBI30748.3|  unnamed protein product                                125   5e-29   
ref|XP_009146321.1|  PREDICTED: probable leucine-rich repeat rece...    125   5e-29   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    125   5e-29   
emb|CDY05028.1|  BnaC03g28260D                                          125   6e-29   
gb|KCW67581.1|  hypothetical protein EUGRSUZ_F01338                     118   6e-29   
ref|XP_009116594.1|  PREDICTED: probable leucine-rich repeat rece...    125   9e-29   
emb|CDY20088.1|  BnaA01g29140D                                          125   9e-29   
ref|XP_011461995.1|  PREDICTED: probable LRR receptor-like serine...    125   9e-29   
gb|AAS49060.1|  At1g56140                                               117   1e-28   
ref|XP_006392562.1|  hypothetical protein EUTSA_v10011215mg             124   1e-28   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...    124   1e-28   
emb|CBJ31157.1|  Hypothetical leucine rich repeat protein               123   1e-28   
emb|CDX90696.1|  BnaA03g23760D                                          124   1e-28   
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                     124   1e-28   
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...    124   1e-28   
ref|XP_011460365.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
gb|KJB12988.1|  hypothetical protein B456_002G048800                    124   2e-28   
ref|XP_007149528.1|  hypothetical protein PHAVU_005G077700g             120   2e-28   
gb|KJB12987.1|  hypothetical protein B456_002G048800                    124   2e-28   
emb|CBJ29898.1|  LRR-GTPase of the ROCO family                          124   2e-28   
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
emb|CDY33594.1|  BnaC06g29580D                                          120   2e-28   
ref|XP_009134111.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             123   2e-28   
ref|XP_010244448.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...    124   2e-28   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...    124   2e-28   
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...    123   3e-28   
ref|XP_009109650.1|  PREDICTED: probable LRR receptor-like serine...    123   3e-28   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             123   3e-28   
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...    123   3e-28   
ref|XP_009102814.1|  PREDICTED: probable LRR receptor-like serine...    123   3e-28   
ref|NP_001061218.2|  Os08g0202300                                       122   3e-28   



>ref|XP_009621780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Nicotiana tomentosiformis]
Length=529

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG LG  F VL +L    AQ+  TDP EV A+NKIIDHWNLRSK+NLS  +PC +NA WA
Sbjct  1    MGFLGICFLVLLMLKIAAAQT-FTDPIEVDALNKIIDHWNLRSKLNLS-MDPCTQNAPWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P +ANPR+ACDCS T CHI  LKIY LD+ GEIP ELF+LKE+MDLNL QNV+NG++P E
Sbjct  59   PDQANPRVACDCSATICHITHLKIYALDVSGEIPNELFLLKELMDLNLGQNVINGTIPAE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I QL+KM++LS G NNLTGP+P E+G+L+ LI+LSF++NN NGPLPP+LG L +L+++YI
Sbjct  119  IRQLSKMQYLSLGINNLTGPVPAELGSLTNLISLSFSSNNFNGPLPPQLGKLISLQQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ + GPIP ELS LK+L +LWAS N FTGKLPEF G
Sbjct  179  DSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFG  216


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP EL  LK +  L  + N   G +P   G     + L   
Sbjct  168  GKLISLQQLYIDSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFGHFMNFQVLRLE  227

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
               L GPIP   G                        NL+ L  LS     + G LP +L
Sbjct  228  GTLLEGPIPSNYGVLIKLQDLRIGDLRNEDSSLDFIQNLTSLSILSLRNCRIIGQLPEKL  287

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +   LE + + SN+LTG IP       +LR L+  SNN +G+LP
Sbjct  288  SSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGELP  332


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +1

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPI  441
            L +    I+G++P++L     +  L+L+ N L G +P        +++L  G+NNL+G +
Sbjct  272  LSLRNCRIIGQLPEKLSSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGEL  331

Query  442  PPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
            PP I + S L  L  + N+++G L P+   L+
Sbjct  332  PPNIMS-SNLTALDVSFNSLSGDLTPKRSGLS  362



>ref|XP_011081555.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Sesamum indicum]
Length=678

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 178/218 (82%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L FS  V+ +L TV AQ   T+P EV AINKIIDHWNLRSK+NLS  +PC  NA+WA
Sbjct  33   MGVLSFSLLVIWMLETVAAQPK-TEPREVDAINKIIDHWNLRSKLNLS-VDPCTPNATWA  90

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P  ANPRIACDCS T CHI  LKIY LDI GEIP+ELF+L E+ DLNL QNVLNGS+PPE
Sbjct  91   PETANPRIACDCSDTICHITHLKIYALDISGEIPQELFLLTELSDLNLNQNVLNGSIPPE  150

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IGQL KM++L+ GTNN TGP+P E+GNL+ L++LS ++NN+ G LPP+LGNLT+L ++YI
Sbjct  151  IGQLLKMEYLALGTNNFTGPVPAELGNLTKLLSLSVSSNNLQGRLPPQLGNLTSLHQLYI  210

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++GPIP+ELS LK+L++LWAS N F GK+PEFLG
Sbjct  211  DSSGVSGPIPQELSNLKSLQILWASDNRFRGKIPEFLG  248



>ref|XP_009621778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nicotiana tomentosiformis]
Length=649

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG LG  F VL +L    AQ+  TDP EV A+NKIIDHWNLRSK+NLS  +PC +NA WA
Sbjct  1    MGFLGICFLVLLMLKIAAAQT-FTDPIEVDALNKIIDHWNLRSKLNLS-MDPCTQNAPWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P +ANPR+ACDCS T CHI  LKIY LD+ GEIP ELF+LKE+MDLNL QNV+NG++P E
Sbjct  59   PDQANPRVACDCSATICHITHLKIYALDVSGEIPNELFLLKELMDLNLGQNVINGTIPAE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I QL+KM++LS G NNLTGP+P E+G+L+ LI+LSF++NN NGPLPP+LG L +L+++YI
Sbjct  119  IRQLSKMQYLSLGINNLTGPVPAELGSLTNLISLSFSSNNFNGPLPPQLGKLISLQQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ + GPIP ELS LK+L +LWAS N FTGKLPEF G
Sbjct  179  DSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFG  216


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP EL  LK +  L  + N   G +P   G     + L   
Sbjct  168  GKLISLQQLYIDSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFGHFMNFQVLRLE  227

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
               L GPIP   G                        NL+ L  LS     + G LP +L
Sbjct  228  GTLLEGPIPSNYGVLIKLQDLRIGDLRNEDSSLDFIQNLTSLSILSLRNCRIIGQLPEKL  287

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +   LE + + SN+LTG IP       +LR L+  SNN +G+LP
Sbjct  288  SSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGELP  332


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +1

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPI  441
            L +    I+G++P++L     +  L+L+ N L G +P        +++L  G+NNL+G +
Sbjct  272  LSLRNCRIIGQLPEKLSSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGEL  331

Query  442  PPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
            PP I + S L  L  + N+++G L P+   L+
Sbjct  332  PPNIMS-SNLTALDVSFNSLSGDLTPKRSGLS  362



>ref|XP_009759487.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nicotiana sylvestris]
Length=649

 Score =   299 bits (766),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 174/217 (80%), Gaps = 2/217 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG LG  F VL +L    AQ   TDP EV A+NKIIDHWNLRSK+NL++ +PC++NA WA
Sbjct  1    MGFLGICFLVLLMLKIAAAQP-FTDPIEVDALNKIIDHWNLRSKLNLTT-DPCNRNAPWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P +ANPR+ACDCS T CHI  LKIY LD+ GEIPKELFVL+E+MDLNL QNV+NG++P E
Sbjct  59   PEQANPRVACDCSATICHITHLKIYALDVSGEIPKELFVLRELMDLNLGQNVINGTIPAE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I QL KM++LS G NNLTG +PPE+G+L+ LI+LSF +NN NGPLPP+LGNL +L+++YI
Sbjct  119  IRQLPKMQYLSLGINNLTGSVPPELGSLTNLISLSFGSNNFNGPLPPQLGNLVSLQQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            D + + GPIP ELS LK+L +LWAS N FTGKLPEF 
Sbjct  179  DGSGVNGPIPRELSNLKSLEILWASDNRFTGKLPEFF  215


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I G  + G IP+EL  LK +  L  + N   G +P         + L   
Sbjct  168  GNLVSLQQLYIDGSGVNGPIPRELSNLKSLEILWASDNRFTGKLPEFFVNFMNFQVLRLE  227

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
               L GPIP   G                        NL+ L  LS     + G LP +L
Sbjct  228  GTLLEGPIPSNYGALNKLQDLRIGDLHTEDSSLDFVENLTSLSILSLRNCRIIGQLPEKL  287

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +   LE + +  N+LTG IP       +LR L+  SNN +GKLP
Sbjct  288  SSFGNLEILDLSFNKLTGQIPRSFEDFASLRFLYLGSNNLSGKLP  332



>gb|KJB07626.1| hypothetical protein B456_001G034000 [Gossypium raimondii]
Length=650

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 174/218 (80%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L F+  +LGL   V AQ N TDPNEV A+  +I++WNL SK+NL+  +PC++NASW 
Sbjct  1    MGLLSFTLLILGLFQLVSAQQN-TDPNEVAALRTLINYWNLGSKINLT-IDPCNQNASWT  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
              ++NPR+ACDCS   CHI  LKIY LDI GEIPKELF LKE+MDLNL QNVLNGS+P E
Sbjct  59   SEDSNPRVACDCSSNICHITHLKIYALDIKGEIPKELFELKELMDLNLGQNVLNGSIPAE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IGQL+KM++LS G NNLTG +PPE+GNLS L +LSF++NN  GPLP ELGNLT+L+++YI
Sbjct  119  IGQLSKMQYLSLGINNLTGAVPPELGNLSQLHSLSFSSNNFFGPLPKELGNLTSLQQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++G IPEE + LK+L++LWAS N  TGKLPE+ G
Sbjct  179  DSSGVSGSIPEEFANLKSLQILWASDNRLTGKLPEYFG  216


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 74/166 (45%), Gaps = 24/166 (14%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N L G +P   G  T+ + +   
Sbjct  168  GNLTSLQQLYIDSSGVSGSIPEEFANLKSLQILWASDNRLTGKLPEYFGTFTEFRDMRLQ  227

Query  418  TNNLTGPIPP-----------EIGNL-------------SILITLSFATNNMNGPLPPEL  525
              ++ GPIP             IG+L             + L TLS     ++G +P  +
Sbjct  228  GTSVEGPIPSSFSALTKLEDLRIGDLRGEASSLDFLDSQTSLSTLSLRNCQLSGQIPERI  287

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
            G  T L+ + +  N+LTG IP       +L+ L+  +NN +G+LPE
Sbjct  288  GKFTNLKYLDLSFNKLTGQIPTSFRGFSSLQFLYLGNNNLSGELPE  333


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 72/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    ++ L     +  G +PKEL  L  +  L +  + ++GS+P E   L  ++ L   
Sbjct  144  GNLSQLHSLSFSSNNFFGPLPKELGNLTSLQQLYIDSSGVSGSIPEEFANLKSLQILWAS  203

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM-------------YI  558
             N LTG +P   G  +    +     ++ GP+P     LT LE++             ++
Sbjct  204  DNRLTGKLPEYFGTFTEFRDMRLQGTSVEGPIPSSFSALTKLEDLRIGDLRGEASSLDFL  263

Query  559  DSN-----------RLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            DS            +L+G IPE + K  NL+ L  S N  TG++P
Sbjct  264  DSQTSLSTLSLRNCQLSGQIPERIGKFTNLKYLDLSFNKLTGQIP  308


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 70/160 (44%), Gaps = 29/160 (18%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL------------------------NLA  345
            GTF     +++ G  + G IP     L ++ DL                        +L 
Sbjct  216  GTFTEFRDMRLQGTSVEGPIPSSFSALTKLEDLRIGDLRGEASSLDFLDSQTSLSTLSLR  275

Query  346  QNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
               L+G +P  IG+ T +K+L    N LTG IP      S L  L    NN++G LP + 
Sbjct  276  NCQLSGQIPERIGKFTNLKYLDLSFNKLTGQIPTSFRGFSSLQFLYLGNNNLSGELPED-  334

Query  526  GNLTTLEEMYIDS--NRLTGPIPEELSKLKNLRVLWASSN  639
              + T E + +D   N L+G +P + +K K++ V+  S N
Sbjct  335  --IITPELIALDVSFNPLSGNLPTQFAKTKSINVVGTSIN  372



>gb|EYU20256.1| hypothetical protein MIMGU_mgv1a002601mg [Erythranthe guttata]
Length=655

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTFCHINRLK  267
            T+P EV A+NKIIDHWNLR KVNL+  +PC +NASWAP  ANPRIACDCS T CHI  LK
Sbjct  26   TEPLEVDAMNKIIDHWNLRRKVNLN-IDPCIQNASWAPETANPRIACDCSATVCHITHLK  84

Query  268  IYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPP  447
            IY LDI GEIP+ELF+L E+MDLNL QNVLNGS+PP IGQL+KM++L  G NNLTGP+P 
Sbjct  85   IYALDIYGEIPQELFLLTELMDLNLDQNVLNGSIPPAIGQLSKMQYLGLGINNLTGPVPA  144

Query  448  EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLW  627
            E+GNL+ +I+LSF++NN  G LPPELGNLT+L+++YIDS+ LTGPIP+ELS LK+L+ LW
Sbjct  145  ELGNLTKMISLSFSSNNFKGTLPPELGNLTSLQQLYIDSSGLTGPIPQELSNLKSLQTLW  204

Query  628  ASSNNFTGKLPEFLG  672
            AS N FTGK+P+FLG
Sbjct  205  ASDNGFTGKIPDFLG  219


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 64/144 (44%), Gaps = 25/144 (17%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLA------------QNV------  354
            D  GTF  +  L++ G ++ G IP     L ++ DL +             +N+      
Sbjct  216  DFLGTFTQLKVLRLEGTNLEGPIPSSFGSLTKLEDLRIGDVGGSDTSLDFLENLTSLSIL  275

Query  355  ------LNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
                  ++G +P  +  L  +K L    N LTGPIP    N + L  L   +NN+NG LP
Sbjct  276  SLRNCRISGQIPEHLTTLPNLKILDLSFNKLTGPIPASFRNSASLQYLYLGSNNLNGDLP  335

Query  517  PELGNLTTLEEMYIDSNRLTGPIP  588
             ++   + L  + +  N LTG IP
Sbjct  336  TDIIG-SALIALDVSFNPLTGNIP  358



>gb|KDO61747.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=419

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELP  336



>ref|XP_011039729.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Populus euphratica]
Length=902

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            VMG+L F FFV  +      Q   TDPNEV A+NK+ID+WNLR K+N++  +PC +NA+W
Sbjct  246  VMGVLSFCFFVFWVSQVGFGQ-QTTDPNEVDALNKLIDYWNLRDKLNIND-DPCIQNATW  303

Query  196  APLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
               +ANPR+ACDC G  CHI  LKIY LDI GEIP ELFVLKE+MDLNL QNVLNGS+P 
Sbjct  304  TNEKANPRVACDCGGNTCHITHLKIYALDISGEIPSELFVLKELMDLNLGQNVLNGSIPA  363

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
            EI QL+ M++LS G NN TGP+PPE+GNL+ LI LSF++NN  GPLP  LG LT+L+E+Y
Sbjct  364  EIEQLSNMQYLSLGINNFTGPVPPELGNLTKLIVLSFSSNNFVGPLPASLGKLTSLQELY  423

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ ++GPIP+E + LK+L++LWAS N FTGKLP+F G
Sbjct  424  IDSSGVSGPIPQEFANLKSLQILWASDNQFTGKLPDFFG  462


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + G IP+E   LK +  L  + N   G +P   G LT+++ L   
Sbjct  414  GKLTSLQELYIDSSGVSGPIPQEFANLKSLQILWASDNQFTGKLPDFFGTLTELRTLRLQ  473

Query  418  TNNLTGPIPPEIGNLSIL------------ITLSFATNN------------MNGPLPPEL  525
               L GPIP     L+ L             +L F  N             ++G +P +L
Sbjct  474  GTLLEGPIPNSFSALNKLEDLRIGDLSGEDSSLEFMQNQKTLSILILRNCLLSGKMPDQL  533

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G  + L+E+ +  N+LTG IPE    L +L+ L+  SNN  G+LP
Sbjct  534  GEFSKLQELDLSFNKLTGQIPESFQDLVSLQYLYLGSNNLNGQLP  578


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 69/151 (46%), Gaps = 29/151 (19%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLA------------QN-------  351
            D  GT   +  L++ G  + G IP     L ++ DL +             QN       
Sbjct  459  DFFGTLTELRTLRLQGTLLEGPIPNSFSALNKLEDLRIGDLSGEDSSLEFMQNQKTLSIL  518

Query  352  -----VLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
                 +L+G +P ++G+ +K++ L    N LTG IP    +L  L  L   +NN+NG LP
Sbjct  519  ILRNCLLSGKMPDQLGEFSKLQELDLSFNKLTGQIPESFQDLVSLQYLYLGSNNLNGQLP  578

Query  517  PE-LG-NLTTLEEMYIDSNRLTGPIPEELSK  603
               LG N+  ++   +  N L+G +P+  +K
Sbjct  579  ANILGPNIIAID---VSFNSLSGSLPQNFAK  606



>ref|XP_006450417.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63657.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
Length=419

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELP  336


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 29/148 (20%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL--------------AQNVLN-----  360
            GT   +  L++ G  + G IP+    L ++ DL +              +Q  L+     
Sbjct  220  GTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLR  279

Query  361  -----GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
                 G +P ++G   K++ L    N LTG IP  + +LS+L  L    NN++G LP  +
Sbjct  280  NCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELPVNI  339

Query  526  --GNLTTLEEMYIDSNRLTGPIPEELSK  603
               NL  L+  Y   N L+G +P   +K
Sbjct  340  IAPNLIALDVSY---NPLSGNLPRNFAK  364



>ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46953.1| ATP binding protein, putative [Ricinus communis]
Length=895

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 182/219 (83%), Gaps = 1/219 (0%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            +M +L  SFF++ +L  V++    TD NEV A++K+ID+WNLRSK+N+++ +PC +NA+W
Sbjct  244  LMEVLSCSFFLVLVLLQVVSAQPATDSNEVAALDKMIDYWNLRSKLNITN-DPCIQNATW  302

Query  196  APLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
            A   ANPR+ACDC+G+ CHI  LKIY LDIVGEIP ELFVL+++MDLNL QNVLNGS+PP
Sbjct  303  ANENANPRVACDCTGSICHITHLKIYALDIVGEIPSELFVLQKLMDLNLGQNVLNGSIPP  362

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
            EIGQL+ M++LS G NNLTG +PPE+GNL+ L++LSF++NN  GPLP ELGNLT+L+++Y
Sbjct  363  EIGQLSNMQYLSLGINNLTGQVPPELGNLTKLLSLSFSSNNFFGPLPTELGNLTSLQQLY  422

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ ++G IP+E+ +LK+L++LWAS N FTGKLPEF G
Sbjct  423  IDSSGVSGSIPQEVKQLKSLQILWASDNRFTGKLPEFFG  461


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E+  LK +  L  + N   G +P   G LT +K L   
Sbjct  413  GNLTSLQQLYIDSSGVSGSIPQEVKQLKSLQILWASDNRFTGKLPEFFGALTALKVLRLQ  472

Query  418  TNNLTGPIPPEIGNLSIL------------ITLSFATNNMN------------GPLPPEL  525
               L GPIP     L+ L             +L F  +  N            G +P  L
Sbjct  473  GTLLEGPIPSSFSALNNLEDLRIGDLNGEDSSLEFLKDQRNLSVLILRNCLISGEIPERL  532

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G  T L+++ +  N+LTG IP     L +L+ L+  SN  +G+LP
Sbjct  533  GTFTKLKQLDLSFNKLTGQIPTSFQDLASLQFLYLGSNTLSGELP  577



>ref|XP_006450418.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63658.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
Length=544

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELP  336


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 29/148 (20%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL--------------AQNVLN-----  360
            GT   +  L++ G  + G IP+    L ++ DL +              +Q  L+     
Sbjct  220  GTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLR  279

Query  361  -----GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
                 G +P ++G   K++ L    N LTG IP  + +LS+L  L    NN++G LP  +
Sbjct  280  NCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELPVNI  339

Query  526  --GNLTTLEEMYIDSNRLTGPIPEELSK  603
               NL  L+  Y   N L+G +P   +K
Sbjct  340  IAPNLIALDVSY---NPLSGNLPRNFAK  364



>emb|CBI21051.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 176/218 (81%), Gaps = 3/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L  SFFVL ++  V AQ+  TD +EV A+NK+ID+WNLRS +N SS +PC +NA+WA
Sbjct  1    MGVLTVSFFVLCIIELVAAQTT-TDRDEVAALNKLIDYWNLRS-LN-SSIDPCTQNATWA  57

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
              +ANPR+ACDC+   CHI  LKIY LDI GEIP ELFVLK+++DLNL QNVL+G +P E
Sbjct  58   SKDANPRVACDCTSNTCHITHLKIYALDISGEIPPELFVLKKLVDLNLGQNVLSGPIPAE  117

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IGQL+ +++LS G NNLTG +P E+GNL+ L++LSF +NN  GPLP ELGNLT+L+++YI
Sbjct  118  IGQLSNLQYLSLGINNLTGRVPSELGNLTKLVSLSFGSNNFFGPLPKELGNLTSLQQLYI  177

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++GPIP+E + LK+L++LWAS N FTGKLPEF+G
Sbjct  178  DSSGVSGPIPQEFAGLKSLQILWASDNLFTGKLPEFIG  215


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
              G++P+ +  L E+ DL +   +L G +P   G LTK++ L  G           +G+ 
Sbjct  206  FTGKLPEFIGTLIELRDLRVEGTLLEGPIPSSFGALTKLEDLRIGDLRGQDSSLDFLGSQ  265

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNN  642
            + L  LS     ++G +P +L   T L+ + +  N+LTG I +      +L  L+  +NN
Sbjct  266  TSLSILSLRNCRVSGRIPDQLSTFTKLKYLDLSFNKLTGEILKSFQDFVSLEYLYLGNNN  325

Query  643  FTGKLP  660
              G+LP
Sbjct  326  LNGELP  331



>gb|KDP33585.1| hypothetical protein JCGZ_07156 [Jatropha curcas]
Length=650

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 174/218 (80%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            M  L F FF++ +L    AQ   TDP+EV A+NK+ID+WNLR K+N+++ +PC +NA+W+
Sbjct  1    MRFLSFCFFIIWVLQVAFAQPT-TDPSEVNALNKMIDYWNLRGKLNITT-DPCVQNATWS  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
               ANPR+ CDC G  CHI  LKIY LDI GEIP ELF+LKE+MDLNL QNVLNGS+PPE
Sbjct  59   NENANPRVHCDCIGNTCHITHLKIYALDISGEIPSELFMLKELMDLNLGQNVLNGSIPPE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IGQL+ M++LS G NNLTG +P E+GNL+ L++LSF++NN  GPLP  LG+LT+L+++YI
Sbjct  119  IGQLSNMQYLSLGINNLTGLVPSELGNLTKLLSLSFSSNNFLGPLPKTLGSLTSLQQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++GPIP+E +KLK+L++LWAS N FTGKLP+F G
Sbjct  179  DSSGVSGPIPQEFAKLKSLQILWASDNPFTGKLPDFFG  216


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G+   + +L I    + G IP+E   LK +  L  + N   G +P   G LT+++ L   
Sbjct  168  GSLTSLQQLYIDSSGVSGPIPQEFAKLKSLQILWASDNPFTGKLPDFFGTLTELRVLRIQ  227

Query  418  TNNLTGPIPPEIGNLSIL------------ITLSFATNNMN------------GPLPPEL  525
               L GPIP     L+ L             +L F  N  N            G +P +L
Sbjct  228  GTKLEGPIPSSFSALNKLEDLRIGDLSGEDSSLEFLKNQTNLSILILRNSLISGQIPEQL  287

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G  + L+ + +  N+LTGPIP+    L  L+ ++  +NN  G+LP
Sbjct  288  GTFSQLKLLDLSFNKLTGPIPDSFQDLTALQYMYLGNNNLNGELP  332


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 75/167 (45%), Gaps = 29/167 (17%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN-----------------------  339
            D  GT   +  L+I G  + G IP     L ++ DL                        
Sbjct  213  DFFGTLTELRVLRIQGTKLEGPIPSSFSALNKLEDLRIGDLSGEDSSLEFLKNQTNLSIL  272

Query  340  -LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
             L  ++++G +P ++G  +++K L    N LTGPIP    +L+ L  +    NN+NG LP
Sbjct  273  ILRNSLISGQIPEQLGTFSQLKLLDLSFNKLTGPIPDSFQDLTALQYMYLGNNNLNGELP  332

Query  517  PELGNLTTLEEMYIDS--NRLTGPIPEELSKLKNLRVLWASSNNFTG  651
                N+   + + ID   N L+G +P+ L+K+    ++  +S N  G
Sbjct  333  ---ANIIGPQLIAIDVSFNPLSGNLPQNLTKVVPSTIVVGTSINANG  376



>ref|XP_010648817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Vitis vinifera]
Length=812

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 177/219 (81%), Gaps = 3/219 (1%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            VMG+L  SFFVL ++  V AQ+  TD +EV A+NK+ID+WNLRS +N SS +PC +NA+W
Sbjct  163  VMGVLTVSFFVLCIIELVAAQTT-TDRDEVAALNKLIDYWNLRS-LN-SSIDPCTQNATW  219

Query  196  APLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
            A  +ANPR+ACDC+   CHI  LKIY LDI GEIP ELFVLK+++DLNL QNVL+G +P 
Sbjct  220  ASKDANPRVACDCTSNTCHITHLKIYALDISGEIPPELFVLKKLVDLNLGQNVLSGPIPA  279

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
            EIGQL+ +++LS G NNLTG +P E+GNL+ L++LSF +NN  GPLP ELGNLT+L+++Y
Sbjct  280  EIGQLSNLQYLSLGINNLTGRVPSELGNLTKLVSLSFGSNNFFGPLPKELGNLTSLQQLY  339

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ ++GPIP+E + LK+L++LWAS N FTGKLPEF+G
Sbjct  340  IDSSGVSGPIPQEFAGLKSLQILWASDNLFTGKLPEFIG  378


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
              G++P+ +  L E+ DL +   +L G +P   G LTK++ L  G           +G+ 
Sbjct  369  FTGKLPEFIGTLIELRDLRVEGTLLEGPIPSSFGALTKLEDLRIGDLRGQDSSLDFLGSQ  428

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNN  642
            + L  LS     ++G +P +L   T L+ + +  N+LTG I +      +L  L+  +NN
Sbjct  429  TSLSILSLRNCRVSGRIPDQLSTFTKLKYLDLSFNKLTGEILKSFQDFVSLEYLYLGNNN  488

Query  643  FTGKLP  660
              G+LP
Sbjct  489  LNGELP  494



>gb|KDO61744.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=642

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELP  336



>ref|XP_006450419.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 ref|XP_006450420.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63659.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63660.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
Length=657

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELP  336


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 29/148 (20%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL--------------AQNVLN-----  360
            GT   +  L++ G  + G IP+    L ++ DL +              +Q  L+     
Sbjct  220  GTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLR  279

Query  361  -----GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
                 G +P ++G   K++ L    N LTG IP  + +LS+L  L    NN++G LP  +
Sbjct  280  NCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSMLQYLYLGNNNLSGELPVNI  339

Query  526  --GNLTTLEEMYIDSNRLTGPIPEELSK  603
               NL  L+  Y   N L+G +P   +K
Sbjct  340  IAPNLIALDVSY---NPLSGNLPRNFAK  364



>ref|XP_006483373.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
 gb|KDO61745.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=657

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ++ TD  EV A+NK+ID+WNLRSK+NL++ +PC +NASWA   ANPR+ACDC+   
Sbjct  20   VSAQTS-TDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNS  78

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDI+GE+P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN
Sbjct  79   CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINN  138

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
             TG +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + L
Sbjct  139  FTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANL  198

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+LR+LWAS N FTGK+PEF G
Sbjct  199  KSLRILWASDNLFTGKIPEFFG  220


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  172  GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  231

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  232  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  291

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  292  GTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELP  336



>ref|XP_007224199.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
 gb|EMJ25398.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
Length=653

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 164/195 (84%), Gaps = 1/195 (1%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTFCHINRLK  267
            TDPNEV A+NKIIDHW+L ++++L+  +PC  NA+WA   ANPR+ CDC+G+ CHI  LK
Sbjct  26   TDPNEVSALNKIIDHWDLGNQLSLT-IDPCIPNATWASNTANPRVLCDCAGSTCHITHLK  84

Query  268  IYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPP  447
            IY LDI+GEIP+ELF LKE++DLNL QNVL+G +P EIGQL+K+++LS G NNLTGP+PP
Sbjct  85   IYALDILGEIPRELFELKELIDLNLGQNVLSGPIPAEIGQLSKLQYLSLGINNLTGPVPP  144

Query  448  EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLW  627
            EIGNLS L++LSF +N  +GPLP ELG LTTL+E+Y+DS+ +TGPIP+EL+ LK+L+ LW
Sbjct  145  EIGNLSKLLSLSFGSNQFSGPLPMELGKLTTLQELYLDSSGVTGPIPQELANLKSLKTLW  204

Query  628  ASSNNFTGKLPEFLG  672
            AS N FTGKLPEFLG
Sbjct  205  ASDNLFTGKLPEFLG  219


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
              G++P+ L +  E+ DL L   +L G +P   G L K+  L  G           + NL
Sbjct  210  FTGKLPEFLGIFAELKDLRLEGTLLEGPIPSNFGALVKLDILRVGDLGEEDSSLGFLENL  269

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNN  642
            + L TLS     ++G +P ++GN   L+ + +  N+LTG IP    K   L+ L+   NN
Sbjct  270  TSLSTLSLRNCRVSGKIPEQIGNFAKLQYLDLSFNKLTGQIPNSFQKFTVLQFLYLGDNN  329

Query  643  FTGKLP  660
             +G+LP
Sbjct  330  LSGELP  335



>ref|XP_007011844.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY29463.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=879

 Score =   278 bits (712),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEAN  213
             S + L  L  V AQ N TDPNEV A+ KIID+WNL SK+NL+  +PC +NA W   ++N
Sbjct  235  LSSYCLLCLYLVSAQQN-TDPNEVAALRKIIDYWNLGSKLNLT-VDPCSQNAKWTSEDSN  292

Query  214  PRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLT  393
            PR+ACDCS   CHI  LKIY LDI GEIP+ELF LKE+MDLNL QNVLNGS+P EIGQL+
Sbjct  293  PRVACDCSSNPCHITLLKIYALDIKGEIPRELFELKELMDLNLGQNVLNGSIPAEIGQLS  352

Query  394  KMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRL  573
            KM++LS G NNLTGP+PPE+GNL+ L++LSF++NN  GPLP ELG LT+L+++YIDS+ +
Sbjct  353  KMQYLSLGINNLTGPVPPELGNLTKLLSLSFSSNNFYGPLPKELGRLTSLQQLYIDSSGV  412

Query  574  TGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +GPIP E + LK+L++LWAS N  TGKLPEFLG
Sbjct  413  SGPIPPEFANLKSLQILWASDNLLTGKLPEFLG  445


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 75/166 (45%), Gaps = 24/166 (14%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP E   LK +  L  + N+L G +P  +G  T+ + +   
Sbjct  397  GRLTSLQQLYIDSSGVSGPIPPEFANLKSLQILWASDNLLTGKLPEFLGTFTEFRDMRLQ  456

Query  418  TNNLTGPIPP-----------EIGNLS-------------ILITLSFATNNMNGPLPPEL  525
              +L GPIP             +G+LS              L TLS     ++G LP  L
Sbjct  457  GTSLEGPIPSSFAALTKLEDLRVGDLSGEDSSLDFLNDQTRLSTLSLRNCRLSGQLPERL  516

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
            G  T L+ + +  N LTG IP    +  +L+ L+  +NN +G+LPE
Sbjct  517  GRFTMLQYLDLSFNELTGQIPISFREFSSLQFLYLGNNNLSGELPE  562


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 24/151 (16%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  G +PKEL  L  +  L +  + ++G +PPE   L  ++ L    N LTG +P  +G 
Sbjct  387  NFYGPLPKELGRLTSLQQLYIDSSGVSGPIPPEFANLKSLQILWASDNLLTGKLPEFLGT  446

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYI------DSN------------------  567
             +    +     ++ GP+P     LT LE++ +      DS+                  
Sbjct  447  FTEFRDMRLQGTSLEGPIPSSFAALTKLEDLRVGDLSGEDSSLDFLNDQTRLSTLSLRNC  506

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            RL+G +PE L +   L+ L  S N  TG++P
Sbjct  507  RLSGQLPERLGRFTMLQYLDLSFNELTGQIP  537


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 71/160 (44%), Gaps = 29/160 (18%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL------------------------NLA  345
            GTF     +++ G  + G IP     L ++ DL                        +L 
Sbjct  445  GTFTEFRDMRLQGTSLEGPIPSSFAALTKLEDLRVGDLSGEDSSLDFLNDQTRLSTLSLR  504

Query  346  QNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
               L+G +P  +G+ T +++L    N LTG IP      S L  L    NN++G LP + 
Sbjct  505  NCRLSGQLPERLGRFTMLQYLDLSFNELTGQIPISFREFSSLQFLYLGNNNLSGELPED-  563

Query  526  GNLTTLEEMYIDS--NRLTGPIPEELSKLKNLRVLWASSN  639
              + T E + +D   N L+G +P + +K+K++ V+  S N
Sbjct  564  --IITPELIALDVSFNPLSGNLPPQFAKVKSMNVVGTSIN  601



>ref|XP_008219685.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Prunus mume]
Length=664

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTFCHINRLK  267
            TDPNEV A+NKIIDHW++ ++++LS  +PC  NA+WA   ANPR+ CDC+G+ CHI  LK
Sbjct  37   TDPNEVSALNKIIDHWDMGNQLSLS-IDPCTPNATWASSTANPRVICDCAGSTCHITHLK  95

Query  268  IYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPP  447
            IY LDI+GEIP+ELF LKE++DLNL QNVL+G +P EIGQL+K+++LS G NNLTGP+P 
Sbjct  96   IYALDILGEIPRELFELKELIDLNLGQNVLSGPIPAEIGQLSKLQYLSLGINNLTGPVPQ  155

Query  448  EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLW  627
            EIGNLS L++LSF +N  +GPLP +LG LTTL+E+Y+DS+ +TGPIP+EL+ LK+L  LW
Sbjct  156  EIGNLSKLLSLSFGSNQFSGPLPMKLGKLTTLQELYLDSSGVTGPIPQELANLKSLNTLW  215

Query  628  ASSNNFTGKLPEFLG  672
            AS N FTG+LPEFLG
Sbjct  216  ASDNLFTGQLPEFLG  230


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 70/165 (42%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L +    + G IP+EL  LK +  L  + N+  G +P  +G   ++K L   
Sbjct  182  GKLTTLQELYLDSSGVTGPIPQELANLKSLNTLWASDNLFTGQLPEFLGTFAELKDLRLE  241

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
                 GPIP   G                        NL+ L TLS     ++G +P ++
Sbjct  242  GTLFEGPIPSNFGALVKLDILRVGDLGEEDSSLGFLENLTSLSTLSLRNCRVSGKIPEQI  301

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP    +   L+ L+   NN +G+LP
Sbjct  302  GKFAKLQYLDLSFNKLTGQIPNSFQEFTVLQFLYLGDNNLSGELP  346



>ref|XP_010040282.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=655

 Score =   268 bits (685),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L  S  VL ++  V AQ   TDPNE  A+ KII+HWNL S +N S+ +PC +NASWA
Sbjct  1    MGVLALSMVVLCVIQVVAAQ-KTTDPNEGAALKKIIEHWNLGSSLN-STVDPCTQNASWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P  ANPR++CDCSG  CHI  LKIY LDI G+IP ELF LKE+ DLNLAQNVL+G +PP+
Sbjct  59   PDTANPRVSCDCSGNVCHITHLKIYALDISGQIPSELFELKELTDLNLAQNVLSGPIPPQ  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
              QL+ M++LS G NNLTG +PPE+GN++ L++LSF++NN++GPLPPELG LT LE++YI
Sbjct  119  FEQLSNMQYLSLGINNLTGQVPPELGNMTKLLSLSFSSNNLSGPLPPELGKLTALEQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++GPIP++L+ LK+L+ LWAS N FTGKLPEFLG
Sbjct  179  DSSGVSGPIPQDLANLKSLQKLWASDNLFTGKLPEFLG  216


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 66/150 (44%), Gaps = 25/150 (17%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK--------------------  402
              G++P+ L  L E++DL      L G +P   G LTK++                    
Sbjct  207  FTGKLPEFLGTLTELVDLRFEGTSLEGPIPDSFGALTKLENLIIGDLVGDDSSLDFLRNQ  266

Query  403  ----WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNR  570
                 LS  +  L+G IP  IG  S L  L  + N + G +P      T L+ +++ +N 
Sbjct  267  TSLSVLSLRSCQLSGQIPDIIGTFSKLKYLDLSFNKLEGTIPDSFQGFTKLQFLFLGNNN  326

Query  571  LTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            LTGP+P  +   ++L  L  S N  +G LP
Sbjct  327  LTGPLPANIVS-QSLTALDVSFNPLSGNLP  355



>gb|KCW81385.1| hypothetical protein EUGRSUZ_C02767 [Eucalyptus grandis]
Length=627

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L  S  VL ++  V AQ   TDPNE  A+ KII+HWNL S +N S+ +PC +NASWA
Sbjct  1    MGVLALSMLVLCVIQVVAAQ-KTTDPNEGAALKKIIEHWNLGSSLN-STVDPCTQNASWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
            P  ANPR++CDCSG  CHI  LKIY LDI G+IP ELF LKE+ DLNLAQNVL+G +PP+
Sbjct  59   PDTANPRVSCDCSGNVCHITHLKIYALDISGQIPSELFELKELTDLNLAQNVLSGPIPPQ  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
              QL+ M++LS G NNLTG +PPE+GN++ L++LSF++NN++GPLP ELG LT LE++YI
Sbjct  119  FEQLSNMQYLSLGINNLTGQVPPELGNMTKLLSLSFSSNNLSGPLPAELGKLTALEQLYI  178

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ ++GPIP++L+ LK+L+ LWAS N FTGKLPEFLG
Sbjct  179  DSSGVSGPIPQDLANLKSLQKLWASDNLFTGKLPEFLG  216


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 66/150 (44%), Gaps = 25/150 (17%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK--------------------  402
              G++P+ L  L E++DL      L G +P   G LTK++                    
Sbjct  207  FTGKLPEFLGTLTELVDLRFEGTSLEGPIPDSFGALTKLENLIIGDLVGDDSSLDFLRNQ  266

Query  403  ----WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNR  570
                 LS  +  L+G IP  IG  S L  L  + N + G +P      T L+ +++ +N 
Sbjct  267  TSLSVLSLRSCQLSGQIPDIIGTFSKLKYLDLSFNKLEGTIPDSFQGFTKLQFLFLGNNN  326

Query  571  LTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            LTGP+P  +   ++L  L  S N  +G LP
Sbjct  327  LTGPLPANIVS-QSLTALDVSFNPLSGNLP  355



>ref|XP_011459850.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Fragaria vesca subsp. vesca]
Length=930

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = +1

Query  67   VIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTF  246
            V AQ   T P+EV A+NK+++HWNL + +NL+  +PC +NA+WA   ANPR+ACDC+G+ 
Sbjct  295  VYAQ-RTTAPDEVTALNKVLEHWNLANHLNLT-IDPCTENATWASETANPRVACDCTGST  352

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CHI  LKIY LDIVG++P ELF LK+++DLNL QNVL+G +PPEIG L+ M++LS G NN
Sbjct  353  CHITHLKIYALDIVGDLPGELFELKQLIDLNLGQNVLSGRIPPEIGLLSNMQYLSLGINN  412

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
            L+GP+PPE+G L+ L+ LSF++N  +GPLP ELG LT+L+++YIDS+ +TGPIP+E S L
Sbjct  413  LSGPVPPELGKLTKLVELSFSSNEFSGPLPVELGKLTSLQQLYIDSSGVTGPIPQEFSSL  472

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K+L+  WAS N FTGKLPEFLG
Sbjct  473  KSLQTFWASDNFFTGKLPEFLG  494


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
              G++P+ L  L ++MDL L   +L G +P   G LTK+  L  G  +        + NL
Sbjct  485  FTGKLPEFLGTLTQLMDLRLEGTLLEGPIPSNFGALTKLDILRIGDLSKEDSSLDFLENL  544

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNN  642
            + L  LS  +  ++G +P ++G  + L+ + +  N+L G IP+       L+ L+  +N+
Sbjct  545  TSLSMLSLRSCQVSGKIPEQIGKFSKLQYLDLRFNKLIGSIPDSFQDFTVLQFLYLGNND  604

Query  643  FTGKLP  660
             +G+LP
Sbjct  605  LSGELP  610



>ref|XP_011036739.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Populus euphratica]
Length=700

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 163/219 (74%), Gaps = 2/219 (1%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            VMG+L F F V  +   V AQ   TDPNEV A+N++ID+WNLR K+N+++ +PC +NA+W
Sbjct  50   VMGVLSFCFLVFWVSQVVFAQQ-ATDPNEVDALNRLIDYWNLRDKLNITN-DPCIQNAAW  107

Query  196  APLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
            A  +ANPR+ACDCS   CHI  LKI+ LDI GE+P ELFVLKE+ +L+  +NVLNG++P 
Sbjct  108  ANKQANPRVACDCSSNTCHITHLKIHALDISGELPSELFVLKELTNLDFGKNVLNGAIPA  167

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
            EI  L+ M+ L+ G NN TG +P E+GNL+ LITL F +NN  GPLP  LG L +L+E+Y
Sbjct  168  EIELLSNMQRLNLGINNFTGAVPQELGNLTKLITLDFGSNNFMGPLPTSLGKLKSLQELY  227

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            I+S+ ++G IP+E + LK+L+ LWAS N FTGKLP+F G
Sbjct  228  INSSGVSGRIPQEFANLKSLQTLWASDNLFTGKLPDFFG  266


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 72/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + G IP+E   LK +  L  + N+  G +P   G LTK++ L   
Sbjct  218  GKLKSLQELYINSSGVSGRIPQEFANLKSLQTLWASDNLFTGKLPDFFGTLTKLRNLRLQ  277

Query  418  TNNLTGPIPPEIGNLSILITLSFATNN------------------------MNGPLPPEL  525
               L GPIP     L  L  L     N                        ++G +P +L
Sbjct  278  GTLLEGPIPSSFSALKKLGDLRIGDLNGEDSSLEFLLDQKNLTILILRNCLLSGQIPDQL  337

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            GN + L+E+ +  N+LTG IP+    L +L+ L+  SNN  G+LP
Sbjct  338  GNFSQLQELDLSFNKLTGQIPDSFQDLASLQYLYLGSNNLNGQLP  382


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 65/147 (44%), Gaps = 29/147 (20%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN-----------------------  339
            D  GT   +  L++ G  + G IP     LK++ DL                        
Sbjct  263  DFFGTLTKLRNLRLQGTLLEGPIPSSFSALKKLGDLRIGDLNGEDSSLEFLLDQKNLTIL  322

Query  340  -LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
             L   +L+G +P ++G  ++++ L    N LTG IP    +L+ L  L   +NN+NG LP
Sbjct  323  ILRNCLLSGQIPDQLGNFSQLQELDLSFNKLTGQIPDSFQDLASLQYLYLGSNNLNGQLP  382

Query  517  PEL--GNLTTLEEMYIDSNRLTGPIPE  591
              +   NL  ++   +  N L+G +P+
Sbjct  383  ANIIGPNLIAID---VSFNPLSGSLPQ  406



>ref|XP_002309634.2| hypothetical protein POPTR_0006s27120g [Populus trichocarpa]
 gb|EEE93157.2| hypothetical protein POPTR_0006s27120g [Populus trichocarpa]
Length=523

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 129/195 (66%), Gaps = 1/195 (1%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSGTFCHINRLK  267
            TDP EV A+NK+ID+WNLR ++N++  +PC +NA+WA   ANPR+ACDC G  CHI  LK
Sbjct  23   TDPKEVDALNKLIDYWNLRDRLNITD-DPCIQNATWANEIANPRVACDCGGNTCHITHLK  81

Query  268  IYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPP  447
            IY LDI GEIP ELFVLK++MDLNL QNVLNGS+P EI QL+ M++LSF +NN  G +P 
Sbjct  82   IYALDISGEIPSELFVLKDLMDLNLGQNVLNGSIPAEIEQLSNMQYLSFSSNNFVGSLPT  141

Query  448  EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLW  627
             +G L+ L  L  + N   G LP   G LT L  + +    L GPIP   S L  L  L 
Sbjct  142  SLGKLTSLQELWASDNQFTGKLPDFFGTLTELRTLRLQGTLLEGPIPNSFSALNKLEDLI  201

Query  628  ASSNNFTGKLPEFLG  672
              +   +GK+P+ LG
Sbjct  202  LRNCLLSGKIPDQLG  216



>ref|XP_010064052.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=309

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 138/206 (67%), Gaps = 12/206 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKNA-----SWAPLEANPRIACDCS--  237
            TDP+EV  +N I   W L S   K N+S  EPC   A     S    + NP I CDCS  
Sbjct  30   TDPSEVAILNSIWSTWGLTSQTPKWNMSG-EPCSGVAINDAVSIDDKDYNPFIKCDCSFN  88

Query  238  -GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
              T CHI +LK+Y + +   IP EL+ L  + +LNLAQN+L GS+ P IG LT+M++L+ 
Sbjct  89   NSTTCHITQLKVYAMSVASPIPDELWNLTYLSNLNLAQNLLTGSLSPSIGNLTRMQYLTV  148

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
            G N L+G +PP++G L+ L++LSF+TN  NG LP ELGNL+ L+++YIDS+ +TG IP  
Sbjct  149  GINALSGELPPQLGQLTELLSLSFSTNKFNGSLPSELGNLSKLQQLYIDSSGVTGEIPSA  208

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
             SKLKNL+ +WAS NNFTG +PEF+G
Sbjct  209  FSKLKNLQKVWASDNNFTGNIPEFIG  234



>ref|XP_010090613.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB40149.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=565

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  265  KIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIP  444
            KIY LDI GEIPKELF LK++MDLNLAQNVL+GSVPPEIGQL+ M++LS G NNLTGP+P
Sbjct  4    KIYALDISGEIPKELFELKKLMDLNLAQNVLSGSVPPEIGQLSDMQYLSLGINNLTGPVP  63

Query  445  PEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVL  624
             E+GNL+ LI+LSF++N+  G LP ELG LT L+++YIDS+ +TGPIP+E + LK LR+L
Sbjct  64   QELGNLTKLISLSFSSNSFVGQLPKELGKLTLLQQLYIDSSGVTGPIPQEFASLKALRIL  123

Query  625  WASSNNFTGKLPEFLG  672
            WAS N FTGKLPEFLG
Sbjct  124  WASDNLFTGKLPEFLG  139



>ref|XP_010941603.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Elaeis guineensis]
Length=1061

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 144/222 (65%), Gaps = 12/222 (5%)
 Frame = +1

Query  40   FFVLGL--LNTVIAQSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNAS----W  195
            FF+L L  L T       TDP+EV A+N I+  W   +    N+S  EPC   A+    +
Sbjct  40   FFILALFLLATRATAQAKTDPSEVRALNTILGRWGKTASAAWNISG-EPCSGAATDTTRF  98

Query  196  APLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
                 NP I CDCS    T CHI +LK+Y LD+VG IP+EL  L  + +LNLAQN L G 
Sbjct  99   DDTSLNPFIKCDCSYNNNTTCHITQLKVYALDVVGPIPEELQNLTYLFNLNLAQNYLTGP  158

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  IG  T M++LS G N L+GPIP E+G L  LI+L   TNN +GPLPPELGNLT+L+
Sbjct  159  LPAFIGNFTAMQYLSVGINALSGPIPKELGKLQNLISLGMGTNNFSGPLPPELGNLTSLQ  218

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            + Y DS+ ++G +P  LSKLK+L++LW S N+FTGK+PEF+G
Sbjct  219  QWYTDSSGVSGELPSTLSKLKSLQILWGSDNSFTGKIPEFIG  260


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP-PEIGQLTKMKWLSF  414
            G++  +  L+  G    G IP     L ++ DL +  +++NGS     IG LT +  L  
Sbjct  260  GSWTDLTTLRFQGNSFEGPIPSSFSNLVKLTDLRIG-DIINGSSSLGFIGNLTSLTNLIL  318

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
              + ++  IP      + L  L  + NN+ G LPP L NL++L  +++ +N L+G +P +
Sbjct  319  RNSKISDTIPSNFEQYTNLQKLDLSFNNITGQLPPSLFNLSSLNYLFLGNNSLSGNLPTQ  378

Query  595  LS-KLKNLRVLWASSNNFTGKLPEFL  669
             S  L N+ +   S N  +G+ P ++
Sbjct  379  KSTSLSNIDL---SYNQLSGQFPSWV  401



>ref|XP_010064059.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=1029

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDK---NASWAPLEANPRIACDC  234
            +Q+  TDP+EV  +N I   W L S+    N+S  EPC     +AS +  + NP I CDC
Sbjct  26   SQNATTDPSEVAILNSIWSTWRLTSQAPTWNISG-EPCSGAAIDASVSFDDYNPFIICDC  84

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    T CHI +LK+Y + + G IP EL+ L  + +LNLAQN+L+GS+ P IG LT+M++
Sbjct  85   SFSSSTTCHITQLKVYAMSVDGPIPDELWNLTYLFNLNLAQNLLSGSLSPSIGNLTRMQY  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS G N L+G +PP++G L+ L++LSF+TNN NG LP ELGNL+ L+++Y+DS+ ++G I
Sbjct  145  LSLGINALSGELPPQLGQLTELLSLSFSTNNFNGSLPSELGNLSKLQQLYMDSSGVSGEI  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL  +WAS NNFTG +PEF+G
Sbjct  205  PSTFSKLKNLNTVWASDNNFTGNIPEFIG  233


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 8/139 (6%)
 Frame = +1

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN---LAQNVLNGSVPPEIGQLTKMKWLS  411
            TF ++  LK   +  V  +   L  ++ M +L    L  N ++ S+P +      +  L 
Sbjct  255  TFSNLTALKDLRISDVSNVSSSLEFIRNMKNLTILVLRNNNISDSLPSDFSGYQSLSQLD  314

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
               N LTG IP  + NLS L  L    N++NG LP +     +L  + +  N L G IP 
Sbjct  315  LSFNKLTGQIPDSLFNLSSLTYLFLGNNSLNGTLPEQKS--ASLRNIDVSYNNLMGSIPS  372

Query  592  ELSKLKNLRVLWASSNNFT  648
             +S    L ++    NNFT
Sbjct  373  WVSNDLQLNLV---GNNFT  388



>ref|XP_002324865.1| hypothetical protein POPTR_0018s01800g [Populus trichocarpa]
 gb|EEF03430.1| hypothetical protein POPTR_0018s01800g [Populus trichocarpa]
Length=608

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 135/217 (62%), Gaps = 9/217 (4%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWA  198
            MG+L F FFV  +   V AQ   TDPNEV A+N++ID+WNLR K+N+++ +PC +NA+WA
Sbjct  1    MGVLSFCFFVFWVSQVVFAQQT-TDPNEVDALNRLIDYWNLRDKLNITN-DPCIQNAAWA  58

Query  199  PLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
              +ANPR+AC+CS   CHI  LKI+ LDI GE+P ELFVLKE+M+L+  +NVLNG++P E
Sbjct  59   KKQANPRVACNCSSNPCHITHLKIHALDISGELPSELFVLKELMNLDFGKNVLNGAIPAE  118

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I +        FG+NN  GP+P  +G L+ L  L  + N   G LP   GNLT L  + +
Sbjct  119  IER-------DFGSNNFIGPLPTSLGKLTSLQELWASDNLFTGKLPAFFGNLTKLRNLRL  171

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
                L GPIP   S LK L  L     N      EFL
Sbjct  172  QGTLLEGPIPSSFSALKKLGDLRIGDLNGEDSSLEFL  208



>ref|XP_010064058.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=1029

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDK---NASWAPLEANPRIACDC  234
            +Q+  TDP+EV  +N I   W L S+    N+S  EPC     +AS +  + NP I CDC
Sbjct  26   SQNATTDPSEVAILNSIWSTWRLTSQAPTWNISG-EPCSGAAIDASISFDDYNPFIICDC  84

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    T CHI +L++Y L + G IP EL+ L  + +LNLAQN+L GS+ P IG LT+M++
Sbjct  85   SFSNSTTCHITQLRVYALSVAGPIPDELWNLTYLSNLNLAQNLLTGSLSPSIGNLTRMQY  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L+ G N L+G +PP++G L+ L++LSF+TNN +G LP ELGNL+ L+++Y+ S+ ++G I
Sbjct  145  LTVGINALSGELPPQLGQLTELLSLSFSTNNFSGALPSELGNLSKLQQLYMGSSGVSGEI  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL+ +WA  NNFTG +PEF+G
Sbjct  205  PSTFSKLKNLQRVWAYDNNFTGNIPEFIG  233



>ref|XP_010065125.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=673

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 139/206 (67%), Gaps = 12/206 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKV---NLSSFEPC-----DKNASWAPLEANPRIACDC---  234
            TDP+EV  +N     W L S+    N+   EPC     D + S+   + NP I CDC   
Sbjct  32   TDPSEVAILNSTWSTWGLTSQAPKWNIGG-EPCSGAAIDDSVSFDDTDYNPFIKCDCYFN  90

Query  235  SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
            + T CHI +LK+Y + + G IP EL+ L  + +LNLA+N+L GS+ P IG LT+M++L+ 
Sbjct  91   NSTTCHITQLKVYAMSVDGPIPDELWNLTYLFNLNLAKNLLTGSLSPSIGNLTRMQYLTV  150

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
            G N L+G +P ++G L+ L++LSF+TNN NG LP ELGNL+ L+++Y+DS+ ++G IP  
Sbjct  151  GINALSGELPTQLGQLTELLSLSFSTNNFNGSLPSELGNLSKLQQLYMDSSGVSGEIPST  210

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
             SKLKNL+ +WAS NNFTG +PEF+G
Sbjct  211  FSKLKNLQKVWASDNNFTGNIPEFIG  236



>ref|XP_004243974.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Solanum lycopersicum]
Length=1027

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +1

Query  37   SFFVLGLLNTVIAQS-NITDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNA--SWAP  201
            +  ++ +    +AQ+   TDP+E   +N +  +W + +  + N+S  E C   A  S + 
Sbjct  14   TLILMYMFEIAVAQTIATTDPSEARILNSMFQNWGISATERWNISG-ELCSGAAIDSTSI  72

Query  202  LEANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP  372
            L+ NP I CDCS    T CHI  L++Y LDI+GEIP+EL+ L  + DLNL QN L G++ 
Sbjct  73   LDFNPSIKCDCSANNTTPCHITGLRVYALDIIGEIPEELWSLTFLDDLNLGQNYLTGTLS  132

Query  373  PEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM  552
            P IG LT+MKWL+FG N L+G IP E+G L+ L +LS  TNN +GPLP ELGNLT L ++
Sbjct  133  PSIGNLTRMKWLTFGVNALSGEIPKELGLLTELQSLSLGTNNFSGPLPSELGNLTKLTQI  192

Query  553  YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            Y++S  ++GPIP   ++L+ L  +W S N FTG++P+F+G
Sbjct  193  YLNSAGVSGPIPLTFARLQELEQVWTSDNAFTGRIPDFIG  232


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (52%), Gaps = 8/139 (6%)
 Frame = +1

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS---FGTNNLT  432
            L+  G    G IP     L  + DL ++ ++ NGS   +   L  MK LS      NN++
Sbjct  241  LRFEGNAFEGTIPASFSNLTTLTDLRIS-DLSNGSSSLDF--LRNMKSLSKLVLRNNNIS  297

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
            G IP  IG    L  L  + NN+ G +P  L NLT+L  +++  N+LTG +P +  K+++
Sbjct  298  GSIPSNIGEYQSLTLLDLSFNNLTGRIPDALFNLTSLTHLFLGDNKLTGALPAQ--KIRS  355

Query  613  LRVLWASSNNFTGKLPEFL  669
            L+ +  S N  +G  P ++
Sbjct  356  LQTIDLSYNELSGNFPSWI  374



>emb|CAD41883.2| OSJNBa0093O08.2 [Oryza sativa Japonica Group]
Length=1028

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 140/221 (63%), Gaps = 12/221 (5%)
 Frame = +1

Query  43   FVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNASWA---  198
            F+L L   V+    +   TDP E  A+N +      ++    NLS  +PC   A+     
Sbjct  13   FLLLLAAAVVQAQRVATKTDPTEAAALNAVFAKLGQQAAASWNLSG-DPCTGAATDGTDF  71

Query  199  PLEANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
              +    I CDCS    T CHI RLKIY  D VG+IP+EL  LK +  LNL+QNVL G +
Sbjct  72   SDQNTTAIKCDCSDQNNTVCHITRLKIYARDAVGQIPEELQNLKHLTHLNLSQNVLAGPI  131

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
            P  IG+LT M++++FG N L+GPIP E+GNL+ LI+L F +NN +G LP ELGNL  LEE
Sbjct  132  PSFIGELTNMQYMTFGINALSGPIPKELGNLTNLISLGFGSNNFSGSLPSELGNLFKLEE  191

Query  550  MYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +YIDS+ L+G +P   + L  +++LWAS NNFTG++P+++G
Sbjct  192  LYIDSSGLSGALPSSFANLTRMKILWASDNNFTGQIPDYIG  232


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 72/178 (40%), Gaps = 51/178 (29%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P EL  L ++ +L +  + L+G++P     LT+MK L    NN TG IP  IG+ + 
Sbjct  177  GSLPSELGNLFKLEELYIDSSGLSGALPSSFANLTRMKILWASDNNFTGQIPDYIGSWN-  235

Query  469  LITLSFATNNMNGPLPPELGNLTTLEEMYIDS----------------------------  564
            L  L    N+  GPLP  L NL  L  + I                              
Sbjct  236  LTDLRLQGNSFQGPLPATLSNLVQLTNLRIGDIASGISSSLAFISSMTSLNTLILRNCMI  295

Query  565  ----------------------NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
                                  N +TGPIP+ L  L +L  L+  +N+ TGKLP  +G
Sbjct  296  SNSLESIDFSKYASLTLLDFSFNNITGPIPQALLNLNSLNYLFLGNNSLTGKLPTSIG  353



>gb|AAV31389.1| putative protein kinase [Oryza sativa Japonica Group]
Length=409

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 131/204 (64%), Gaps = 10/204 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPCD----KNASWAPLEANPRIACDCSG---  240
            TDP EV A+N I+  W L   S+ N+S  EPC      N+ W     +P I CDCS    
Sbjct  38   TDPIEVSALNTIMGRWGLTAPSEWNISG-EPCSGVASDNSDWDNYPKDPAIKCDCSSNDN  96

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CHI +L++  L++VG IP EL  L  + DLNL QN L G++P  IG+   MK+L  G 
Sbjct  97   TICHIIKLRVRKLNVVGRIPAELQNLTFLQDLNLNQNYLTGAIPSFIGKFASMKYLGLGF  156

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G +P E+GNL+ L++L  + +N  G LP ELGNLT LE++YIDS+  +GP P  +S
Sbjct  157  NPLSGQLPKELGNLTNLLSLGISLDNFTGELPEELGNLTKLEQLYIDSSGFSGPFPSTIS  216

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            KLKNL+ L AS N FTGKLP++LG
Sbjct  217  KLKNLKYLKASDNEFTGKLPDYLG  240


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 77/193 (40%), Gaps = 49/193 (25%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G   ++  L I   +  GE+P+EL  L ++  L +  +  +G  P  I +L  +K+L   
Sbjct  168  GNLTNLLSLGISLDNFTGELPEELGNLTKLEQLYIDSSGFSGPFPSTISKLKNLKYLKAS  227

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-----------  564
             N  TG +P  +G+L+ L  L+F  N+  GP+P  L NLT L  + I             
Sbjct  228  DNEFTGKLPDYLGSLTELEDLAFQGNSFEGPIPASLSNLTKLTNLRIGDIVNGSSSLGFI  287

Query  565  --------------------------------------NRLTGPIPEELSKLKNLRVLWA  630
                                                  N +TG +P+ +  L  L+ L+ 
Sbjct  288  SNLTSLTNLVLRNCRISENLETVDFSKFAALTMLDLSFNNITGQVPQSILNLGMLQFLFL  347

Query  631  SSNNFTGKLPEFL  669
             +N+  G LP+ +
Sbjct  348  GNNSLIGTLPDVI  360



>gb|KCW71353.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1010

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 140/209 (67%), Gaps = 10/209 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPC-----DKNASWAPLEANPRIAC  228
            +Q+  TDP+EV  +N I   W L S   K N+S  EPC     D   S+   + NP I C
Sbjct  26   SQNATTDPSEVAILNSIWSTWGLTSPKQKWNISG-EPCSGAAIDDAVSFDNNDYNPFIKC  84

Query  229  DCS-GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            DCS  + CHI +LK+Y L + G IP EL+ L  + +L+L QN+L GS+ P IG LT+M++
Sbjct  85   DCSFNSTCHITQLKVYALSVAGPIPDELWNLTYLSNLDLRQNLLTGSLSPSIGNLTRMQY  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS G N L+G +P ++G L+ L++LSF+TNN +G LP ELGNL+ L+++Y+ S+ ++G I
Sbjct  145  LSLGINALSGELPLQLGQLTELLSLSFSTNNFSGSLPSELGNLSKLQQLYMGSSGVSGEI  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL+ +WA  NNFTG +PEF+G
Sbjct  205  PSTFSKLKNLQRVWAYDNNFTGNIPEFIG  233



>gb|KCW71354.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1027

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 140/209 (67%), Gaps = 10/209 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPC-----DKNASWAPLEANPRIAC  228
            +Q+  TDP+EV  +N I   W L S   K N+S  EPC     D   S+   + NP I C
Sbjct  26   SQNATTDPSEVAILNSIWSTWGLTSPKQKWNISG-EPCSGAAIDDAVSFDNNDYNPFIKC  84

Query  229  DCS-GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            DCS  + CHI +LK+Y L + G IP EL+ L  + +L+L QN+L GS+ P IG LT+M++
Sbjct  85   DCSFNSTCHITQLKVYALSVAGPIPDELWNLTYLSNLDLRQNLLTGSLSPSIGNLTRMQY  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS G N L+G +P ++G L+ L++LSF+TNN +G LP ELGNL+ L+++Y+ S+ ++G I
Sbjct  145  LSLGINALSGELPLQLGQLTELLSLSFSTNNFSGSLPSELGNLSKLQQLYMGSSGVSGEI  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL+ +WA  NNFTG +PEF+G
Sbjct  205  PSTFSKLKNLQRVWAYDNNFTGNIPEFIG  233



>emb|CAJ86314.1| H0525G02.11 [Oryza sativa Indica Group]
Length=938

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 134/204 (66%), Gaps = 10/204 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDH--WNLRSKVNLSSFEPCDKNASWAPL----EANPRIACDCS---G  240
            TDP E  A+N +        +S  NLS  +PC   A+          NP I CDC+    
Sbjct  34   TDPTEAAALNAVFAKLGQQAQSSWNLSG-DPCTGRATDGSAIDDTSFNPAITCDCTFQNS  92

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I +LKIY +D  G+IP+EL  L  + DLNL QN+L+G +P  IG+LT M+ ++FG 
Sbjct  93   TICRITKLKIYAVDASGQIPEELRNLTRLTDLNLGQNLLSGPLPSFIGELTNMQKMTFGI  152

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N+L+GPIP E+GNL+ LI+L   +N+ NG LP ELGNL  L+E+YIDS  L+GP+P  LS
Sbjct  153  NSLSGPIPKELGNLTNLISLGLGSNHFNGSLPTELGNLINLQELYIDSAGLSGPLPSSLS  212

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            KL  +++LWAS NNFTG++P+++G
Sbjct  213  KLTRMQILWASDNNFTGQIPDYIG  236



>ref|XP_003581672.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brachypodium distachyon]
Length=1045

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNASW-APLEANP----RIACDCS---G  240
            TDP E  A+N I+    LR+  + + S  PC   A+   PL+ NP     I CDC+   G
Sbjct  47   TDPTEAAAVNAILGKLGLRAPASWNVSGNPCSGAATDDTPLDDNPNFNPAIKCDCTDRNG  106

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CH+ RLKI  LD  G IP+EL  L  ++ L+  +N L G +P  IG+LT +K+++ GT
Sbjct  107  TLCHVTRLKINSLDAAGPIPEELRNLTHLIKLDFRKNSLTGPLPAFIGELTALKYITVGT  166

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GP+P E+GNL+ L++L+  +NN NG LP ELG LT L+++YIDSN  +GP+P  LS
Sbjct  167  NALSGPVPKELGNLTDLVSLALGSNNFNGSLPDELGKLTKLKQLYIDSNDFSGPLPATLS  226

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            +L NL  LWAS NNFTG++P++LG
Sbjct  227  QLTNLSTLWASDNNFTGQIPDYLG  250



>ref|XP_006853337.1| hypothetical protein AMTR_s00032p00079260 [Amborella trichopoda]
 gb|ERN14804.1| hypothetical protein AMTR_s00032p00079260 [Amborella trichopoda]
Length=957

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 141/219 (64%), Gaps = 10/219 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCD----KNASWAPL  204
            F +  L+ T  AQ+   DP EV+A+  I + W L S V+ + S EPC      N+     
Sbjct  18   FLISFLVCTSEAQT--LDPKEVMALRSISEKWGLSSSVSWNISGEPCSGTAIDNSKIEDP  75

Query  205  EANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDC   +GT CHI  +K+Y L + G IP+E+  L  + +LNLA+N L G +P 
Sbjct  76   NNNPAIKCDCRANNGTTCHIKEMKVYSLSVSGSIPEEIANLSFLTNLNLAENHLTGPLPA  135

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT M++LSF  N L+G IP E+GNL  L++L F++NN +G LPP+LGNL  LE++Y
Sbjct  136  FIGNLTSMQYLSFAANMLSGTIPKELGNLRDLLSLRFSSNNFSGVLPPDLGNLVKLEQIY  195

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS  ++G IP  LSKL+NL+ +WAS N F GK+P+F+G
Sbjct  196  IDSAGVSGEIPSTLSKLQNLKYVWASDNGFPGKIPDFIG  234


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 66/142 (46%), Gaps = 0/142 (0%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + GEIP  L  L+ +  +  + N   G +P  IG  T ++ L   
Sbjct  186  GNLVKLEQIYIDSAGVSGEIPSTLSKLQNLKYVWASDNGFPGKIPDFIGNWTNLQTLKLQ  245

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+  GPIP    NL+ L+ L  +  +        + N+  L  + + +N ++G I  E+
Sbjct  246  GNSFEGPIPSSFANLTSLMDLRISELSNGSSSLDFIKNMKNLTILVLRNNMISGNISSEI  305

Query  598  SKLKNLRVLWASSNNFTGKLPE  663
                 LR L+  +NN +G LP+
Sbjct  306  VDFAQLRHLFLGNNNLSGSLPQ  327



>ref|XP_011097808.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Sesamum indicum]
Length=1111

 Score =   188 bits (477),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 138/216 (64%), Gaps = 10/216 (5%)
 Frame = +1

Query  55   LLNTVIAQSNIT----DPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNASWAPLEAN--  213
            L++T  AQ+  T    DP E  A+N +   W + +  N + S E C   A  A    N  
Sbjct  29   LMDTAGAQNRTTNATTDPVEARALNAMFQRWRIAATSNWNISGELCSGVAIDATEVGNLN  88

Query  214  PRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIG  384
            P I CDCS   G+ CHI  +++Y LD+ G IP EL+ L  M DLNLAQN L G +P  IG
Sbjct  89   PGIKCDCSYDSGSTCHITAMRVYALDVAGPIPDELWNLTYMDDLNLAQNYLTGPIPAAIG  148

Query  385  QLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS  564
             L +M++LSFGTN L+G +P E+G L+ L +LSF TNN +GPLP ELGNLT L ++YI+S
Sbjct  149  TLNRMQYLSFGTNALSGEVPRELGLLTDLRSLSFGTNNFSGPLPSELGNLTRLTQIYINS  208

Query  565  NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
              ++GPIP+  + L++L  +WAS N FTG +P+F+G
Sbjct  209  AGVSGPIPQTFANLRSLERVWASDNEFTGPIPDFIG  244


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 6/149 (4%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G + ++ +L+  G    G IP     L  + DL ++ ++ NGS     +  +T +  
Sbjct  241  DFIGNWANLVQLRFQGNSFQGSIPPSFSSLSLLNDLRIS-DLSNGSSSLNFLRNMTSLAT  299

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++G IP  +     L  L  + NN+   +P  L N + L  +Y+ +NRLTG +
Sbjct  300  LVLRNNNISGSIPSYVSEFRSLFLLDLSFNNLTARIPESLFNHSVLTNLYLGNNRLTGAL  359

Query  586  PEELS-KLKNLRVLWASSNNFTGKLPEFL  669
            P + S  L N+ +   S N  +G  P ++
Sbjct  360  PSQKSPSLGNIDL---SYNELSGSFPSWI  385



>ref|XP_010093040.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB53368.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=1105

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 144/228 (63%), Gaps = 15/228 (7%)
 Frame = +1

Query  34   FSF---FVLGLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKN  186
            F+F   FVL L  ++    N     TDP+EV A+N I D WN+++      ++ +PC   
Sbjct  15   FTFCVAFVLVLTASLTRAQNETQATTDPSEVRALNSIFDQWNIKADTQQWNTTGDPCSGA  74

Query  187  ASWAPL---EANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
            A    +     NP I CDCS    + CHI +LK+Y +D+ G IP+EL+ L  + +LNL Q
Sbjct  75   AIDTAIGFDTYNPFIKCDCSSNNNSLCHITQLKVYSMDVAGPIPEELWNLTFLFNLNLGQ  134

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N L GSV P IG LT M++LS G N L+G +P E+G L+ LI+LSF+ NN +G LP ELG
Sbjct  135  NYLTGSVSPSIGNLTSMQYLSLGINALSGEVPKELGQLTDLISLSFSANNFSGSLPSELG  194

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +L+ L+++YIDS+ ++G IP   + L++L+ LWAS    TG +P+F+G
Sbjct  195  SLSKLQQLYIDSSGVSGEIPSTFANLQSLQTLWASDIALTGIIPDFIG  242


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 76/159 (48%), Gaps = 2/159 (1%)
 Frame = +1

Query  193  WAPLEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP  372
            WA   A   I  D  G + ++N L+  G    G IP     L  + DL L++     S  
Sbjct  227  WASDIALTGIIPDFIGNWSNLNTLRFQGNSFEGPIPSTFANLTSLSDLRLSEVSNVNSSL  286

Query  373  PEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM  552
              I  L  +  L    NN TG IP +IG    L  L  + N +NG +P  L NL++L  +
Sbjct  287  AFIKDLKSLNILVLRNNNFTGSIPSDIGEYQKLSQLDLSFNKLNGRIPDSLFNLSSLSVL  346

Query  553  YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            ++ +N L G +P+E  K K+L  +  S NN  G +P ++
Sbjct  347  FLGNNSLNGSLPQE--KSKSLLTIDVSYNNLVGSIPSWV  383



>ref|XP_010064056.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Eucalyptus grandis]
Length=994

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDKNA--SWAPLEANPRIACDCS---GT  243
            TDP+EV  +N I   W L  +    N+S  EPC   A  S +    NP I CDCS    T
Sbjct  32   TDPSEVAILNSIWSKWGLAQQTTTWNISG-EPCSGAAIDSTSFETYNPFIKCDCSFNNST  90

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             CHI +LK+Y + + G IP EL+ L  + DLNLAQN+  GS+ P IG LT+M++LS G N
Sbjct  91   TCHITQLKVYAMSVAGPIPDELWNLTYLFDLNLAQNLFTGSLSPSIGNLTRMQYLSLGIN  150

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
             L+G +PP++G L+ L++LSF+TNN NG LPPELGNL+ L+++Y+DS+ ++G IP   SK
Sbjct  151  ALSGELPPQLGLLTELLSLSFSTNNFNGSLPPELGNLSKLQQLYMDSSGVSGQIPSTFSK  210

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            LKNL+ +WAS NNFTG +PEF+G
Sbjct  211  LKNLQTVWASDNNFTGNIPEFIG  233



>gb|KCW71208.1| hypothetical protein EUGRSUZ_F04300, partial [Eucalyptus grandis]
Length=435

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 133/208 (64%), Gaps = 12/208 (6%)
 Frame = +1

Query  82   NITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDKNA-----SWAPLEANPRIACDCS  237
            N  D + V  +N I   W L S+    N+S  EPC   A     +      NP I CDCS
Sbjct  77   NCKDASPVAILNSIWSTWGLTSRTPNWNISG-EPCSGVAINDAVTIDDKAYNPFIKCDCS  135

Query  238  ---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
                T CHI +LK+Y + +   IP EL+ L  + +LNL QN+L GS+ P IG LT+M++L
Sbjct  136  FNNSTTCHITQLKVYAMSVASPIPDELWNLTYLSNLNLGQNLLTGSLSPSIGNLTRMQYL  195

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            S G N L+G +P ++G L+ L++LSF+TNN NG LP ELGNL+ L+++Y+DS+ ++G IP
Sbjct  196  SLGINALSGELPLQLGQLTELLSLSFSTNNFNGSLPSELGNLSKLQQLYMDSSGVSGEIP  255

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFLG  672
               SKLKNL+ +WAS NNFTG +P F+G
Sbjct  256  STFSKLKNLQKVWASDNNFTGNIPAFIG  283



>ref|XP_010064055.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Eucalyptus grandis]
Length=1018

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDKNA--SWAPLEANPRIACDCS---GT  243
            TDP+EV  +N I   W L  +    N+S  EPC   A  S +    NP I CDCS    T
Sbjct  32   TDPSEVAILNSIWSKWGLAQQTTTWNISG-EPCSGAAIDSTSFETYNPFIKCDCSFNNST  90

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             CHI +LK+Y + + G IP EL+ L  + DLNLAQN+  GS+ P IG LT+M++LS G N
Sbjct  91   TCHITQLKVYAMSVAGPIPDELWNLTYLFDLNLAQNLFTGSLSPSIGNLTRMQYLSLGIN  150

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
             L+G +PP++G L+ L++LSF+TNN NG LPPELGNL+ L+++Y+DS+ ++G IP   SK
Sbjct  151  ALSGELPPQLGLLTELLSLSFSTNNFNGSLPPELGNLSKLQQLYMDSSGVSGQIPSTFSK  210

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            LKNL+ +WAS NNFTG +PEF+G
Sbjct  211  LKNLQTVWASDNNFTGNIPEFIG  233



>ref|XP_010064054.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1028

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 136/207 (66%), Gaps = 16/207 (8%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNASWAPLEA--------NPRIACDCS-  237
            TDP+EV  +N I   W L  +   + S EPC    S A +++        NP I C CS 
Sbjct  30   TDPSEVAILNSIWSKWGLTPQTTWNISGEPC----SGAAIDSTDFNNNNYNPFIKCSCSF  85

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI +LK+Y + + G IP EL+ L  + +L L QN+L GS+ P IG LT+M++L+
Sbjct  86   NNSTTCHITQLKVYAMSVAGPIPDELWNLTYLFNLKLDQNLLTGSLSPSIGNLTRMQYLT  145

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
             G N L+G +PP++G L+ L++LSF+TNN +G LP ELGNL+ L+++Y+DS+ ++G IP 
Sbjct  146  VGINALSGELPPQLGQLTELLSLSFSTNNFSGSLPSELGNLSKLQQLYMDSSGVSGEIPS  205

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKLKNL  +WAS NNFTG +PEF+G
Sbjct  206  TFSKLKNLNTVWASDNNFTGNIPEFIG  232



>ref|XP_006659917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1020

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 134/205 (65%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDKNA-SWAPLEANP----RIACDCS---  237
            TDP EV A+N I+  W LR+    N+S  EPC   A     ++ NP     I CDCS   
Sbjct  32   TDPTEVAALNTILARWGLRASPAWNISG-EPCSGVAVDGTDVDNNPNINVAIKCDCSFNA  90

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI RLK+Y L+IVG+IP EL  L  + +L+L +N L G +P  IG+ + M++L+  
Sbjct  91   STVCHITRLKVYALNIVGQIPDELQDLTYLDNLDLRKNYLTGPLPSFIGKFSAMQYLAVS  150

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIGNLS L++L  ++ N +G LP ELGNL  LE+MYI S+  +GP P   
Sbjct  151  LNPLSGPLPREIGNLSNLLSLGISSTNFSGELPSELGNLEKLEQMYIVSSGFSGPFPSTF  210

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKLKNLR+LWAS N+FTGK+P++ G
Sbjct  211  SKLKNLRILWASDNDFTGKIPDYFG  235


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/192 (23%), Positives = 70/192 (36%), Gaps = 49/192 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G   ++  L I   +  GE+P EL  L+++  + +  +  +G  P    +L  ++ L   
Sbjct  163  GNLSNLLSLGISSTNFSGELPSELGNLEKLEQMYIVSSGFSGPFPSTFSKLKNLRILWAS  222

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-----------  564
             N+ TG IP   G    L  L F  N+  GP+P  L NLT L  + I             
Sbjct  223  DNDFTGKIPDYFGGFPNLQELRFQGNSFQGPIPASLSNLTRLTTLRIGDIINGSSSLSFI  282

Query  565  --------------------------------------NRLTGPIPEELSKLKNLRVLWA  630
                                                  N +TG +P+ +  L  L  L+ 
Sbjct  283  SNMTSLNVLVLRNCKISDNLEAVNFSNLAGLTLLDLSFNNITGRVPQSILNLNKLGFLFL  342

Query  631  SSNNFTGKLPEF  666
             +N+ +G LP F
Sbjct  343  GNNSLSGSLPYF  354



>ref|XP_010064741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1028

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 137/210 (65%), Gaps = 11/210 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDKNA----SWAPLEANPRIACD  231
            +QS  TDP+EV  +N I   W L S+    N+S  EPC   A    S+     NP I C 
Sbjct  26   SQSATTDPSEVAILNSIWSTWELTSQAPKWNISG-EPCSGAAIDSTSFIDTNYNPFIKCV  84

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            CS    T CHI  LK+  + + G IP +L+ L  ++DLNLAQN L GS+ P IG LT+M+
Sbjct  85   CSFNSSTTCHITGLKVLAMSVAGPIPDQLWKLTYILDLNLAQNFLTGSLSPSIGNLTRMQ  144

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
            +L+ G N L+G +PP++G L+ L++LSF TNN +G LP ELGNL+ L+++Y++S+ ++  
Sbjct  145  YLTVGKNALSGELPPQLGQLTELLSLSFTTNNFSGSLPSELGNLSKLQQLYMESSGVSSE  204

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   SKLKNL+++  S NNFTG +PEF+G
Sbjct  205  IPSTFSKLKNLQIVRVSDNNFTGNIPEFIG  234


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = +1

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN---LAQNVLNGSVPPEIGQLTKMKWLS  411
            TF ++  LK   +  V  +   L  ++ M +L+   L  N ++ S+P +      +  L 
Sbjct  256  TFSNLTSLKDLRISDVSNVSSSLEFIRNMKNLSILILRNNNISDSLPSDFSGYQSLSQLD  315

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
               N LTG IP  + NLS L  L    N++NG LP +     +L  + +  N L G IP 
Sbjct  316  LSFNKLTGQIPDSLFNLSSLTYLFLGNNSLNGTLPEQKS--ASLRNIDVSYNNLMGSIPS  373

Query  592  ELS  600
             +S
Sbjct  374  WVS  376



>ref|XP_008361918.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Malus domestica]
Length=234

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 132/222 (59%), Gaps = 7/222 (3%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            +M IL   F          AQ+  TDP+EV A+N I + W+ + +  +S  EPC   A  
Sbjct  9    LMRILLLCFLSCFWFQLSFAQNATTDPSEVRALNSIFEQWDTQVQWKISG-EPCSGPAI-  66

Query  196  APLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
               + NP IACDC+      CHI +L +Y L+  G  P+E   L+ + DL + +N   G 
Sbjct  67   --NDNNPAIACDCTYDNNATCHITKLSMYALNKRGVFPEEFVALRYLTDLRIDRNYFTGH  124

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  IG ++ +  L+ G N+ +GPIP E+GNL  L+ L+F +NN +G LPPELGNL  LE
Sbjct  125  LPAFIGNMSALTTLTIGVNSFSGPIPKELGNLKKLVLLAFGSNNFSGTLPPELGNLVKLE  184

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++Y+D   L G IP   +KL N++ LWAS + F+GK+P+F+G
Sbjct  185  KLYMDGCGLGGEIPSTFAKLTNMQTLWASDSPFSGKIPDFIG  226



>gb|AFW56974.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=790

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 135/209 (65%), Gaps = 12/209 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPC------DKNASWAPLEANPRIACDC  234
            Q+  TDP E  A++ I+  W L++    + S E C      D +   +P   NP I CDC
Sbjct  34   QTARTDPAEAAALSTILGRWGLKASPGWNISGELCSGVAVDDTDVDNSP-TINPSIKCDC  92

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    T CHI +L++YGL++VG+IP EL  L  + +LNL QN L G VP  IG+   M++
Sbjct  93   SYDDNTVCHITKLRVYGLNVVGQIPAELENLTYLSNLNLMQNYLTGPVPSFIGKF-PMQY  151

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS   N L+G +P E+GNL+ LI+L  + NN  G LPPELGNL+ LE++Y DS+  +GP 
Sbjct  152  LSLAINPLSGTLPKELGNLTDLISLGISLNNFTGELPPELGNLSKLEQIYFDSSGFSGPF  211

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL++LWAS N+FTGK+P+F+G
Sbjct  212  PSTFSKLKNLKILWASDNDFTGKIPDFIG  240



>ref|XP_008361917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Malus domestica]
Length=267

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 133/222 (60%), Gaps = 7/222 (3%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASW  195
            +M IL   F          AQ+  TDP+EV A+N I + W+ + +  +S  EPC   +  
Sbjct  42   LMRILLLCFLSCFWFQLSFAQNATTDPSEVRALNSIFEQWDTQVQWKISG-EPC---SGP  97

Query  196  APLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            A  + NP IACDC+      CHI +L +Y L+  G  P+E   L+ + DL + +N   G 
Sbjct  98   AINDNNPAIACDCTYDNNATCHITKLSMYALNKRGVFPEEFVALRYLTDLRIDRNYFTGH  157

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  IG ++ +  L+ G N+ +GPIP E+GNL  L+ L+F +NN +G LPPELGNL  LE
Sbjct  158  LPAFIGNMSALTTLTIGVNSFSGPIPKELGNLKKLVLLAFGSNNFSGTLPPELGNLVKLE  217

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++Y+D   L G IP   +KL N++ LWAS + F+GK+P+F+G
Sbjct  218  KLYMDGCGLGGEIPSTFAKLTNMQTLWASDSPFSGKIPDFIG  259



>ref|XP_004516049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Cicer arietinum]
Length=1030

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 129/205 (63%), Gaps = 10/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVN-------LSSFEPCDKNASWAPLEANPRIACDCS---  237
            TDP+E  ++N I   W + +          L S    D + +      NP I CDCS   
Sbjct  33   TDPSEARSLNSIFSKWGISADQTQWNKSGELCSGRAIDSSTTIEDTAYNPFIKCDCSYNN  92

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI  LK+Y LD++ EIP+EL+ L  + +L L QN L GS+PP+IG LT+M+++S G
Sbjct  93   KTTCHITALKVYALDVISEIPQELWTLTYLTNLKLGQNYLTGSLPPDIGNLTRMQYMSIG  152

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+G +P ++GNL+ LI LSF +NN +G LP ELG L  LE++Y+DS+ ++GPIP  +
Sbjct  153  INALSGELPKQLGNLTQLIVLSFGSNNFSGTLPSELGKLLKLEQLYMDSSGISGPIPPTI  212

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + LKNL  +WAS    TG +P+F+G
Sbjct  213  ASLKNLVTVWASDTELTGSIPDFIG  237


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 69/140 (49%), Gaps = 0/140 (0%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L +    I G IP  +  LK ++ +  +   L GS+P  IG  +K++ L F 
Sbjct  189  GKLLKLEQLYMDSSGISGPIPPTIASLKNLVTVWASDTELTGSIPDFIGNWSKLQTLRFQ  248

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+  GPIP    NL+ L  L  +  +        + N+ +L  + + +N+++G IP  +
Sbjct  249  GNSFEGPIPSSFSNLTSLTELRISGLSNGSSSLEVIRNMKSLTILELRNNKMSGSIPPNI  308

Query  598  SKLKNLRVLWASSNNFTGKL  657
             + +NL  L  S NN +G +
Sbjct  309  GEFRNLTQLDLSFNNISGHI  328



>ref|XP_007214107.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica]
 gb|EMJ15306.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica]
Length=1053

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 131/204 (64%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA----SWAPLEANPRIACDCS---G  240
            TDP+EV A+N I   W + +      ++ +PC   A    ++   + NP I CDCS    
Sbjct  52   TDPSEVRALNSIFAQWKISANQRQWNTTGDPCSGAAIDSTAFGDEDYNPFIKCDCSFDSN  111

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            + CHI +LK+Y LD+VG IP EL+ L  + DLNLAQN L G +   IG LT M++L+ G 
Sbjct  112  STCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGI  171

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G +P E+GNL+ L T +F  NN +GPLP ELG+LT L+E+Y DS+ ++G IP   +
Sbjct  172  NALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFA  231

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L+NL ++WAS    TG++P+F+G
Sbjct  232  NLQNLEIVWASDTELTGRIPDFIG  255


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 80/164 (49%), Gaps = 10/164 (6%)
 Frame = +1

Query  193  WAP-LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ-NVLNGS  366
            WA   E   RI  D  G +  ++ L+  G    G IP     L  + +L ++  + +NGS
Sbjct  240  WASDTELTGRIP-DFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGS  298

Query  367  VPPEIGQLTKMKWLS---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
                +G +  MK LS      NN++  IP  IG    L  L  + NN+ G +P  L NL+
Sbjct  299  --SSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLS  356

Query  538  TLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +L  +++ +N+L G +PE  SK  +L  +  S NN  G  P ++
Sbjct  357  SLSILFLGNNKLNGTLPE--SKSSSLLNIDLSYNNLLGSFPSWV  398



>ref|XP_006855170.1| hypothetical protein AMTR_s00051p00090280 [Amborella trichopoda]
 gb|ERN16637.1| hypothetical protein AMTR_s00051p00090280 [Amborella trichopoda]
Length=197

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  265  KIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIP  444
            KIY LDI G IP  LF L E+MDLNLAQN+LNGS+PP+ GQL+KM++LS G NN TGP+P
Sbjct  22   KIYALDISGTIPMALFNLTELMDLNLAQNILNGSIPPQFGQLSKMRYLSLGINNFTGPVP  81

Query  445  PEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVL  624
             E+GNL+ LI+LSF++NN++GPLP ELGNLT LE++YIDS+ ++G IP+EL  LK LR+L
Sbjct  82   AELGNLTSLISLSFSSNNLSGPLPKELGNLTPLEQLYIDSSGMSGNIPKELVNLKALRIL  141

Query  625  WASSNNFTGKLPEFLG  672
            WAS N FTG LPEF G
Sbjct  142  WASDNLFTGNLPEFFG  157



>gb|KEH19251.1| LRR receptor-like kinase, putative [Medicago truncatula]
Length=1044

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 144/231 (62%), Gaps = 11/231 (5%)
 Frame = +1

Query  7    TL*VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNL---RSKVNLSSFEPC  177
            +L V  ++ F+ F      T  + +  TDP+E   +N I   W +   +++ N++  + C
Sbjct  9    SLCVFSLINFAHFEQAQAQTQTSNAT-TDPSEARVVNSIFSKWKISANQTQWNVTG-DIC  66

Query  178  DKNASWAPLE---ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               A    ++    NP I CDCS    T C I  LK+Y +D++GEIP EL+ L  + +LN
Sbjct  67   SGGAIDTVIDDNTYNPFIKCDCSFNKNTTCRIIALKVYAIDVIGEIPAELWTLTYLTNLN  126

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QN LNGS+PP +G LT+M+++S G N L+G +P E+G+L+ LI L   TNN +G LP 
Sbjct  127  LGQNYLNGSLPPAVGNLTRMQYMSIGINALSGKLPKELGDLTELIVLGIGTNNFSGSLPS  186

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ELG LT LE++Y+DS+ ++GPIP   + LKNL  LWAS N  TG++P+F+G
Sbjct  187  ELGKLTKLEQLYMDSSGISGPIPPTFASLKNLVTLWASDNELTGRIPDFIG  237


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 70/165 (42%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L +    I G IP     LK ++ L  + N L G +P  IG  TK++ L F 
Sbjct  189  GKLTKLEQLYMDSSGISGPIPPTFASLKNLVTLWASDNELTGRIPDFIGNWTKLQSLRFQ  248

Query  418  TNNLTGPIPPEIGNLSILIT------------------------LSFATNNMNGPLPPEL  525
             N+   PIP  + NL+ L                          L    NN++G +P  +
Sbjct  249  GNSFESPIPSSLSNLTSLTDIKISGLLNGSSSLDVIRNMKSLTILDLRYNNISGSIPSTI  308

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L  + +  N L+G IP  +  L +L  L+  +N F+G LP
Sbjct  309  GEFENLTYLDLSFNSLSGQIPGSIFNLTSLTSLFLGNNTFSGTLP  353


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 6/149 (4%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+  G      IP  L  L  + D+ ++  +LNGS   + I  +  +  
Sbjct  234  DFIGNWTKLQSLRFQGNSFESPIPSSLSNLTSLTDIKIS-GLLNGSSSLDVIRNMKSLTI  292

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++G IP  IG    L  L  + N+++G +P  + NLT+L  +++ +N  +G +
Sbjct  293  LDLRYNNISGSIPSTIGEFENLTYLDLSFNSLSGQIPGSIFNLTSLTSLFLGNNTFSGTL  352

Query  586  -PEELSKLKNLRVLWASSNNFTGKLPEFL  669
             P++ S L N+ +   S N+ +G LP ++
Sbjct  353  PPQKSSSLINIDL---SYNDLSGSLPSWI  378



>ref|XP_006653770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1113

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 128/177 (72%), Gaps = 7/177 (4%)
 Frame = +1

Query  163  SFEPCDKNAS-WAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLK  321
            S +PC   A+   P++A   NP I CDC+    T C + +LKIY +D  G+IP+EL  L 
Sbjct  150  SGDPCTGAATDGTPIDAASFNPAITCDCTFQNNTVCRVTKLKIYAVDASGQIPEELRNLT  209

Query  322  EMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNM  501
             ++DLNL QN+L+G +P  IG+LT M+ ++FG N+L+GPIP EIGNL+ LI+L   +N+ 
Sbjct  210  RLIDLNLGQNLLSGPLPSFIGELTNMQKMTFGINSLSGPIPKEIGNLTNLISLGLGSNHF  269

Query  502  NGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            NG LP ELGNL  L+E+YIDS+ L+GP+P  LSKL  +R+LWAS N+FTG++P+++G
Sbjct  270  NGSLPSELGNLNKLQELYIDSSGLSGPLPSSLSKLTRMRILWASDNDFTGQIPDYIG  326



>ref|XP_007133315.1| hypothetical protein PHAVU_011G169300g [Phaseolus vulgaris]
 gb|ESW05309.1| hypothetical protein PHAVU_011G169300g [Phaseolus vulgaris]
Length=1030

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 144/232 (62%), Gaps = 18/232 (8%)
 Frame = +1

Query  31   GFSFFVLGL--------LNTVIAQSN--ITDPNEVVAINKIIDHWNLRSKVNL--SSFEP  174
            GF+F ++ +        L++  AQS    TDP+E   IN I   W   +  ++   S E 
Sbjct  4    GFAFALVAVFFCHFSCFLSSAQAQSANATTDPSEARTINSIFSKWGKSADTSIWNISGEL  63

Query  175  CDKNA---SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL  336
            C   A   +  P   NP I CDCS   GT C I  L++  L++VGEIP+EL+ L  + +L
Sbjct  64   CSGRAIDSTSTPESYNPFIRCDCSFDDGTTCRITALRVSALNVVGEIPEELWTLTYLNNL  123

Query  337  NLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
            NLAQN L GS+P  IG LT+M++LSFG NNL+G +P E+GNL+ L++LSF++N  +G LP
Sbjct  124  NLAQNYLTGSLPAAIGNLTRMQYLSFGINNLSGELPKELGNLTELLSLSFSSNKFSGSLP  183

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             ELG LT L ++YIDS+ ++GPIP   + L++L  +WAS     G +P+F+G
Sbjct  184  SELGKLTKLTQLYIDSSGISGPIPSSFADLRSLERVWASDTELRGNIPDFIG  235


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 70/147 (48%), Gaps = 2/147 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP     L  + +L ++      S    +  L  +  L
Sbjct  232  DFIGNWTRLQVLRFQGNSFNGSIPSSFSNLTSLTELRISGLSDGNSSLEFVRNLKSLNIL  291

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NN++G IP  IG L  L  L  + NN+ G +P  + NL++L  +++ +N+L G +P
Sbjct  292  ELRNNNISGSIPSSIGELHNLTQLDLSFNNIEGQIPGSIFNLSSLSTLFLGNNKLNGTLP  351

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             +  K  + + +  S N+ +G LP ++
Sbjct  352  TQ--KSSSFQFIDLSYNDLSGSLPSWV  376



>gb|EEC78858.1| hypothetical protein OsI_19210 [Oryza sativa Indica Group]
Length=1023

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 131/204 (64%), Gaps = 10/204 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPCD----KNASWAPLEANPRIACDCSG---  240
            TDP EV A+N I+  W L   S+ N+S  EPC      N+ W     +P I CDCS    
Sbjct  38   TDPIEVSALNTIMGRWGLTAPSEWNISG-EPCSGVASDNSDWDNYPKDPAIKCDCSSNDN  96

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CHI +L++  L++VG IP EL  L  + DLNL QN L G++P  IG+   MK+L  G 
Sbjct  97   TICHIIKLRVRKLNVVGRIPAELQNLTFLQDLNLNQNYLTGAIPSFIGKFASMKYLGLGF  156

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G +P E+GNL+ L++L  + +N  G LP ELGNLT LE++YIDS+  +GP P  +S
Sbjct  157  NPLSGQLPKELGNLTNLLSLGISLDNFTGELPEELGNLTKLEQLYIDSSGFSGPFPSTIS  216

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            KLKNL+ L AS N FTGKLP++LG
Sbjct  217  KLKNLKYLKASDNEFTGKLPDYLG  240


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 72/179 (40%), Gaps = 49/179 (27%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  GE+P+EL  L ++  L +  +  +G  P  I +L  +K+L    N  TG +P  +G+
Sbjct  182  NFTGELPEELGNLTKLEQLYIDSSGFSGPFPSTISKLKNLKYLKASDNEFTGKLPDYLGS  241

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-------------------------  564
            L+ L  L+F  N+  GP+P  L NLT L  + I                           
Sbjct  242  LTELEDLAFQGNSFEGPIPASLSNLTKLTNLRIGDIVNGSSSLGFISNLTSLTNLVLRNC  301

Query  565  ------------------------NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
                                    N +TG +P+ +  L  L+ L+  +N+  G LP+ +
Sbjct  302  RISENLETVDFSKFAALTMLDLSFNNITGQVPQSILNLGMLQFLFLGNNSLIGTLPDVI  360



>emb|CAD41884.2| OSJNBa0093O08.3 [Oryza sativa Japonica Group]
Length=1030

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 133/204 (65%), Gaps = 10/204 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDH--WNLRSKVNLSSFEPCDKNASWAPL----EANPRIACDCS---G  240
            TDP E  A+N +        +S  NLS  +PC   A+          NP I CDC+    
Sbjct  34   TDPTEAAALNAVFAKLGQQAQSSWNLSG-DPCTGRATDGSAIDDTSFNPAITCDCTFQNS  92

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I +LKI+ +D  G IP+EL  L  + DLNL QN+L+G +P  IG+LT M+ ++FG 
Sbjct  93   TICRITKLKIHAVDASGPIPEELRNLTRLTDLNLGQNLLSGPLPSFIGELTNMQKMTFGI  152

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N+L+GPIP E+GNL+ LI+L   +N+ NG LP ELGNL  L+E+YIDS  L+GP+P  LS
Sbjct  153  NSLSGPIPKELGNLTNLISLGLGSNHFNGSLPTELGNLIKLQELYIDSAGLSGPLPSSLS  212

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            KL  +++LWAS NNFTG++P+++G
Sbjct  213  KLTRMQILWASDNNFTGQIPDYIG  236



>ref|XP_010040869.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Eucalyptus grandis]
Length=1072

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 133/198 (67%), Gaps = 12/198 (6%)
 Frame = +1

Query  112  INKIIDHWNLRSKV---NLSSFEPC-----DKNASWAPLEANPRIACDCS---GTFCHIN  258
            +N I   W L S+    N+S  EPC     D + S+     NP I CDCS    T CHI 
Sbjct  3    LNLIWSTWELTSQAPKWNISG-EPCSGAAIDDSVSFDDYSYNPFIKCDCSFKNSTTCHIT  61

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
            +LK+  + + G IP EL+ L  + +L+LAQN L GS+ P IG LT+M++LS G+N L+G 
Sbjct  62   QLKVSAMSVDGPIPDELWNLTYLSNLSLAQNHLTGSLSPSIGNLTRMQYLSLGSNALSGE  121

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            +PP++G L+ L++LSF+TNN NG LP ELGNL+ L+++Y+DS+ ++G IP   SKLKNL 
Sbjct  122  LPPQLGQLTELLSLSFSTNNFNGSLPSELGNLSKLQQLYMDSSGVSGEIPSTFSKLKNLH  181

Query  619  VLWASSNNFTGKLPEFLG  672
             +WAS NNFTG +PEF+G
Sbjct  182  KVWASDNNFTGNIPEFIG  199



>ref|XP_002267129.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Vitis vinifera]
 emb|CBI20015.3| unnamed protein product [Vitis vinifera]
Length=1031

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 137/224 (61%), Gaps = 12/224 (5%)
 Frame = +1

Query  37   SFFVLGLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNA----  189
            S +V+GL +  +AQ+      TDP+EV  +N I   W + +     +S EPC   A    
Sbjct  19   SVYVIGLFHIAVAQTTEANATTDPSEVRVLNSIFQQWGISASNQWNTSGEPCTGAAIDST  78

Query  190  SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
            S    + NP I CDCS    + CHI +LK+Y LD+VG IP EL+ L  + +LNL QN L 
Sbjct  79   SIDSSDYNPGIKCDCSYDNASTCHITQLKVYALDVVGVIPDELWNLTFLTNLNLGQNYLT  138

Query  361  GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            G +   IG LT M++LS G N L+G +P E+G L+ L +L+F TNN +G LP E+GNL  
Sbjct  139  GPLSASIGNLTSMQYLSMGINALSGELPKELGQLTDLRSLAFGTNNFSGSLPSEIGNLVK  198

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            LE++Y DS+ ++G IP   + L++L  +WAS N  TG +P+F+G
Sbjct  199  LEQLYFDSSGVSGEIPSTFANLQSLTTVWASDNELTGNIPDFIG  242



>ref|XP_008662731.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
 ref|XP_008662732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
Length=1029

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 135/209 (65%), Gaps = 12/209 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPC------DKNASWAPLEANPRIACDC  234
            Q+  TDP E  A++ I+  W L++    + S E C      D +   +P   NP I CDC
Sbjct  34   QTARTDPAEAAALSTILGRWGLKASPGWNISGELCSGVAVDDTDVDNSP-TINPSIKCDC  92

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    T CHI +L++YGL++VG+IP EL  L  + +LNL QN L G VP  IG+   M++
Sbjct  93   SYDDNTVCHITKLRVYGLNVVGQIPAELENLTYLSNLNLMQNYLTGPVPSFIGKF-PMQY  151

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS   N L+G +P E+GNL+ LI+L  + NN  G LPPELGNL+ LE++Y DS+  +GP 
Sbjct  152  LSLAINPLSGTLPKELGNLTDLISLGISLNNFTGELPPELGNLSKLEQIYFDSSGFSGPF  211

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL++LWAS N+FTGK+P+F+G
Sbjct  212  PSTFSKLKNLKILWASDNDFTGKIPDFIG  240



>ref|XP_007022387.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13912.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1036

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 138/226 (61%), Gaps = 16/226 (7%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSN---ITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCD------K  183
            F+ L +L    AQ+     TDP EV A+N I   W + ++    N+S  EPC        
Sbjct  22   FYALCILGAAQAQNQSQPTTDPAEVRALNSIFQQWGISARQGQWNISG-EPCSGAALDSD  80

Query  184  NASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNV  354
            +A++   + NP I CDCS    + CHI RLK+Y L++VG IP EL+ L  + +L L QN 
Sbjct  81   SANFESGDYNPIIQCDCSFNSRSTCHITRLKVYALNVVGVIPDELWTLTFLTNLKLGQNY  140

Query  355  LNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNL  534
            L G +   IG LT+M+WL  G N L+G +P EIG L+ L +L+  TNN +GPLP E+GN 
Sbjct  141  LTGPLSASIGNLTRMQWLDLGINALSGELPKEIGLLTDLRSLAIGTNNFSGPLPSEIGNC  200

Query  535  TTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            + LE++Y DS+ +TG IP   + L+NL+ +WAS    TG++P+F+G
Sbjct  201  SMLEQLYFDSSGVTGEIPSTFTNLQNLQTVWASDTELTGRIPDFIG  246


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (42%), Gaps = 25/153 (16%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT-------------  420
            ++ G IP  +    ++ DL    N   G +P     LT +  L                 
Sbjct  236  ELTGRIPDFIGNWSKLRDLRFQGNSFEGPIPSTFSNLTSLTELRISGLSNGSSLSFMKDI  295

Query  421  ----------NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNR  570
                      NN++  IP  IG    L  L  + NN+ G +P  L NL++L  +++ +N+
Sbjct  296  KSLTILDLRNNNISDTIPSTIGEYQSLTQLDLSFNNITGQIPDSLFNLSSLTHLFLGNNK  355

Query  571  LTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            L G +P +  K  +LR +  S NN  G  P ++
Sbjct  356  LNGSLPAQ--KSSSLRNIDVSYNNLAGSFPSWV  386



>ref|XP_009412046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Musa acuminata subsp. malaccensis]
Length=1033

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 129/207 (62%), Gaps = 7/207 (3%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCD----KNASWAPLEANPRIACDCS-  237
            A    TDP EV+A+N I+  W  ++     S EPC      + ++     NP I CDC+ 
Sbjct  25   AAQATTDPTEVLALNTILGRWGKKASSWNISGEPCSGVATDSTTFNDRTYNPLIKCDCTY  84

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
              G  CHI +LK+Y LD+VG IP+EL  L  +  +N  QN L G +P  IG LT ++ LS
Sbjct  85   NNGNTCHITQLKVYALDVVGTIPQELQNLTFLTKINFDQNYLTGPLPAFIGNLTSLQSLS  144

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
             G NNL+GPIP E+G L  L  L   TN  +G +P E GNL  L+E Y+DS+ L+G +PE
Sbjct  145  VGINNLSGPIPKELGKLQNLNLLGMGTNYFSGSVPSEFGNLVNLQEWYMDSSGLSGELPE  204

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LS LKN+++LWAS NNFTG++P+++G
Sbjct  205  NLSNLKNMQILWASDNNFTGRIPDYIG  231


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G + ++  L+  G    G IP  L  L ++ DL +   V   S    I  LT +  L
Sbjct  228  DYIGGWTNLTVLRFQGNSFQGPIPASLSSLTKLTDLRIGDIVNGSSSLAFISNLTSLSSL  287

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                  ++  IP      + L+ L F+ NN+ G +P  L +L++L  +++ +N L G +P
Sbjct  288  VLRNCKISDTIPSNFAKFTNLLKLDFSFNNITGQVPQSLFSLSSLAYLFLGNNSLDGTLP  347

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
            E+ S  L N+ +   S N  +G  P ++
Sbjct  348  EQKSTSLINIDL---SYNQLSGSFPSWV  372



>ref|XP_006653769.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=1021

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 133/203 (66%), Gaps = 8/203 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNAS-WAPLEA---NPRIACDCS---GT  243
            TDP E  A+N +      ++  + + S +PC   A    P+E    NP I CDC+    T
Sbjct  32   TDPTEAAALNAVFAKLEQQAASSWNISGDPCTGAAKDGTPIEDTSFNPAITCDCTFQNNT  91

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             C + +LKI+GLD+ G+IP+EL  L  +  LNL QN+L GS+P  IG+LT M+ ++F  N
Sbjct  92   ICRVTKLKIFGLDVSGQIPQELRNLTRLTYLNLGQNILTGSLPSFIGELTNMQNMTFRIN  151

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
            +L+GPIP E+GNL+ L++L   +N  NG LP ELGNL  L+E+YIDS  L+GP+P   SK
Sbjct  152  SLSGPIPKELGNLTNLVSLGLGSNRFNGSLPSELGNLDKLQELYIDSAGLSGPLPSSFSK  211

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            L  ++ LWAS N+FTG++P+++G
Sbjct  212  LTRMQTLWASDNDFTGQIPDYIG  234



>ref|XP_008226109.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Prunus mume]
Length=1052

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 137/226 (61%), Gaps = 10/226 (4%)
 Frame = +1

Query  25   ILGFSFFVLGLLNTVIAQ-SNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA--  189
            ILGF    +       +Q    TDP+EV A+N I   W + +      ++ +PC   A  
Sbjct  29   ILGFGGIGIAEAQAPTSQPQATTDPSEVRALNSIFAQWKISANQRQWNTTGDPCSGAAID  88

Query  190  --SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNV  354
              ++   + NP I CDCS    + CHI +LK+Y LD+VG IP EL+ L  + DLNLAQN 
Sbjct  89   STAFGNEDYNPFIKCDCSFDSNSTCHITQLKVYSLDVVGVIPDELWTLTFLFDLNLAQNY  148

Query  355  LNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNL  534
            L G +   IG LT M++L+ G N L+G +P E+GNL+ L T +F  NN +GPLP ELG+L
Sbjct  149  LTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSL  208

Query  535  TTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            + L+E+Y DS+ ++G IP   + L+NL  +WAS    TG++P+F+G
Sbjct  209  SKLKEIYFDSSGVSGEIPSTFANLQNLETVWASDTELTGRIPDFIG  254


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 80/164 (49%), Gaps = 10/164 (6%)
 Frame = +1

Query  193  WAP-LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ-NVLNGS  366
            WA   E   RI  D  G +  ++ L+  G    G IP     L  + +L ++  + +NGS
Sbjct  239  WASDTELTGRIP-DFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGS  297

Query  367  VPPEIGQLTKMKWLS---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
                +G +  MK LS      NN++  IP  IG    L  L  + NN+ G +P  L NL+
Sbjct  298  --SSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLS  355

Query  538  TLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +L  +++ +N+L G +PE  SK  +L  +  S NN  G  P ++
Sbjct  356  SLSILFLGNNKLNGTLPE--SKSPSLLNIDLSYNNLLGSFPSWV  397



>ref|XP_004976816.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Setaria italica]
Length=1014

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 134/211 (64%), Gaps = 23/211 (11%)
 Frame = +1

Query  88   TDPNEVVAINKIIDH--------WNLRSKVNLSSFEPCDKNASW-----APLEANPRIAC  228
            TDP E  A+N + D         WN+       S +PC   A+      + +  NP I C
Sbjct  34   TDPTEAAAVNAVFDKLGQTASSAWNI-------SGDPCTGAATDDTNIDSDMNFNPAIQC  86

Query  229  DCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
             CSG   T CHI +LK+Y L++VG IP+EL  L  + +LNL QN L G VP  +G+LT +
Sbjct  87   KCSGQNNTVCHITKLKMYALNLVGPIPEELRNLTHLTNLNLMQNYLTGPVPSFLGELTAL  146

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            +++S   N L+G +P E+G L  LI+L  + NN+NG LPPELGN+  LE++YIDS+ L+G
Sbjct  147  QYMSLAINALSGSVPKELGKLVNLISLGISMNNLNGSLPPELGNMVKLEQLYIDSSGLSG  206

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P+P   SKL ++++LWAS N+FTG++P+++G
Sbjct  207  PLPPSFSKLTSMKILWASDNDFTGQIPDYIG  237



>emb|CAD41800.2| OSJNBa0008M17.16 [Oryza sativa Japonica Group]
Length=1042

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 134/205 (65%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASW-APLEANPR----IACDCSG--  240
            TDP E  A+N ++    L +    N+SS +PC   A+   PL+ NP     I CDCS   
Sbjct  39   TDPTEAAALNAMMARLGLSAPPSWNISS-DPCSGAATDDTPLDDNPAFNPAIKCDCSDHN  97

Query  241  -TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI RLKI  LD+VG IP+EL  L  ++ L+  +N   G +P  IG+LT +K+++ G
Sbjct  98   NTLCHITRLKINTLDVVGPIPEELRNLTHLIKLDFRKNYFTGPLPAFIGELTALKYITVG  157

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP E+GNL+ L++L+  +NN NG LP ELG LT L+++YIDSN  +GP+P  L
Sbjct  158  INALSGPIPKELGNLTNLVSLALGSNNFNGSLPDELGKLTKLQQLYIDSNDFSGPLPTTL  217

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            S+L NL  LWA  NNFTG++P++LG
Sbjct  218  SQLTNLSTLWALDNNFTGQIPDYLG  242


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 76/150 (51%), Gaps = 9/150 (6%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G+  ++ +L++ G    G IP+ L+ L ++  L +   V   S    IG +T +  L
Sbjct  239  DYLGSLTNLTQLRLQGNSFQGPIPRSLYNLVKLRSLRIGDIVNGSSSLAFIGSMTSLGDL  298

Query  409  SFGTNNLTGPIPP----EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLT  576
                + ++  +      + G+L++L  LSF  NN+ G +PP + NL +L  +++ +N L+
Sbjct  299  VLRNSRISDSLASVDFSKFGSLNLL-DLSF--NNITGQIPPSIVNLPSLTFLFLGNNSLS  355

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEF  666
            G +P   S L  L  L  S N+ +G  P +
Sbjct  356  GSLPAMKSPL--LSNLDFSYNHLSGNFPSW  383



>ref|NP_001061225.1| Os08g0203700 [Oryza sativa Japonica Group]
 dbj|BAD02997.1| putative Receptor-like serine/threonine kinase(RFK1) [Oryza sativa 
Japonica Group]
 dbj|BAF23139.1| Os08g0203700 [Oryza sativa Japonica Group]
 dbj|BAG94644.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 132/205 (64%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSK--VNLSSFEPC-----DKNASWAPLEANPRIACDCS---  237
            TDP EV A+N I+  W LR+    N+S  EPC     D+         NP I CDCS   
Sbjct  32   TDPAEVAALNTILGRWGLRASPAWNISG-EPCSGVAIDETGVDNNPNINPAIKCDCSFNA  90

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            GT CHI RL+++ L++VG+IP+EL  L  + +L+L +N L G +P  IG  + M++L+  
Sbjct  91   GTVCHIIRLRVFSLNVVGQIPEELQNLSYLNNLDLRRNYLTGPLPSFIGNFSAMQYLAVS  150

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIGNL  L++L  ++NN  G LP ELGNL  LE+MYI S+  +GP P   
Sbjct  151  LNPLSGPLPKEIGNLRNLLSLGISSNNFTGELPAELGNLEKLEQMYIISSGFSGPFPSTF  210

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKLKNL++LWAS N+ TGK+P++ G
Sbjct  211  SKLKNLKILWASDNDLTGKIPDYFG  235



>ref|XP_002310677.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE91127.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=1036

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 138/230 (60%), Gaps = 14/230 (6%)
 Frame = +1

Query  25   ILGFSFF-VLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKN  186
             L  SF  ++GL     AQ+     TDP+E  A+N I   W++ +  N   +S + C   
Sbjct  10   FLALSFVCIIGLAAIAQAQNQTQATTDPDEARALNSIFQQWSISANTNQWNTSGDVCSGA  69

Query  187  ASWAP-----LEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL  342
            A+ A       + NP I CDC+   GT C I  LK+Y +D++G IP EL+ LK + +LNL
Sbjct  70   ATGASPTIDNTDFNPFIKCDCTFLNGTTCRITALKVYAIDVIGLIPDELWSLKYLTNLNL  129

Query  343  AQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPE  522
             QN L G++ P IG LT+M++L+ G N L+G +P E+G L+ L    F +NN NG LP  
Sbjct  130  GQNYLTGNLSPSIGNLTRMQYLTIGINALSGELPKELGQLTDLRVFGFGSNNFNGSLPSA  189

Query  523  LGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            LGNL  LE++Y DS+ ++G IP   + L+NL  +WAS N  TG++P+F+G
Sbjct  190  LGNLVKLEQIYFDSSGVSGEIPTTFANLQNLATVWASDNELTGRIPDFIG  239


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP     L  + DL ++     GS    I  +  +  L
Sbjct  236  DFIGNWSKLTSLRFEGNAFEGPIPSVFSNLTNLTDLRISDLSDGGSSLEFIKNMKSLSIL  295

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                +N++  IP  IG    L  L  + NN+ G +P  L NL++L  +++ +N+L G +P
Sbjct  296  MLRNDNISASIPSYIGEFQSLTQLDLSFNNIEGQIPDSLFNLSSLTYLFLGNNKLNGTLP  355

Query  589  E-ELSKLKNLRVLWASSNNFTGKLPEFL  669
              + S+L N+ V   S NN  G  P ++
Sbjct  356  ATKSSRLLNVDV---SYNNLAGGFPSWV  380



>ref|XP_009387671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Musa acuminata subsp. malaccensis]
Length=879

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 127/202 (63%), Gaps = 12/202 (6%)
 Frame = +1

Query  97   NEVVAINKIIDHWNLRSKVNLS-----SFEPCDKNA----SWAPLEANPRIACDCS---G  240
            +EV A+N I+  W   +    S     S EPC   A    S+     NP + CDCS    
Sbjct  39   SEVAALNVILGRWGRTASATSSPAWNISGEPCSGAAIDSTSFDSTAFNPAVKCDCSYDNA  98

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CHI +LK+Y LD+VG IP EL  L  + +L+LAQN L G  P  IG LT +++LS GT
Sbjct  99   TTCHITQLKVYALDVVGRIPAELQNLTYLTNLHLAQNYLTGPFPAFIGNLTGLQYLSVGT  158

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G IP E+G L+ L++LS ATNN +GPLP ELGNLT L+++Y+ S   +G  P  +S
Sbjct  159  NALSGGIPKELGKLTNLLSLSIATNNFSGPLPLELGNLTKLQQLYVSSCGASGEFPSTIS  218

Query  601  KLKNLRVLWASSNNFTGKLPEF  666
             LKNL+ LW  +NNFTGK+P+F
Sbjct  219  GLKNLKTLWLINNNFTGKIPDF  240



>ref|XP_010324206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Solanum lycopersicum]
Length=985

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 125/187 (67%), Gaps = 12/187 (6%)
 Frame = +1

Query  127  DHWNLRSKVNLSSFEPCDKNA--SWAPLEANPRIACDCSG---TFCHINRLKIYGLDIVG  291
            + WN+       S E C   A  S + L+ NP I CDCS    T CHI  L++Y LDI+G
Sbjct  11   ERWNI-------SGELCSGAAIDSTSILDFNPSIKCDCSANNTTPCHITGLRVYALDIIG  63

Query  292  EIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSIL  471
            EIP+EL+ L  + DLNL QN L G++ P IG LT+MKWL+FG N L+G IP E+G L+ L
Sbjct  64   EIPEELWSLTFLDDLNLGQNYLTGTLSPSIGNLTRMKWLTFGVNALSGEIPKELGLLTEL  123

Query  472  ITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTG  651
             +LS  TNN +GPLP ELGNLT L ++Y++S  ++GPIP   ++L+ L  +W S N FTG
Sbjct  124  QSLSLGTNNFSGPLPSELGNLTKLTQIYLNSAGVSGPIPLTFARLQELEQVWTSDNAFTG  183

Query  652  KLPEFLG  672
            ++P+F+G
Sbjct  184  RIPDFIG  190


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (52%), Gaps = 8/139 (6%)
 Frame = +1

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS---FGTNNLT  432
            L+  G    G IP     L  + DL ++ ++ NGS   +   L  MK LS      NN++
Sbjct  199  LRFEGNAFEGTIPASFSNLTTLTDLRIS-DLSNGSSSLDF--LRNMKSLSKLVLRNNNIS  255

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
            G IP  IG    L  L  + NN+ G +P  L NLT+L  +++  N+LTG +P +  K+++
Sbjct  256  GSIPSNIGEYQSLTLLDLSFNNLTGRIPDALFNLTSLTHLFLGDNKLTGALPAQ--KIRS  313

Query  613  LRVLWASSNNFTGKLPEFL  669
            L+ +  S N  +G  P ++
Sbjct  314  LQTIDLSYNELSGNFPSWI  332



>emb|CBI20016.3| unnamed protein product [Vitis vinifera]
Length=2193

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 136/231 (59%), Gaps = 18/231 (8%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWA  198
            +  +V+GL +   AQS      TDP+EV  +N I   W + +     +S EPC   A  +
Sbjct  84   YGVYVIGLFHAAAAQSTEANATTDPSEVTILNSIFQQWGISASNEWNTSGEPCTGAALDS  143

Query  199  PLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
                NP I CDCS    + CHI +LK+Y LD+VG IP EL+ L  + +LNL QN L GS+
Sbjct  144  ADIKNPGIKCDCSYDNASTCHITQLKVYALDVVGAIPDELWNLTFLTNLNLGQNYLTGSL  203

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
               IG LT M++LS G N L+G +P E+G L+ L +++F TNN +G LP ELGNL  LE+
Sbjct  204  SASIGNLTSMQYLSLGINALSGELPKELGQLTDLRSIAFGTNNFSGSLPSELGNLVKLEQ  263

Query  550  M----------YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +          Y DS+ L+G IP   + L++L  +WAS N  TG +P+F+G
Sbjct  264  LICCYCLTNQCYFDSSGLSGDIPSTFANLQSLTTVWASDNELTGNIPDFIG  314


 Score =   178 bits (451),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 132/224 (59%), Gaps = 12/224 (5%)
 Frame = +1

Query  37    SFFVLGLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNLSSF-EPCDKNA----  189
             S +V GL +   AQ+      TDP+EV  +N I   W + +     +  EPC   A    
Sbjct  1168  SVYVTGLFHIAAAQTTEANATTDPSEVRVLNSIFRQWGISASSQWRTIGEPCTGAAIDST  1227

Query  190   SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
             S    + N  I CDCS    + CHI +LK+Y LD+VG IP EL+ L  +  LNL QN L 
Sbjct  1228  SIDSADYNFGIKCDCSYDNASTCHITQLKVYALDVVGVIPDELWNLTFLTSLNLGQNYLT  1287

Query  361   GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
             G +   IG LT M++LS G N L+G +P E+G L+ L + +F TNN +G LP E+GNL  
Sbjct  1288  GPLSASIGNLTSMQYLSLGINALSGELPKELGQLTDLRSFAFGTNNFSGSLPSEIGNLVK  1347

Query  541   LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LE++Y DS+ ++G IP   + L++L ++WAS N  TG +P+F+G
Sbjct  1348  LEQLYFDSSGVSGEIPSTFANLQSLTIVWASDNELTGNIPDFIG  1391


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (47%), Gaps = 3/148 (2%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L++ G    G IP     L  + DL ++      S   E I  +  +  
Sbjct  311  DFIGNWSKLTVLRLQGNSFEGSIPSSFSNLTSLTDLRISDISNGSSSSLEFIKDMKSLST  370

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++  IP  IG    L  L  + NN++G LP  L NL+ L  +++ +N+LTG +
Sbjct  371  LIIRNNNISDAIPSNIGEYGSLTQLDLSFNNLSGQLPESLFNLSQLTYLFLGNNQLTGSL  430

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P +  K  +L  +  S N  +G  P ++
Sbjct  431  PSQ--KSTSLLNIDLSYNGLSGSFPSWV  456



>ref|XP_010244460.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Nelumbo nucifera]
Length=1692

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 18/206 (9%)
 Frame = +1

Query  94   PNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPLEA--------NPRIACDCS--  237
            P+ V A+N +   W +++    N+S  EPC    S A L +        NP I CDC+  
Sbjct  696  PDRVSALNSMFRQWEIKAGNSWNISG-EPC----SGAALNSSDIDNTPENPAIRCDCNYK  750

Query  238  -GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
             GT CHI +L++Y L++ G IP EL  L  + +L L QN L G +P  +G L+ M++LSF
Sbjct  751  NGTTCHITKLRVYALNVKGVIPDELASLTYLTNLKLDQNYLTGPMPAFLGNLSAMQYLSF  810

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
              N L+G IP E+G L+ L +L+F +NN +GPLPPE+GNL  LE++YIDS+ ++G IP  
Sbjct  811  RINALSGSIPAELGKLTDLRSLAFGSNNFSGPLPPEIGNLVKLEQIYIDSSGVSGEIPAT  870

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
             +KL N+++LWAS NNFTGKLPEF+G
Sbjct  871  FAKLVNMQILWASDNNFTGKLPEFIG  896


 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  +G L+ M++LSFG N L+G IP E+G L+ L  L+F +NN +GPLPPE+GNL  LE
Sbjct  1    MPAFLGNLSSMQYLSFGINALSGSIPAELGKLTDLRLLAFGSNNFSGPLPPEIGNLVKLE  60

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YIDS+ ++G IP   +KL N+++LWAS NNFTGKLPEF+G
Sbjct  61   QIYIDSSGVSGEIPATFAKLVNMQILWASDNNFTGKLPEFIG  102


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
            + G IP EL  L ++  L    N  +G +PPEIG L K++ +   ++ ++G IP     L
Sbjct  21   LSGSIPAELGKLTDLRLLAFGSNNFSGPLPPEIGNLVKLEQIYIDSSGVSGEIPATFAKL  80

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
              +  L  + NN  G LP  +G+ T L+ +    N   GPIP   S L +L
Sbjct  81   VNMQILWASDNNFTGKLPEFIGDWTKLKTLRFQGNSFEGPIPSSYSNLTSL  131


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + GEIP     L  M  L  + N   G +P  IG  TK+K L F 
Sbjct  54   GNLVKLEQIYIDSSGVSGEIPATFAKLVNMQILWASDNNFTGKLPEFIGDWTKLKTLRFQ  113

Query  418  TNNLTGPIPPEIGNLSILITLSFAT-NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP    NL+ L  L  +  +N N  L   + ++  L  + + +N ++G IP  
Sbjct  114  GNSFEGPIPSSYSNLTSLTDLRISELSNANSTLDF-IKDMKALTVLILRNNMISGTIPSS  172

Query  595  LSKLKNLRVLWASSNNFTGKLP  660
            + +L++L+ L  S NN  G++P
Sbjct  173  IGELQSLQKLDLSFNNLRGEIP  194


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 69/142 (49%), Gaps = 2/142 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + GEIP     L  M  L  + N   G +P  IG  TK+K L F 
Sbjct  848  GNLVKLEQIYIDSSGVSGEIPATFAKLVNMQILWASDNNFTGKLPEFIGNWTKLKTLRFQ  907

Query  418  TNNLTGPIPPEIGNLSILITLSFAT-NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP     L+ L  L  +  +N N  L   + ++  L  + + +N ++G IP  
Sbjct  908  GNSFEGPIPSSYSKLTSLTDLRISELSNANSTLDF-IKDMKALTVLILRNNMISGTIPSS  966

Query  595  LSKLKNLRVLWASSNNFTGKLP  660
            + +L++L+ L  S NN  G++P
Sbjct  967  IGELQSLKTLDLSFNNLRGEIP  988


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            +K +  L L  N+++G++P  IG+L  ++ L    NNL G IP  + NLS L  L    N
Sbjct  152  MKALTVLILRNNMISGTIPSSIGELQSLQKLDLSFNNLRGEIPSSLFNLSSLSYLFLGNN  211

Query  496  NMNGPLPPE-LGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNF  645
            N++G LPP+  GNL +++  Y   N+L+G  P  ++K   L ++   +NNF
Sbjct  212  NLSGSLPPQSSGNLVSIDLSY---NQLSGSFPSWVNKDLQLNLV---ANNF  256



>ref|XP_009771802.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana sylvestris]
Length=1038

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 136/218 (62%), Gaps = 13/218 (6%)
 Frame = +1

Query  55   LLNTVIAQSNITD-----PNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNA--SWAPLE  207
            L+   +AQ N T+     P E  A+N I   W + +  + N+S  E C   A  S    +
Sbjct  30   LVEIAVAQRNTTNVATTNPPEARALNFIFQKWGISATNRWNISG-ELCSGAAIDSTEIQD  88

Query  208  ANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
             NP I CDCS    T CHI  L++Y +++V EIP EL+ L  + DLN+AQN L G++ P 
Sbjct  89   FNPAIKCDCSDNNRTLCHITGLRVYAMNVVSEIPDELWSLNFLNDLNVAQNFLTGTLSPS  148

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I  LT+M+WLS G N L+G +P E+G L+ L +  F TNN +GPLP ELGNLT + ++Y 
Sbjct  149  IANLTRMQWLSIGINALSGELPKELGLLTELKSFGFGTNNFSGPLPSELGNLTKMTQIYF  208

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS  ++GPIP   +KL+NL  +WA+ NN TG++P+F+G
Sbjct  209  DSAGVSGPIPLTFAKLQNLDTVWAADNNLTGRIPDFIG  246


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 77/150 (51%), Gaps = 8/150 (5%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G++  +  L+  G    G IP     L  + DL ++ ++ NGS   +   L  MK L
Sbjct  243  DFIGSWSKLTTLRFQGNSFEGPIPASFSNLTSLTDLRIS-DLSNGSSSLDF--LRNMKSL  299

Query  409  S---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            S      NN++G IPP IG    L  L  + NN++G +P  L NL++L  +++  N+LTG
Sbjct  300  SKLVLRNNNISGSIPPNIGEYQSLSLLDLSFNNLSGRIPDALFNLSSLTHLFLGDNKLTG  359

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
             +P +  K   L+ +  S N  +G LP ++
Sbjct  360  VLPAQ--KSGPLQTIDLSYNGLSGSLPSWI  387



>ref|XP_010065123.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1009

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 133/208 (64%), Gaps = 12/208 (6%)
 Frame = +1

Query  82   NITDPNEVVAINKIIDHWNLRSKV---NLSSFEPCDKNA-----SWAPLEANPRIACDCS  237
            N  D + V  +N I   W L S+    N+S  EPC   A     +      NP I CDCS
Sbjct  4    NCKDASPVAILNSIWSTWGLTSRTPNWNISG-EPCSGVAINDAVTIDDKAYNPFIKCDCS  62

Query  238  ---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
                T CHI +LK+Y + +   IP EL+ L  + +LNL QN+L GS+ P IG LT+M++L
Sbjct  63   FNNSTTCHITQLKVYAMSVASPIPDELWNLTYLSNLNLGQNLLTGSLSPSIGNLTRMQYL  122

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            S G N L+G +P ++G L+ L++LSF+TNN NG LP ELGNL+ L+++Y+DS+ ++G IP
Sbjct  123  SLGINALSGELPLQLGQLTELLSLSFSTNNFNGSLPSELGNLSKLQQLYMDSSGVSGEIP  182

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFLG  672
               SKLKNL+ +WAS NNFTG +P F+G
Sbjct  183  STFSKLKNLQKVWASDNNFTGNIPAFIG  210



>gb|KHM98859.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1034

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 137/219 (63%), Gaps = 14/219 (6%)
 Frame = +1

Query  55   LLNTVIAQSN--ITDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKNASWAPLEA---  210
            L+N   AQS    TDP+E  A+N I   W++ +   + N+SS E C   A  A       
Sbjct  24   LVNVAQAQSANATTDPSEARALNSIFSKWDILANPTQWNISS-ELCSGRAIDATTTIDDT  82

Query  211  --NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDCS    T C I  LK+Y + IVG I +EL+ L  + +LNLAQN L GS+PP
Sbjct  83   TFNPFIKCDCSYDNRTTCRITALKVYAMSIVGTISEELWTLTYLTNLNLAQNYLTGSLPP  142

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT+M++LS G NN +G +P E+GNL+ L +L+F +N   G LP ELG LT LE++Y
Sbjct  143  NIGNLTRMQYLSIGINNFSGELPKELGNLTELRSLAFGSNKFRGSLPSELGKLTNLEQIY  202

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             DS+ ++GPIP   + L+NL+ +WAS    TGK+P+F+G
Sbjct  203  FDSSGISGPIPSTFANLRNLKQVWASDMELTGKIPDFIG  241


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 2/112 (2%)
 Frame = +1

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
            +  L+I GL       + L  +K +  L L  N ++GS+P  IG+L  +K L    NN+T
Sbjct  270  LTELRITGLSNGSSSLEFLRNMKSLTILELRNNNISGSIPSTIGELHNLKQLDLSFNNIT  329

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            G     I NLS+L  L    N  NG LP +    ++L  + +  N L+G +P
Sbjct  330  GQNLGSIFNLSLLTYLFLGNNKFNGTLPMQ--KSSSLVNIDLSYNDLSGSLP  379



>gb|EMT28000.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=925

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  211  NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
            NP I C CS    + C I RLKIY LD VG IP+EL+ L  + +LNLAQN L G +P  I
Sbjct  73   NPAIKCLCSTGNASLCRITRLKIYALDAVGPIPEELWNLTSLTNLNLAQNYLTGPIPSFI  132

Query  382  GQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYID  561
            G L +M++LS G N L+GP+P E+GNL+ L++L   +N  NG LP ELGNL  LE+MYID
Sbjct  133  GNLAQMQYLSLGINALSGPLPKELGNLTNLVSLGIGSNKFNGSLPSELGNLAKLEQMYID  192

Query  562  SNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            S  LTGP+P  LSKL  +++LWAS N+FTG++P+++G
Sbjct  193  SAGLTGPLPASLSKLTKMKILWASDNDFTGQIPDYIG  229



>gb|KDO61746.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=579

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             LK+  L ++  +P ELF+L+++MDLNL QNVLNGS+P EIGQL+ M++LS G NN TG 
Sbjct  5    HLKMRILVLLVTLPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGR  64

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            +P E+GNL+ LI+LSF++NN  GPLP ELG LT+L+++YIDS+ +TG IP+E + LK+LR
Sbjct  65   VPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLR  124

Query  619  VLWASSNNFTGKLPEFLG  672
            +LWAS N FTGK+PEF G
Sbjct  125  ILWASDNLFTGKIPEFFG  142


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP+E   LK +  L  + N+  G +P   G LT++  L   
Sbjct  94   GKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQ  153

Query  418  TNNLTGPIPP-----------EIGNLSI-------------LITLSFATNNMNGPLPPEL  525
               L GPIP             IG+LS              L  LS     ++G +P +L
Sbjct  154  GTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQL  213

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G    L+ + +  N+LTG IP  L  L  L+ L+  +NN +G+LP
Sbjct  214  GTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELP  258



>gb|EEE68220.1| hypothetical protein OsJ_26392 [Oryza sativa Japonica Group]
Length=969

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 131/206 (64%), Gaps = 13/206 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPC------DKNASWAPLEANPRIACDCS--  237
            TDP EV A+N I+  W  +     N++  +PC      D +    P+  NP I CDC+  
Sbjct  46   TDPVEVAALNTILGRWGTKPPKTWNITGGDPCTGTAVDDTDIDNNPI-VNPGIKCDCTFN  104

Query  238  -GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
              T C I +L++Y L++VG+IP EL  L  + +LNL QN L G VP   G+   M++LS 
Sbjct  105  NNTVCRIVKLRVYALNVVGQIPAELEKLTHLANLNLMQNYLTGPVPSFFGKF-PMQYLSL  163

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
              N L+GP+P E+GNL+ LI+L  + NN  G LP ELGNLT LE+MYIDS+  +GP P  
Sbjct  164  AINPLSGPLPKELGNLTNLISLGISLNNFTGNLPEELGNLTKLEQMYIDSSGFSGPFPST  223

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
            +SKLK L++LW S N+FTGK+P+F+G
Sbjct  224  ISKLKKLKILWISDNDFTGKIPDFIG  249


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  G +P+EL  L ++  + +  +  +G  P  I +L K+K L    N+ TG IP  IG+
Sbjct  191  NFTGNLPEELGNLTKLEQMYIDSSGFSGPFPSTISKLKKLKILWISDNDFTGKIPDFIGS  250

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            L+ L  L    N+  GP+P     LT L  + I
Sbjct  251  LTNLEDLRLQGNSFQGPIPASFSKLTKLTSLRI  283



>gb|ABK23413.1| unknown [Picea sitchensis]
Length=315

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 133/202 (66%), Gaps = 8/202 (4%)
 Frame = +1

Query  85   ITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPL---EANPRIACDCS---GTF  246
            +TDP EV A+ +II      +K N S  +PC ++ SW  L   E      C+C+    T 
Sbjct  35   LTDPKEVKAL-RIIASKMGNTKWNFS-VDPCSRDPSWYTLDDREGELGAICNCAFNKNTT  92

Query  247  CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNN  426
            CH+  +KI   ++ G IP E+  L  + +++L  N+L+GS+P  +G LT+M++LSFG NN
Sbjct  93   CHVCEIKILYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTRMQYLSFGINN  152

Query  427  LTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKL  606
            L+G IP E G L+ +I+LS   N+++G +PPELGNLT LE++YI SN+ +G IP   S L
Sbjct  153  LSGEIPKEFGKLTNMISLSLDQNDLSGMIPPELGNLTNLEKLYIRSNQFSGEIPTTFSNL  212

Query  607  KNLRVLWASSNNFTGKLPEFLG  672
            K +R+ WASSNNFTGK+P+F+G
Sbjct  213  KKMRLFWASSNNFTGKIPDFIG  234



>ref|XP_010942352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Elaeis guineensis]
Length=1043

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 133/221 (60%), Gaps = 10/221 (5%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLS---SFEPCDKNA----S  192
             SF  L L          TD +EV A+N I+  W  ++  + +   S EPC   A     
Sbjct  18   LSFLCLFLHVGRSGARATTDSSEVEALNAILGSWGKKATTSPAWNISGEPCSGAAIDSTD  77

Query  193  WAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
            +     NP I CDCS   GT CHI +L++Y LD+ G IP+EL  L  + DL+L+QN L G
Sbjct  78   FKNPNFNPAIKCDCSYNNGTTCHITQLRVYALDVEGTIPEELQNLTYLKDLDLSQNYLTG  137

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
             +P  IG LT++++ + GTN L+G IP E+G L  LI+L    NN +G LP ELGNL+ L
Sbjct  138  PLPAFIGNLTELQYFTVGTNALSGTIPKELGKLQKLISLGVGANNFSGSLPSELGNLSNL  197

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEF  666
            +++Y+DS  + G  P  +S LKNL+ LWAS NNFTGK+P+F
Sbjct  198  QQLYVDSCGVGGEFPSTVSSLKNLQTLWASDNNFTGKIPDF  238


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 2/140 (1%)
 Frame = +1

Query  250  HINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNL  429
            ++  L++ G    G IP     L  + DL L       S    I  LT +  L    + +
Sbjct  242  NLTTLRMQGNSFEGPIPSSFSSLTSLTDLRLGDISNGSSTLAFISNLTSLSKLVLRNSRI  301

Query  430  TGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLK  609
            +  IPP+    + L  L  + NN+ G LP  L NL++L  +++ +N L+G +P   SK  
Sbjct  302  SDAIPPDFSLYTNLQILDLSFNNLTGQLPQSLFNLSSLSYLFLGNNSLSGSLPT--SKSN  359

Query  610  NLRVLWASSNNFTGKLPEFL  669
            +L  +  S N  +G  P ++
Sbjct  360  SLLNIDVSYNQLSGSFPSWV  379



>ref|XP_006653768.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=990

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 121/178 (68%), Gaps = 8/178 (4%)
 Frame = +1

Query  163  SFEPCDKNASW-APLEANPR----IACDCS---GTFCHINRLKIYGLDIVGEIPKELFVL  318
            S EPC   A+   PL+ NP     I CDCS    T CHI RLKI  LD+VG IP+EL  L
Sbjct  15   SGEPCSGAATDDTPLDDNPAFNPAIKCDCSHLNNTLCHITRLKINTLDVVGPIPEELRNL  74

Query  319  KEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNN  498
              ++ L+  +N   G +P  IG+LT +K+++ G N L+GPIP E+GNL+ L++L+  +NN
Sbjct  75   THLVKLDFRKNYFTGPLPAFIGELTSLKYITVGINALSGPIPKELGNLTNLVSLALGSNN  134

Query  499  MNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             NG LP ELG LT L+++YIDSN  +GP+P  LS+L NL  LWAS NNFTGK+P++LG
Sbjct  135  FNGSLPDELGKLTKLQQLYIDSNDFSGPLPATLSQLANLSTLWASDNNFTGKIPDYLG  192



>emb|CAJ86313.1| H0525G02.10 [Oryza sativa Indica Group]
Length=917

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 131/205 (64%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPCDKNAS-WAPLEANP----RIACDCS---  237
            TDP E  A+N +      +  S  NLS  +PC   A+   P++ NP     I CDC+   
Sbjct  31   TDPTEAAALNAVFAKLGQQAASTWNLSG-DPCTGAATDGTPIDDNPNFNPAIKCDCTFQN  89

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I +LKIY LD+ G IP+EL  L  +  LNL QN+L G +P  IG+LT M+ ++F 
Sbjct  90   NTICRITKLKIYALDVPGTIPQELRNLTRLTHLNLGQNILTGPLPSFIGELTNMQNMTFR  149

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+L+GPIP E+GNL+ L++L   +N  NG LP ELGNL  L+E+YIDS  L+GP+P   
Sbjct  150  INSLSGPIPKELGNLTNLVSLGLGSNRFNGSLPSELGNLDKLQELYIDSAGLSGPLPSSF  209

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKL  ++ LWAS N+FTG++P+++G
Sbjct  210  SKLTRMQTLWASDNDFTGQIPDYIG  234



>gb|KDO61621.1| hypothetical protein CISIN_1g001658mg [Citrus sinensis]
Length=1036

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 139/232 (60%), Gaps = 16/232 (7%)
 Frame = +1

Query  25   ILGFSF-FVLGLLNTVIAQSN-----ITDPNEVVAINKIIDHWNLRSKVNL--SSFEPC-  177
            + GF+  FV   ++  + Q+       TDPNEV A+N I   W + ++      S +PC 
Sbjct  9    VSGFALCFVCLFVHFCLCQAQNRTQATTDPNEVRALNSIFQQWRISARQGQWNRSGDPCT  68

Query  178  ----DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL  336
                D +  +   + NP I CDCS   GT CHI +LK+Y L++VG IP EL+ L  + +L
Sbjct  69   GAALDDSIVFDNTDYNPFIKCDCSSQNGTVCHITQLKVYALNVVGVIPDELWNLTSLFNL  128

Query  337  NLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
            NL QN L G + P +G LT M++L+   N L+G +P E+G L+ L+ L   TNN +GPLP
Sbjct  129  NLGQNYLTGPLSPSVGNLTAMQYLNLAINALSGELPKELGQLTELLILGIGTNNFSGPLP  188

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             ELG+L+ L+E+YIDS  ++G IP   + L++L   WAS    TG++P+F+G
Sbjct  189  SELGSLSKLQELYIDSAGVSGEIPSSFANLQSLTKWWASDTRLTGRIPDFIG  240


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP-PEIGQLTKMKW  405
            D  G +  +  L+  G    G IP     L  + +L ++ ++ NGS     I  +  +  
Sbjct  237  DFIGNWSKLTALRFQGNSFNGPIPSSFSNLTSVTELRIS-DLSNGSSKLAFIRDMKSLSI  295

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++  IP  IG    L  L  + NN+ G +P  L NL++L  +++ +N+L G +
Sbjct  296  LELRNNNISDSIPSNIGEYRSLQHLDLSFNNLGGSIPDSLFNLSSLTHLFLGNNKLNGTL  355

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P   S L  L  +  S NN  G LP ++
Sbjct  356  PARKSPL--LLNIDVSYNNLQGNLPSWI  381



>gb|EAY95562.1| hypothetical protein OsI_17410 [Oryza sativa Indica Group]
Length=917

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 131/205 (64%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPCDKNAS-WAPLEANP----RIACDCS---  237
            TDP E  A+N +      +  S  NLS  +PC   A+   P++ NP     I CDC+   
Sbjct  31   TDPTEAAALNAVFAKLGQQAASTWNLSG-DPCTGAATDGTPIDDNPNFNPAIKCDCTFQN  89

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I +LKIY LD+ G IP+EL  L  +  LNL QN+L G +P  IG+LT M+ ++F 
Sbjct  90   NTICRITKLKIYALDVPGTIPQELRNLTRLTHLNLGQNILTGPLPSFIGELTNMQNMTFR  149

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+L+GPIP E+GNL+ L++L   +N  NG LP ELGNL  L+E+YIDS  L+GP+P   
Sbjct  150  INSLSGPIPKELGNLTNLVSLGLGSNRFNGSLPSELGNLDKLQELYIDSAGLSGPLPSSF  209

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKL  ++ LWAS N+FTG++P+++G
Sbjct  210  SKLTRMQTLWASDNDFTGQIPDYIG  234



>gb|AHG54199.1| LRR receptor-like protein kinase 1 [Triticum aestivum]
Length=1014

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 135/213 (63%), Gaps = 27/213 (13%)
 Frame = +1

Query  88   TDPNEVVAIN--------KIIDHWNLRSKVNLSSFEPCDKNASW-------APLEANPRI  222
            TDP +  A+N        K +  WN+       S +PC   A+         P   NP I
Sbjct  27   TDPGDAAALNAVFAKLGQKALSSWNI-------SGDPCTGAATDNTNIDNNPPF--NPAI  77

Query  223  ACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLT  393
             C+C+G   + C + RLKIY LD VG IP+EL  L  + +L+L+QN L G +P  IG+LT
Sbjct  78   KCECTGGNASVCRVTRLKIYALDAVGPIPEELRNLTALTNLDLSQNYLTGPLPSFIGELT  137

Query  394  KMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRL  573
            +M+++SFG N L+GP+P E+ NL+ L++LS ++NN +G LP ELG+L  LE++YIDS   
Sbjct  138  RMQYMSFGINALSGPLPKELRNLTDLVSLSVSSNNFSGSLPSELGDLAKLEQLYIDSAGF  197

Query  574  TGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +GP+P  LSKL  ++ LWAS N+FTG++P+++G
Sbjct  198  SGPLPSSLSKLTKMKTLWASDNDFTGQIPDYIG  230



>gb|KJB14002.1| hypothetical protein B456_002G105800 [Gossypium raimondii]
Length=1031

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 131/210 (62%), Gaps = 19/210 (9%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNASWAPLEA----------NPRIACD  231
            TDP EV A+N I + W + ++ +   ++ +PC    S A L++          NP I CD
Sbjct  37   TDPAEVRALNSIFEDWGITARQDQWNTTGDPC----SGAALDSDSTDIDNVAYNPFIKCD  92

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            CS   G+ CHI RLK+Y L++VG IP EL+ L  + +L L QN L G +   IG LT+M+
Sbjct  93   CSFSNGSTCHITRLKVYALNVVGVIPDELWTLTFLTNLRLGQNYLTGPLSTSIGNLTRMQ  152

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
            WL  G N L+G +P EIG L+ L + +F TNN +GPLP ELGN + L+++Y DS+ ++G 
Sbjct  153  WLDIGINALSGELPKEIGLLTDLQSFAFGTNNFSGPLPSELGNCSMLQQLYFDSSGVSGE  212

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   + L+NL  +WAS    TG++P+F+G
Sbjct  213  IPSTFANLQNLETVWASDTELTGRIPDFIG  242


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 71/147 (48%), Gaps = 3/147 (2%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP     L  + +L ++  + NGS    I  +  +  L
Sbjct  239  DFIGNWSKLTVLRFQGNSFEGPIPSTFANLTSLTELRIS-GLSNGSSLAFIKDMKSLGVL  297

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NN++G IP  +G    L  L  + NN+ G +P  L NL++L  +++ +N+L G +P
Sbjct  298  DLRNNNISGTIPSSMGEYQSLTQLDLSFNNITGQIPDSLFNLSSLTHLFLGNNKLNGTLP  357

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             E  K  +LR +  S NN  G  P ++
Sbjct  358  AE--KSSSLRNIDVSYNNLAGNFPSWI  382



>ref|XP_006654185.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Oryza brachyantha]
Length=808

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 121/192 (63%), Gaps = 14/192 (7%)
 Frame = +1

Query  118  KIIDHWNLRSKVNLSSFEPCDKNAS----WAPLEANPRIACDCS---GTFCHINRLKIYG  276
            K    WN+       S EPC   AS    W     NP I CDCS    T CHI +L++Y 
Sbjct  7    KASSEWNI-------SGEPCSGVASDVSDWDNYPKNPAIKCDCSFNNNTICHIIKLRVYE  59

Query  277  LDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIG  456
            L+IVG+IP EL  L  + DLNL  N L G++P  IG+ T MK+L  G N L+G +P E+G
Sbjct  60   LNIVGQIPAELQNLTYLQDLNLNHNYLTGAIPSFIGKFTFMKYLGLGFNPLSGQLPKELG  119

Query  457  NLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASS  636
            NL+ L++L  + NN  G LP ELGNLT LE++YIDS+  +GP P  +SKLKNL+ L AS 
Sbjct  120  NLTNLLSLGISLNNFTGELPEELGNLTKLEQLYIDSSGFSGPFPSMISKLKNLKFLKASD  179

Query  637  NNFTGKLPEFLG  672
            N FTGKLP++LG
Sbjct  180  NEFTGKLPDYLG  191



>gb|EEC78009.1| hypothetical protein OsI_17412 [Oryza sativa Indica Group]
Length=719

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 132/207 (64%), Gaps = 8/207 (4%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAP----LEANPRIACDCSG  240
            A +  TD  E  A+  + +  + +++ N +  +PC   A+ +        NP I CDCS 
Sbjct  19   APTATTDRIEAEALKAVFEKLDQKAEWNTTG-DPCSGAATDSTDINDSSINPAIKCDCSD  77

Query  241  ---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI  LKIY  D  G+IP EL  L  +  LNL+ N L G++P  IG+L  M++++
Sbjct  78   QNNTVCHITGLKIYDKDATGQIPGELRNLTHLTHLNLSHNFLVGTIPSFIGELAAMQYMT  137

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            FG N L+G IP E+GNL+ L++L F++NN +G LP ELG+L  LEE+YIDS  L+G +P 
Sbjct  138  FGINALSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFKLEELYIDSAGLSGELPS  197

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LSKL  +++LWAS NNFTG++P+++G
Sbjct  198  SLSKLTRMKILWASDNNFTGQIPDYIG  224



>ref|XP_006448775.1| hypothetical protein CICLE_v10014117mg [Citrus clementina]
 gb|ESR62015.1| hypothetical protein CICLE_v10014117mg [Citrus clementina]
Length=1046

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 137/222 (62%), Gaps = 12/222 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDK---NASWAPL  204
            F ++ L N     +  TDP EV A+N I+  W+  +    N+S   PC     NA+ +  
Sbjct  24   FLLICLSNAQHNTNATTDPAEVRALNSILQQWDAPAAPLWNISG-NPCSGSALNATDSEF  82

Query  205  EA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            E+   NP I C+C+   G  CHI +L++YGL+  G IP+EL  L+ +  L + QN   G 
Sbjct  83   ESPNNNPAIVCNCTFDNGATCHITKLRVYGLNKKGVIPEELVTLQYLTVLKIDQNFFTGP  142

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  IG L+++ +LSF  N+ +GP+P E+GNL  L  L+F TNN +G LPPELGNL  LE
Sbjct  143  LPSFIGNLSRLMFLSFSHNDFSGPVPRELGNLKELTVLAFGTNNFSGALPPELGNLAKLE  202

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YIDS    G IP   +KL+N++ LWAS N FTGK+P+F+G
Sbjct  203  QLYIDSCGAGGEIPSTFAKLRNMQTLWASDNPFTGKIPDFIG  244


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 72/145 (50%), Gaps = 2/145 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I      GEIP     L+ M  L  + N   G +P  IG  TK+K L F 
Sbjct  196  GNLAKLEQLYIDSCGAGGEIPSTFAKLRNMQTLWASDNPFTGKIPDFIGNWTKLKSLRFQ  255

Query  418  TNNLTGPIPPEIGNLSILITLSFAT-NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP  +  L+ L +L      N++  L   + +L  L ++ + +  +TG IP  
Sbjct  256  GNSFQGPIPSSLSKLASLESLQMGDIYNVSSSLDFVM-SLKNLNDLSLRNALITGTIPSG  314

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
            + +L+ L++L  S NN TG++P  L
Sbjct  315  IGELQMLQILDLSFNNLTGQIPATL  339



>emb|CAD41882.2| OSJNBa0093O08.1 [Oryza sativa Japonica Group]
Length=1025

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 132/207 (64%), Gaps = 12/207 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNAS-WAPLEANP----RIACDCS-  237
            TDP E  A+N +      ++ ++ +++    +PC   A+   P++ NP     I CDC+ 
Sbjct  32   TDPTEAAALNAVFAKLGQQASLSTATWNISGDPCTGAATDGTPIDDNPNFNPAIKCDCTF  91

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T C I +LKIY LD+ G IP+EL  L  +  LNL QN L G +P  IG+LT M+ ++
Sbjct  92   QNNTVCRITKLKIYALDVPGTIPQELRNLTRLTHLNLGQNTLTGPLPSFIGELTNMQNMT  151

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            F  N+L+GPIP E+GNL+ L++L   +N  NG LP ELGNL  L+E+YIDS  L+GP+P 
Sbjct  152  FRINSLSGPIPKELGNLTNLVSLGLGSNRFNGSLPSELGNLDKLQELYIDSAGLSGPLPS  211

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKL  ++ LWAS N+FTG++P+++G
Sbjct  212  SFSKLTRMQTLWASDNDFTGQIPDYIG  238



>ref|XP_006659922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=1022

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 129/203 (64%), Gaps = 21/203 (10%)
 Frame = +1

Query  109  AINKIIDHWNLRSK--VNLSSFEPC----------DKNASWAPLEANPRIACDCS---GT  243
            A+N I+  W LR+    N+S  EPC          D N S      NP I CDCS    T
Sbjct  9    ALNTILGRWGLRASPAWNISG-EPCSGVAIDGTSVDNNPS-----INPAIKCDCSYNAST  62

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             CHI RLK+Y L++VG+IP+EL  L  + +L+L QN L GS+P  IG  + M++L+   N
Sbjct  63   VCHIVRLKVYSLNVVGQIPEELQNLTYLNNLDLRQNYLTGSLPSFIGNFSAMQYLAVSLN  122

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
             L+GP+P EIG+L  L++L  ++NN  G LP ELGNL  LE+MYI S+  +GP P   SK
Sbjct  123  PLSGPLPKEIGSLRNLLSLGISSNNFTGELPAELGNLEKLEQMYIISSGFSGPFPSTFSK  182

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            LKNLR+LWAS N+FTGK+P++ G
Sbjct  183  LKNLRILWASDNDFTGKIPDYFG  205



>emb|CAJ86312.1| H0525G02.9 [Oryza sativa Indica Group]
Length=954

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 132/205 (64%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASW-APLEANPR----IACDCSG--  240
            TDP E  A+N ++    L +    N+S  +PC   A+   PL+ NP     I CDCS   
Sbjct  39   TDPTEAAALNAMMARLGLSAPPSWNISG-DPCSGAATDDTPLDDNPAFNPAIKCDCSDHN  97

Query  241  -TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI RLKI  LD+VG IP+EL  L  ++ L+  +N   G +P  I +LT +K+++ G
Sbjct  98   NTLCHITRLKINTLDVVGPIPEELRNLTHLIKLDFRKNYFTGPLPAFIEELTALKYITVG  157

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP E+GNL+ L++L+  +NN NG LP ELG LT L+++YIDSN  +GP+P  L
Sbjct  158  INALSGPIPKELGNLTNLVSLALGSNNFNGSLPDELGKLTKLQQLYIDSNDFSGPLPTTL  217

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            S+L NL  LWA  NNFTG++P++LG
Sbjct  218  SQLTNLSTLWALDNNFTGQIPDYLG  242



>ref|XP_009608510.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana tomentosiformis]
Length=1037

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 8/200 (4%)
 Frame = +1

Query  94   PNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNA--SWAPLEANPRIACDCSG---TFCH  252
            P E  A+N I   W + +  + N+S  E C   A  S      NP I CDCS    T CH
Sbjct  48   PPEARALNSIFQKWGISATNQWNISG-ELCSGAAIDSTEIQNFNPAIKCDCSDNNRTLCH  106

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
            I  L++Y +D+V EIP EL+ L  + DLN+AQN L G++ P I  LT+M+WLS G N L+
Sbjct  107  ITGLRVYAMDVVSEIPDELWSLTFLNDLNVAQNFLTGTLSPSIANLTRMQWLSIGINALS  166

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
            G +P E+G L+ L +  F TNN +GPLP ELGNLT + ++Y DS  ++GPIP   +KL+N
Sbjct  167  GELPKELGLLTELKSFGFGTNNFSGPLPSELGNLTKMTQIYFDSAGVSGPIPLTFAKLQN  226

Query  613  LRVLWASSNNFTGKLPEFLG  672
            L  +WA+ N+ TG++P+F+G
Sbjct  227  LDTVWAADNDLTGRIPDFMG  246


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (51%), Gaps = 8/150 (5%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G++  +  L+  G    G IP     L  + DL ++ ++ NGS   +   L  MK L
Sbjct  243  DFMGSWSKLTTLRFQGNSFEGPIPASFSNLTSLTDLRIS-DLSNGSSSLDF--LRNMKSL  299

Query  409  S---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            S      NN++G IPP IG    L  L  + NN++G +P  L NL++L  +++  N+LTG
Sbjct  300  SKLVLRNNNISGSIPPNIGEYQSLSLLDLSFNNLSGRIPDALFNLSSLTHLFLGDNKLTG  359

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
             +P +  K   L+ +  S N  +G  P ++
Sbjct  360  VLPAQ--KSGPLQTIDLSYNGLSGSFPSWI  387



>emb|CAN83900.1| hypothetical protein VITISV_034202 [Vitis vinifera]
Length=946

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 136/245 (56%), Gaps = 32/245 (13%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWA  198
            +  +V+GL +   AQS      TDP+EV  +N I   W + +     +S EPC   A  +
Sbjct  18   YGVYVIGLFHAAAAQSTEANATTDPSEVTILNSIFQQWGISASNEWNTSGEPCTGAALDS  77

Query  199  PLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
                NP I CDCS    + CHI +LK+Y LD+VG IP EL+ L  + +LNL QN L GS+
Sbjct  78   SDIENPGIKCDCSYDNASTCHITQLKVYALDVVGAIPDELWNLTFLTNLNLGQNYLTGSL  137

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
               IG LT M++LS G N L+G +P E+G L+ L +++F TNN +G LP ELGNL  LE+
Sbjct  138  SASIGNLTSMQYLSLGINALSGELPKELGQLTDLRSIAFGTNNFSGSLPSELGNLVKLEQ  197

Query  550  M------------------------YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKL  657
            +                        Y DS+ L+G IP   + L++L  +WAS N  TG +
Sbjct  198  LCMGDRSCRDIEVYIGFQTSEIKTSYFDSSGLSGEIPSTFANLQSLTTVWASDNELTGNI  257

Query  658  PEFLG  672
            P+F+G
Sbjct  258  PDFIG  262



>gb|AHG54200.1| LRR receptor-like protein kinase 2 [Triticum aestivum]
Length=1014

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 132/206 (64%), Gaps = 13/206 (6%)
 Frame = +1

Query  88   TDPNEVVAIN--------KIIDHWNLRSKVNLSSFEPCDKNASWAPLEANPRIACDCSG-  240
            TDP +  A+N        K +  WN+   +   +        +  P   NP I C+CSG 
Sbjct  27   TDPGDAAALNAVFAKLGQKALSSWNISGDLCTGAATDNTNIDNNPPF--NPAIKCECSGG  84

Query  241  --TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
              + C + RLKIY LD VG IP+EL  L  + +L+L+QN L G +P  IG+LT+M+++SF
Sbjct  85   NASVCRVTRLKIYALDAVGPIPEELRNLTALTNLDLSQNYLTGPLPSFIGELTRMQYMSF  144

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
            G N L+GP+P E+ NL+ L++LS ++NN +G LP ELG+L  LE++YIDS   +GP+P  
Sbjct  145  GINALSGPLPKELRNLTDLVSLSVSSNNFSGSLPSELGDLAKLEQLYIDSAGFSGPLPSS  204

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
            LSKL  ++ LWAS N+FTG++P+++G
Sbjct  205  LSKLTKMKTLWASDNDFTGQIPDYIG  230



>gb|EEE61686.1| hypothetical protein OsJ_16159 [Oryza sativa Japonica Group]
Length=1001

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 132/207 (64%), Gaps = 12/207 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNAS-WAPLEANPR----IACDCS-  237
            TDP E  A+N +      ++ ++ +++    +PC   A+   P++ NP     I CDC+ 
Sbjct  32   TDPTEAAALNAVFAKLGQQASLSTATWNISGDPCTGAATDGTPIDDNPNFNPAIKCDCTF  91

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T C I +LKIY LD+ G IP+EL  L  +  LNL QN L G +P  IG+LT M+ ++
Sbjct  92   QNNTVCRITKLKIYALDVPGTIPQELRNLTRLTHLNLGQNTLTGPLPSFIGELTNMQNMT  151

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            F  N+L+GPIP E+GNL+ L++L   +N  NG LP ELGNL  L+E+YIDS  L+GP+P 
Sbjct  152  FRINSLSGPIPKELGNLTNLVSLGLGSNRFNGSLPSELGNLDKLQELYIDSAGLSGPLPS  211

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKL  ++ LWAS N+FTG++P+++G
Sbjct  212  SFSKLTRMQTLWASDNDFTGQIPDYIG  238



>ref|XP_006654184.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Oryza brachyantha]
Length=957

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 121/192 (63%), Gaps = 14/192 (7%)
 Frame = +1

Query  118  KIIDHWNLRSKVNLSSFEPCDKNAS----WAPLEANPRIACDCS---GTFCHINRLKIYG  276
            K    WN+       S EPC   AS    W     NP I CDCS    T CHI +L++Y 
Sbjct  7    KASSEWNI-------SGEPCSGVASDVSDWDNYPKNPAIKCDCSFNNNTICHIIKLRVYE  59

Query  277  LDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIG  456
            L+IVG+IP EL  L  + DLNL  N L G++P  IG+ T MK+L  G N L+G +P E+G
Sbjct  60   LNIVGQIPAELQNLTYLQDLNLNHNYLTGAIPSFIGKFTFMKYLGLGFNPLSGQLPKELG  119

Query  457  NLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASS  636
            NL+ L++L  + NN  G LP ELGNLT LE++YIDS+  +GP P  +SKLKNL+ L AS 
Sbjct  120  NLTNLLSLGISLNNFTGELPEELGNLTKLEQLYIDSSGFSGPFPSMISKLKNLKFLKASD  179

Query  637  NNFTGKLPEFLG  672
            N FTGKLP++LG
Sbjct  180  NEFTGKLPDYLG  191



>ref|XP_006468409.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X1 [Citrus sinensis]
Length=1046

 Score =   177 bits (449),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 137/222 (62%), Gaps = 12/222 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDK---NASWAPL  204
            F ++ L N     +  TDP EV A+N I+  W+  +    N+S   PC     NA+ +  
Sbjct  24   FLLICLSNAQNNTTATTDPAEVRALNSILQQWDAPAVPLWNISG-NPCSGSALNATDSEF  82

Query  205  EA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            E+   NP I C+C+   G  CHI +L++YGL+  G IP+EL  L+ +  L + QN   G 
Sbjct  83   ESPNNNPAIVCNCTFDNGATCHITKLRVYGLNKKGVIPEELVTLQYLTVLKIDQNFFTGP  142

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +P  IG L+++ +LSF  N+ +GP+P E+GNL  L  L+F TNN +G LPPELGNL  LE
Sbjct  143  LPSFIGNLSRLMFLSFSHNDFSGPVPRELGNLKELTVLAFGTNNFSGALPPELGNLAKLE  202

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YIDS    G IP   +KL+N++ LWAS N FTGK+P+F+G
Sbjct  203  QLYIDSCGAGGEIPSTFAKLRNMQTLWASDNPFTGKIPDFIG  244


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 73/145 (50%), Gaps = 2/145 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I      GEIP     L+ M  L  + N   G +P  IG  TK+K L F 
Sbjct  196  GNLAKLEQLYIDSCGAGGEIPSTFAKLRNMQTLWASDNPFTGKIPDFIGNWTKLKSLRFQ  255

Query  418  TNNLTGPIPPEIGNLSILITLSFAT-NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP  +  L+ L +L  +   N++  L   + +L  L ++ + +  +TG IP  
Sbjct  256  GNSFQGPIPSSLSKLASLESLQMSDIYNVSSSLDFVM-SLKNLTDLSLRNALITGTIPFG  314

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
            + +L+ L++L  S NN TG++P  L
Sbjct  315  IGELQMLQILDLSFNNLTGQIPATL  339



>gb|KEH19476.1| LRR receptor-like kinase, putative [Medicago truncatula]
Length=781

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNL---RSKVNLS----SFEPC  177
            +GI+   F  L         +  TDP+E   ++ I   W     +++ N+S    S    
Sbjct  10   LGIILCVFICLHNFAQAQTANATTDPSEARVVHSIFSKWGKSADQTQWNISGEICSGRAI  69

Query  178  DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
            D + +      NP I CDCS    T C I  LK+Y LD++ EIP EL+ L  + +LNL Q
Sbjct  70   DSSTTIDDTTYNPFIKCDCSFNNKTTCRITALKVYALDVISEIPPELWTLTYLTNLNLGQ  129

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N L GS+PP IG LT+M+++S G N L+G +P E+G+L+ LI L F +NN +G LP ELG
Sbjct  130  NYLTGSLPPAIGNLTRMQYMSIGINALSGELPKELGDLTQLIVLGFGSNNFSGSLPSELG  189

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L  LE++Y+DS+ ++GPIP   + L N+  +WAS    TG++P+F+G
Sbjct  190  KLVKLEQLYMDSSGISGPIPPTFASLTNMVTVWASDTELTGRIPDFIG  237


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 76/160 (48%), Gaps = 4/160 (3%)
 Frame = +1

Query  193  WAP-LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
            WA   E   RI  D  G +  +  L+  G    G IP  L  L  + +L ++      S 
Sbjct  222  WASDTELTGRIP-DFIGNWSKLQSLRFQGNSFEGPIPSSLSNLTSLTELRISGLSNRSSS  280

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
               +  +  M  L    NN++G  P  IG L  L  L  + NN++G +P  + NL++L  
Sbjct  281  LEFVRNMKSMTILELRNNNISGSFPSTIGELQNLTLLDLSFNNISGQIPGSIFNLSSLSS  340

Query  550  MYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +++ +N L+G +P++  K  +L  +  S N+ +G  P ++
Sbjct  341  LFLGNNTLSGSLPQQ--KRSSLNNIDLSYNDLSGSFPSWI  378



>ref|XP_004976813.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Setaria italica]
Length=1038

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 128/204 (63%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNASWAPL-----EANPRIACDCSG---  240
            TDP E  A+N I+    L +  + + S  PC   A+           NP I CDCS    
Sbjct  32   TDPVEAAAVNAILSKLGLSAPASWNISGNPCSGAATDDTQLDDNPAFNPAIKCDCSDRNN  91

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CH+ R KI  LD VG IP+EL  L  +  L+L +N L G +P  IG+LT ++ ++ G 
Sbjct  92   TLCHVTRFKINMLDAVGPIPEELRNLTHLRKLDLRRNYLTGPLPAFIGELTALESMTVGI  151

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GPIP E+GNL  L++L+  +NN NG LP ELG LT L ++YIDSN  +GP+P  LS
Sbjct  152  NALSGPIPKELGNLVNLVSLALGSNNFNGTLPDELGKLTKLRQIYIDSNDFSGPLPSTLS  211

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            +LKNL +LWAS NNFTG++P++LG
Sbjct  212  QLKNLSILWASDNNFTGQIPDYLG  235



>ref|XP_007024834.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27456.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1029

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 130/209 (62%), Gaps = 10/209 (5%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPC------DKNASWAPLEANPRIACDC  234
            Q+  TDP+EV A+N I   W  ++    + S EPC      D ++++     NP I CDC
Sbjct  40   QNATTDPSEVRALNSIFQQWETQAPDTWNISGEPCSGRALSDSDSAFEDSSNNPAIRCDC  99

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S   GT CHI RL+++ L+  G+IP+EL  L+ +  L + QN   G +P  IG ++++  
Sbjct  100  SFENGTICHITRLRVFSLEKRGQIPEELLALRFLTFLKIDQNFFTGPLPAFIGNMSRLAL  159

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS   N+L+GPIP EIGNL  L  LS   NN +G LPPELGNL  L+++YI+S   TG I
Sbjct  160  LSVAQNSLSGPIPKEIGNLKELYMLSLGINNFSGTLPPELGNLVELQQLYINSCGFTGEI  219

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   + L+NL++++AS N  TGK+P+F+G
Sbjct  220  PSTFANLRNLQIVYASDNALTGKIPDFIG  248


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            LK + DL L   +L GS+  +I +   ++ L    NNLTG IP E+ N++ L  L    N
Sbjct  299  LKNIADLVLRNVLLTGSISTDIVEFQSLQKLDLSFNNLTGQIPSELFNMNSLTFL--GNN  356

Query  496  NMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFT  648
            +++G LP +     +L+ + +  N L+G +P  +     L V+   +NNFT
Sbjct  357  SLSGTLPSQKSQ--SLKNIDVSYNHLSGNLPSWIDSTLQLNVV---ANNFT  402



>ref|XP_003531816.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Glycine max]
Length=1034

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 135/219 (62%), Gaps = 14/219 (6%)
 Frame = +1

Query  55   LLNTVIAQSN--ITDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKNASWAPLEA---  210
            L+N   AQS    TDP+E  A+N I   W++ +   + N+SS E C   A  A       
Sbjct  24   LVNVAQAQSANATTDPSEARALNSIFSKWDILANPTQWNISS-ELCSGRAIDATTTIDDT  82

Query  211  --NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDCS    T C I  LK+Y + IVG IP+EL+ L  + +LNL QN L GS+PP
Sbjct  83   TFNPFIKCDCSYDSRTTCRITALKVYAMSIVGTIPEELWTLTYLTNLNLGQNYLTGSLPP  142

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT+M++LS G NN +G +P E+GNL+ L +L+F +N   G LP ELG LT LE++Y
Sbjct  143  NIGNLTRMQYLSIGINNFSGELPKELGNLTELRSLAFGSNKFRGSLPSELGKLTNLEQIY  202

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             DS+ ++GPIP   + LKNL  + AS    TGK+P+F+G
Sbjct  203  FDSSGISGPIPSTFANLKNLLHVGASDTELTGKIPDFIG  241



>emb|CDP20736.1| unnamed protein product [Coffea canephora]
Length=1045

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 133/216 (62%), Gaps = 24/216 (11%)
 Frame = +1

Query  76   QSNIT----DPNEVVAINKIIDH--------WNLRSKVNLSSFEPCDKNA--SWAPLEAN  213
            Q+N T    DP E +A+N I           WN+       S E C   A  +      N
Sbjct  45   QTNATRPTADPFEAMAVNSIFQKLGAPAPTDWNI-------SGELCSGVAIGNTDIQTFN  97

Query  214  PRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIG  384
            P I CDCS   GT CHI RLKIY LD+VG++P EL+ L  ++DLNL QN L G +PP IG
Sbjct  98   PGIKCDCSYNKGTLCHITRLKIYALDVVGDLPDELWNLTFLIDLNLGQNYLTGPLPPSIG  157

Query  385  QLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS  564
            +LT+M++LS G N L+G +P E+G L+ L +LSF+TNN +G  P ELGNLT L ++Y DS
Sbjct  158  RLTRMQYLSIGINALSGELPKELGMLTDLRSLSFSTNNFSGSFPDELGNLTRLTQLYFDS  217

Query  565  NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            + ++G IP   +KL++L  +W S    TG++P+F+G
Sbjct  218  SGVSGAIPPTFTKLQSLVTVWGSDAQLTGQIPDFIG  253


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+  G    G IP     L  + DL ++ ++ N S   + I  +  +  
Sbjct  250  DFIGNWSQLTTLRFQGNAFHGRIPLSFSKLTSLTDLRIS-DLSNASFSLDFIRDMKSLST  308

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++G +P  IG    L  L  + NN++G +P  L NL++L  +++ +N+ TG +
Sbjct  309  LILRNNNISGSLPSNIGEYLSLQRLDLSFNNLSGRIPDSLLNLSSLTHLFLGNNKFTGSL  368

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P + S++  L  +  S N  +G  P ++
Sbjct  369  PSQKSEV--LHNIDLSYNELSGGFPSWV  394



>ref|XP_011460718.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Fragaria vesca subsp. vesca]
Length=416

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 131/227 (58%), Gaps = 17/227 (7%)
 Frame = +1

Query  43   FVLGLLNTVIAQS----------NITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKN  186
            F+ GL    +AQ+            TDP+E  A+N I   W + +      ++ +PC   
Sbjct  25   FIFGLTGVTVAQAPSQAPTSQPQATTDPSEAKALNSIFAQWGIEANTEQWNTTGDPCSGA  84

Query  187  A----SWAPLEANPRIACDCSGTF-CHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQN  351
            A    ++   + NP I C+CS    CHI +LK+Y LD+ G +P EL+ L  + +L L QN
Sbjct  85   AIDSTAFGDDDHNPFIKCECSDNVTCHITQLKVYALDVDGVLPDELWTLSYLSNLKLGQN  144

Query  352  VLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGN  531
               G +   IG LT M++L FG N L+G +P E+G L+ LI  +  TNN  GPLP ELG+
Sbjct  145  YFTGPLSASIGNLTSMQYLDFGINALSGELPRELGELTELIVFAIGTNNFTGPLPAELGS  204

Query  532  LTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            L+ L+E+Y+DS+ L+G IP   + L++L+ LWAS    +G +P+F+G
Sbjct  205  LSKLQELYLDSSGLSGEIPSTFANLQSLQKLWASDVELSGSIPDFIG  251


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 74/168 (44%), Gaps = 26/168 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G+   +  L +    + GEIP     L+ +  L  +   L+GS+P  IG L+K+  L F 
Sbjct  203  GSLSKLQELYLDSSGLSGEIPSTFANLQSLQKLWASDVELSGSIPDFIGNLSKLTDLRFQ  262

Query  418  TNNLTGPIPPEIGNLSILI--------------------------TLSFATNNMNGPLPP  519
             N+  GPIP  + NL+ L                            L    NN++  +P 
Sbjct  263  GNSFEGPIPSALSNLTSLTNPIITDISTTNGTSSLGFIMDMKSLSVLVLRNNNISDSIPS  322

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
             +G   +L ++ +  N LTG IP+ L  L +L +L+  +N   G +PE
Sbjct  323  NIGEYKSLYQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTIPE  370


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 77/172 (45%), Gaps = 31/172 (18%)
 Frame = +1

Query  241  TFCHINRL-KIYGLDI--VGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTK-----  396
            TF ++  L K++  D+   G IP  +  L ++ DL    N   G +P  +  LT      
Sbjct  225  TFANLQSLQKLWASDVELSGSIPDFIGNLSKLTDLRFQGNSFEGPIPSALSNLTSLTNPI  284

Query  397  ------------------MKWLS---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPL  513
                              MK LS      NN++  IP  IG    L  L  + NN+ G +
Sbjct  285  ITDISTTNGTSSLGFIMDMKSLSVLVLRNNNISDSIPSNIGEYKSLYQLDLSFNNLTGQI  344

Query  514  PPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P  L NL++L  +++ +N+L G IPE  SK  +L  +  S NN  G +P ++
Sbjct  345  PDSLFNLSSLSILFLGNNKLNGTIPE--SKSSSLLNIDLSYNNLVGSIPSWV  394



>gb|KEH19475.1| LRR receptor-like kinase, putative [Medicago truncatula]
Length=1031

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNL---RSKVNLS----SFEPC  177
            +GI+   F  L         +  TDP+E   ++ I   W     +++ N+S    S    
Sbjct  10   LGIILCVFICLHNFAQAQTANATTDPSEARVVHSIFSKWGKSADQTQWNISGEICSGRAI  69

Query  178  DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
            D + +      NP I CDCS    T C I  LK+Y LD++ EIP EL+ L  + +LNL Q
Sbjct  70   DSSTTIDDTTYNPFIKCDCSFNNKTTCRITALKVYALDVISEIPPELWTLTYLTNLNLGQ  129

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N L GS+PP IG LT+M+++S G N L+G +P E+G+L+ LI L F +NN +G LP ELG
Sbjct  130  NYLTGSLPPAIGNLTRMQYMSIGINALSGELPKELGDLTQLIVLGFGSNNFSGSLPSELG  189

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L  LE++Y+DS+ ++GPIP   + L N+  +WAS    TG++P+F+G
Sbjct  190  KLVKLEQLYMDSSGISGPIPPTFASLTNMVTVWASDTELTGRIPDFIG  237


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 76/160 (48%), Gaps = 4/160 (3%)
 Frame = +1

Query  193  WAP-LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
            WA   E   RI  D  G +  +  L+  G    G IP  L  L  + +L ++      S 
Sbjct  222  WASDTELTGRIP-DFIGNWSKLQSLRFQGNSFEGPIPSSLSNLTSLTELRISGLSNRSSS  280

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
               +  +  M  L    NN++G  P  IG L  L  L  + NN++G +P  + NL++L  
Sbjct  281  LEFVRNMKSMTILELRNNNISGSFPSTIGELQNLTLLDLSFNNISGQIPGSIFNLSSLSS  340

Query  550  MYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +++ +N L+G +P++  K  +L  +  S N+ +G  P ++
Sbjct  341  LFLGNNTLSGSLPQQ--KRSSLNNIDLSYNDLSGSFPSWI  378



>gb|KJB69992.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=865

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 74/186 (40%), Gaps = 51/186 (27%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTMNL  383

Query  631  SSNNFT  648
             +NNFT
Sbjct  384  VANNFT  389



>gb|KJB69998.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=872

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (40%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTIDL  383

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  384  SYNFLSGNLPSWV  396



>gb|EEC76964.1| hypothetical protein OsI_15252 [Oryza sativa Indica Group]
Length=883

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 129/208 (62%), Gaps = 9/208 (4%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKV------NLSSFEPCDKNASWAPLEANPRIACDCS  237
            Q+  TDP E VA+N I+  W   +        +L S    DKN        NP I CDC+
Sbjct  30   QAPKTDPVEAVALNTIMRRWGKEASSEWNVSGDLCSGFAADKNDWDYYPNINPFIKCDCT  89

Query  238  ---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
                T C I +L++  LD+VG+IP EL  L  + +L+L  N L G +P  IG+ T MK+L
Sbjct  90   FSNNTLCRITKLRVNKLDVVGQIPSELQNLTRLENLDLNYNYLTGFIPSFIGKFTSMKYL  149

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            + G N L+GP+P E+GNL+ LI+L  + NN  G LP ELGNLT L+++YIDS+  +GP P
Sbjct  150  ALGFNPLSGPLPKELGNLTNLISLGISLNNFTGGLPEELGNLTKLKQLYIDSSGFSGPFP  209

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFLG  672
               SKL+NL++L AS N FTGK+P++LG
Sbjct  210  STFSKLQNLQILLASDNGFTGKIPDYLG  237



>gb|KJB69997.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=882

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (40%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTIDL  383

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  384  SYNFLSGNLPSWV  396



>gb|KJB69994.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=919

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 74/186 (40%), Gaps = 51/186 (27%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTMNL  383

Query  631  SSNNFT  648
             +NNFT
Sbjct  384  VANNFT  389



>ref|NP_001053881.1| Os04g0616700 [Oryza sativa Japonica Group]
 dbj|BAF15795.1| Os04g0616700 [Oryza sativa Japonica Group]
Length=953

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 132/207 (64%), Gaps = 8/207 (4%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAP----LEANPRIACDCSG  240
            A +  TD  E  A+  + +  + +++ N +  +PC   A+ +        NP I CDCS 
Sbjct  19   APTATTDRIEAEALKAVFEKLDQKAEWNTTG-DPCSGAATDSTDINDSSINPAIKCDCSD  77

Query  241  ---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI  LKIY  D  G+IP EL  L  +  LNL+ N L G++P  IG+L  M++++
Sbjct  78   QNNTVCHITGLKIYDKDATGQIPGELRNLTHLTHLNLSHNFLVGTIPSFIGELAAMQYMT  137

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            FG N L+G IP E+GNL+ L++L F++NN +G LP ELG+L  LEE++IDS  L+G +P 
Sbjct  138  FGINALSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFKLEELFIDSAGLSGELPS  197

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LSKL  +++LWAS NNFTG++P+++G
Sbjct  198  SLSKLTRMKILWASDNNFTGQIPDYIG  224



>ref|XP_009409824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Musa acuminata subsp. malaccensis]
Length=768

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 12/202 (6%)
 Frame = +1

Query  97   NEVVAINKIIDHWNLRSKVNLS-----SFEPCDKNAS----WAPLEANPRIACDCS---G  240
            +EV A+N I+  W   +    S     S EPC   A+    +     NP I CDCS    
Sbjct  42   SEVAALNAILGRWGRTASATSSPAWNISGEPCSGAATDSTNFDSTAFNPAIKCDCSYDNA  101

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CHI +LK+  LD+VG IP EL  L  + +L+L +N L G +P  IG LT +++LS GT
Sbjct  102  TTCHITQLKVDALDVVGRIPDELQNLTYLTNLHLVRNYLTGPLPAFIGTLTGLQYLSVGT  161

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G IP E+G L+ L++LS ATNN +GPLP ELGNLT L+++Y+ S   +G  P  +S
Sbjct  162  NALSGGIPKELGKLTNLLSLSIATNNFSGPLPLELGNLTKLQQLYVSSCGASGEFPSTIS  221

Query  601  KLKNLRVLWASSNNFTGKLPEF  666
             L+NL+ LW  +NNFTGK+P+F
Sbjct  222  GLQNLKTLWLGNNNFTGKIPDF  243



>gb|KDP36457.1| hypothetical protein JCGZ_08587 [Jatropha curcas]
Length=1041

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 130/219 (59%), Gaps = 10/219 (5%)
 Frame = +1

Query  43   FVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNA-SWAPLEA-  210
            F+   L++  AQ+  TDP EV A+N I   W++ S    N+S  EPC  +A   +  EA 
Sbjct  23   FIFLSLDSSNAQNATTDPAEVEALNSIFKQWDIESVPLWNISG-EPCSGSAIDESEFEAP  81

Query  211  --NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDC    G  CHI RL++Y L+  G IP+ L VLK ++ L + +N   G +P 
Sbjct  82   DNNPAIRCDCGYNNGATCHITRLRVYNLNKRGVIPETLLVLKHLIFLKIDRNYFTGPLPA  141

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT +K LS   N  +G IP E+GNL  L   S   N+  G LPPELGNL  LE+MY
Sbjct  142  FIGNLTSLKTLSIAQNAFSGTIPKELGNLKELTLFSIGVNDFTGTLPPELGNLVKLEQMY  201

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            I+S  L+G IP   + LK LR++WA  N FTGK+P+F+G
Sbjct  202  INSCGLSGEIPSTFANLKRLRIMWAFDNPFTGKIPDFIG  240


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            +K + DLNL   ++ G++PP IG+   +K L    NNLTG IP  + ++S L  L    N
Sbjct  290  MKNLTDLNLRNALITGTIPPNIGEFRVLKTLDLSFNNLTGEIPSALFSMSSLEFLFLGNN  349

Query  496  NMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            +++G LP E   +  L+ + +  N LTG  P
Sbjct  350  SLSGALPNEKSGI--LQTIDLSYNHLTGRFP  378



>ref|XP_011006995.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Populus euphratica]
Length=1036

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 136/230 (59%), Gaps = 14/230 (6%)
 Frame = +1

Query  25   ILGFSFF-VLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKN  186
             L  SF  ++GL     AQ+     TDP+E  A+N I   W++ +  N   +S + C   
Sbjct  10   FLALSFVCIIGLAAIAQAQNQTQPTTDPDEARALNSIFQQWSISANTNQWNTSGDVCSGA  69

Query  187  ASWAP-----LEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL  342
            A+ A       + NP I CDC+   GT C I  LK+Y +D++G IP EL+ L  + +LNL
Sbjct  70   ATGASPPIDDTDFNPFIKCDCTFLNGTTCRITALKVYAIDVIGLIPDELWSLTYLTNLNL  129

Query  343  AQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPE  522
             QN L G++ P IG LT+M++++ G N L+G +P E+G L+ L    F +NN  G LP E
Sbjct  130  GQNYLTGNLSPSIGNLTRMQYMTIGINALSGELPKELGLLTDLRVFGFGSNNFTGSLPSE  189

Query  523  LGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            LGNL  LEE+Y DS+ ++G IP   + L+NL  +WAS N  +G +P+F+G
Sbjct  190  LGNLVKLEEIYFDSSGVSGEIPPTFANLQNLATVWASDNELSGTIPDFIG  239


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 69/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP     L  M DL ++     GS    I  +  +  L
Sbjct  236  DFIGNWSKLISLRFEGNAFEGPIPSVFSNLTTMTDLRISDLSDGGSSLEFIKNMKSLSIL  295

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                +N++  IP  IG    L  L  + NN+ G +P  L NL++L  +++ +N+L G +P
Sbjct  296  VLRNDNISASIPSYIGEFQSLTQLDLSFNNIEGQIPDSLFNLSSLTYLFLGNNKLNGTLP  355

Query  589  E-ELSKLKNLRVLWASSNNFTGKLPEFL  669
              + SKL N+ V   S NN  G  P ++
Sbjct  356  ATKSSKLLNVDV---SYNNLAGGFPSWV  380



>gb|KJB69996.1| hypothetical protein B456_011G052600 [Gossypium raimondii]
Length=1029

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  29   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  88

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  89   AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  148

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  149  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  208

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  209  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  243


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 74/186 (40%), Gaps = 51/186 (27%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  195  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  254

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  255  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  314

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  315  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTMNL  372

Query  631  SSNNFT  648
             +NNFT
Sbjct  373  VANNFT  378



>gb|EEE61690.1| hypothetical protein OsJ_16163 [Oryza sativa Japonica Group]
Length=984

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 132/207 (64%), Gaps = 8/207 (4%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAP----LEANPRIACDCSG  240
            A +  TD  E  A+  + +  + +++ N +  +PC   A+ +        NP I CDCS 
Sbjct  19   APTATTDRIEAEALKAVFEKLDQKAEWNTTG-DPCSGAATDSTDINDSSINPAIKCDCSD  77

Query  241  ---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI  LKIY  D  G+IP EL  L  +  LNL+ N L G++P  IG+L  M++++
Sbjct  78   QNNTVCHITGLKIYDKDATGQIPGELRNLTHLTHLNLSHNFLVGTIPSFIGELAAMQYMT  137

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            FG N L+G IP E+GNL+ L++L F++NN +G LP ELG+L  LEE++IDS  L+G +P 
Sbjct  138  FGINALSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFKLEELFIDSAGLSGELPS  197

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LSKL  +++LWAS NNFTG++P+++G
Sbjct  198  SLSKLTRMKILWASDNNFTGQIPDYIG  224



>gb|KJB69993.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=1042

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 74/186 (40%), Gaps = 51/186 (27%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTMNL  383

Query  631  SSNNFT  648
             +NNFT
Sbjct  384  VANNFT  389



>gb|KJB69971.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=678

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 138/232 (59%), Gaps = 18/232 (8%)
 Frame = +1

Query  31   GFSFFVLGLL----NTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDK  183
            G  FF L +L     ++ AQ+N     TDP+EV A+  I   W+L++    + S EPC  
Sbjct  11   GLLFFYLVVLFSCSQSIDAQTNQTNATTDPSEVRALISIFQQWDLQAPDTWNISGEPCSG  70

Query  184  NA---SWAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL  336
             A   S++  E    NP I CDCS    T CHI  L+++GLD  G IP E+  L  +  L
Sbjct  71   TALTTSFSEFEDPSNNPAIRCDCSFNASTVCHITSLRVFGLDKRGVIPDEILELPYLDFL  130

Query  337  NLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
             + +N  +GS+P  IG L+++  LS   NN +GPIP EIGNL  L  LS   N+++G LP
Sbjct  131  KIDKNFFSGSLPAFIGNLSRLGLLSIAQNNFSGPIPKEIGNLKKLYLLSLGNNDLSGTLP  190

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            PELGNL  L E+YI+S  L+  IP   + LK +R++WAS N FTGK+P+F+G
Sbjct  191  PELGNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVG  242


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 75/193 (39%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    +  EIP     LKEM  +  + N   G +P  +G  TK+  L F 
Sbjct  194  GNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVGNWTKLTQLRFE  253

Query  418  TNNLTGPIPPEIGNLS----------------------------------ILIT------  477
             N+  GPIP    NL+                                  +L+T      
Sbjct  254  GNSFEGPIPSSFSNLTSLNSLRIGDIYNGSSSSLDFVRNLKNLTDLVLRNVLLTGNFPSY  313

Query  478  ---------LSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
                     L  + NN+ G +P  L N+ +L  +++ +N L+G IP +  K + L+ +  
Sbjct  314  ITELQSLQKLDLSFNNLTGQIPSTLFNMNSLIYLFLGNNSLSGSIPSQ--KSETLQTIDL  371

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  372  SYNFLSGNLPSWV  384



>gb|KJB69991.1| hypothetical protein B456_011G052600, partial [Gossypium raimondii]
Length=1061

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  40   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  99

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  100  AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  159

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  160  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  219

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  220  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  254


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (40%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  206  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  265

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  266  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  325

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  326  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTIDL  383

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  384  SYNFLSGNLPSWV  396



>ref|XP_006659919.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=1031

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 127/201 (63%), Gaps = 13/201 (6%)
 Frame = +1

Query  103  VVAINKIIDHWNLR--SKVNLSSFEPC------DKNASWAPLEANPRIACDCS---GTFC  249
              A++ I+  W  +     N +  +PC      D N    P+  NP I CDCS    T C
Sbjct  45   TAALSTILGRWRTKPPKTWNTTGGDPCTGTAIDDTNIDNDPV-INPGIKCDCSFNNSTVC  103

Query  250  HINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNL  429
            HI +L++Y L++VG+IP EL  L  + +LNL QN L G +P  IG+   MK+LS   N L
Sbjct  104  HITKLRVYALNVVGQIPAELEKLTHLDNLNLMQNYLTGPIPSFIGKF-PMKYLSLAINPL  162

Query  430  TGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLK  609
            +GP+P E+GNL+ L++L  + NN  G LP ELGNLT LE++YIDS+  +GP P   SKLK
Sbjct  163  SGPLPKELGNLTNLMSLGISLNNFTGKLPEELGNLTKLEQLYIDSSGFSGPFPSTFSKLK  222

Query  610  NLRVLWASSNNFTGKLPEFLG  672
            NL++LW S N+FTGK+P+F+G
Sbjct  223  NLKILWISDNDFTGKIPDFIG  243



>gb|KJB69995.1| hypothetical protein B456_011G052600 [Gossypium raimondii]
Length=1052

 Score =   174 bits (441),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  61   NTVIAQSN-ITDPNEVVAINKIIDHWNLRSKVNL-SSFEPCDKNASWAPLEA------NP  216
             ++ AQ+N  TDP+EV A+N I   WN ++  +  ++ +PC   A    L        NP
Sbjct  29   QSITAQTNATTDPSEVKALNSIFQQWNAQAVASWNTTGDPCSGTALSQGLSEFEDPSNNP  88

Query  217  RIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I CDCS    T CHI RL+++GLD  G +PKEL  L  +  L L +N  +G +P  IG 
Sbjct  89   AITCDCSFNDNTVCHITRLRVFGLDKRGVLPKELLDLPYLDFLKLDRNFFSGPLPAFIGN  148

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            ++++  LS   NN +G IP E GNL  L  LS   N++ G LPPELGNL  L E+YI+S 
Sbjct  149  MSRLGLLSLAHNNFSGTIPKEFGNLKKLYLLSLGNNDIFGKLPPELGNLAELGELYINSC  208

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   +KLK+LR +WAS N FTGK+P+F G
Sbjct  209  ALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFG  243


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (40%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     LK++  +  + N   G +P   G LTK+  L F 
Sbjct  195  GNLAELGELYINSCALSGEIPSTFAKLKDLRTVWASDNAFTGKIPDFFGNLTKLTALRFQ  254

Query  418  TNNLTGPIPPEIGNLSILITL-------------------------------------SF  486
             N+  GPIP  +GNL+ L +L                                     S+
Sbjct  255  GNSFEGPIPSSLGNLTSLTSLRIGDIYNGSSSSLDFIRNLKNLTDLVLRNVLLTGNLPSY  314

Query  487  AT------------NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
             T            NN+ G +P  L  + +LE +++ +N L+G IP +  K + L  +  
Sbjct  315  ITELQYLQKLDLSFNNLTGRIPSVLFTMKSLEYLFLGNNGLSGSIPSQ--KSETLTTIDL  372

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  373  SYNFLSGNLPSWV  385



>gb|KJB69970.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=718

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 138/232 (59%), Gaps = 18/232 (8%)
 Frame = +1

Query  31   GFSFFVLGLL----NTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDK  183
            G  FF L +L     ++ AQ+N     TDP+EV A+  I   W+L++    + S EPC  
Sbjct  11   GLLFFYLVVLFSCSQSIDAQTNQTNATTDPSEVRALISIFQQWDLQAPDTWNISGEPCSG  70

Query  184  NA---SWAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL  336
             A   S++  E    NP I CDCS    T CHI  L+++GLD  G IP E+  L  +  L
Sbjct  71   TALTTSFSEFEDPSNNPAIRCDCSFNASTVCHITSLRVFGLDKRGVIPDEILELPYLDFL  130

Query  337  NLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
             + +N  +GS+P  IG L+++  LS   NN +GPIP EIGNL  L  LS   N+++G LP
Sbjct  131  KIDKNFFSGSLPAFIGNLSRLGLLSIAQNNFSGPIPKEIGNLKKLYLLSLGNNDLSGTLP  190

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            PELGNL  L E+YI+S  L+  IP   + LK +R++WAS N FTGK+P+F+G
Sbjct  191  PELGNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVG  242


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 75/193 (39%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    +  EIP     LKEM  +  + N   G +P  +G  TK+  L F 
Sbjct  194  GNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVGNWTKLTQLRFE  253

Query  418  TNNLTGPIPPEIGNLS----------------------------------ILIT------  477
             N+  GPIP    NL+                                  +L+T      
Sbjct  254  GNSFEGPIPSSFSNLTSLNSLRIGDIYNGSSSSLDFVRNLKNLTDLVLRNVLLTGNFPSY  313

Query  478  ---------LSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
                     L  + NN+ G +P  L N+ +L  +++ +N L+G IP +  K + L+ +  
Sbjct  314  ITELQSLQKLDLSFNNLTGQIPSTLFNMNSLIYLFLGNNSLSGSIPSQ--KSETLQTIDL  371

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  372  SYNFLSGNLPSWV  384



>ref|XP_004972616.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X2 [Setaria italica]
Length=1027

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 129/205 (63%), Gaps = 14/205 (7%)
 Frame = +1

Query  91   DPNEVVAINKIIDHWNLRS--KVNLSSFEPC------DKNASWAPLEANPRIACDCS---  237
            DP E  A+N I+  W LR+  + N+S  E C      D      P + NP I C CS   
Sbjct  38   DPVEAAALNTILRRWGLRASPRWNISG-ELCSGVAVDDTEVDNDP-DINPAIKCVCSYNN  95

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI +L++Y L++VG+IP EL  L  + +LNL QN L G VP  IG+   M++LS  
Sbjct  96   ATVCHIIKLRVYALNVVGQIPAELQNLTYLSNLNLMQNYLTGPVPSFIGKF-PMQYLSLA  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+G +P E+GNL+ LI+L  + NN  G LP ELGNL  LE++Y DS+  +GP P   
Sbjct  155  INPLSGTLPKELGNLTNLISLGISLNNFTGELPSELGNLAKLEQIYFDSSGFSGPFPSTF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKLKNL++LWAS N+FTGK+P+F+G
Sbjct  215  SKLKNLKILWASDNDFTGKIPDFIG  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 76/185 (41%), Gaps = 37/185 (20%)
 Frame = +1

Query  217  RIACDCSG-------TFCHINRLKIYGL---DIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            +I  D SG       TF  +  LKI      D  G+IP  +  L ++ DL    N   G 
Sbjct  198  QIYFDSSGFSGPFPSTFSKLKNLKILWASDNDFTGKIPDFIGSLTKLEDLRFQGNSFEGP  257

Query  367  VPPEIGQLTKMKWLSFG-----------TNNLTG--------------PIPPEIGNLSIL  471
            +P  +  LTK+  L  G            +NLT                      NL+ L
Sbjct  258  IPESLSNLTKLTSLRIGDIVNGSSSMSFISNLTSLHVLILRNCRISDNLATVNFSNLAGL  317

Query  472  ITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTG  651
              L  + NN+ G +PP + NL  LE +++ +N L+G +P+  S L  L  L  S N  +G
Sbjct  318  TLLDLSFNNITGQIPPSILNLAKLEFLFLGNNSLSGSLPDVKSPL--LNNLDFSYNQLSG  375

Query  652  KLPEF  666
              P +
Sbjct  376  SFPSW  380



>ref|XP_004972615.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X1 [Setaria italica]
Length=1051

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 129/205 (63%), Gaps = 14/205 (7%)
 Frame = +1

Query  91   DPNEVVAINKIIDHWNLRS--KVNLSSFEPC------DKNASWAPLEANPRIACDCS---  237
            DP E  A+N I+  W LR+  + N+S  E C      D      P + NP I C CS   
Sbjct  38   DPVEAAALNTILRRWGLRASPRWNISG-ELCSGVAVDDTEVDNDP-DINPAIKCVCSYNN  95

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI +L++Y L++VG+IP EL  L  + +LNL QN L G VP  IG+   M++LS  
Sbjct  96   ATVCHIIKLRVYALNVVGQIPAELQNLTYLSNLNLMQNYLTGPVPSFIGKF-PMQYLSLA  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+G +P E+GNL+ LI+L  + NN  G LP ELGNL  LE++Y DS+  +GP P   
Sbjct  155  INPLSGTLPKELGNLTNLISLGISLNNFTGELPSELGNLAKLEQIYFDSSGFSGPFPSTF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKLKNL++LWAS N+FTGK+P+F+G
Sbjct  215  SKLKNLKILWASDNDFTGKIPDFIG  239


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 76/185 (41%), Gaps = 37/185 (20%)
 Frame = +1

Query  217  RIACDCSG-------TFCHINRLKIYGL---DIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            +I  D SG       TF  +  LKI      D  G+IP  +  L ++ DL    N   G 
Sbjct  198  QIYFDSSGFSGPFPSTFSKLKNLKILWASDNDFTGKIPDFIGSLTKLEDLRFQGNSFEGP  257

Query  367  VPPEIGQLTKMKWLSFG-----------TNNLTG--------------PIPPEIGNLSIL  471
            +P  +  LTK+  L  G            +NLT                      NL+ L
Sbjct  258  IPESLSNLTKLTSLRIGDIVNGSSSMSFISNLTSLHVLILRNCRISDNLATVNFSNLAGL  317

Query  472  ITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTG  651
              L  + NN+ G +PP + NL  LE +++ +N L+G +P+  S L  L  L  S N  +G
Sbjct  318  TLLDLSFNNITGQIPPSILNLAKLEFLFLGNNSLSGSLPDVKSPL--LNNLDFSYNQLSG  375

Query  652  KLPEF  666
              P +
Sbjct  376  SFPSW  380



>ref|XP_004516050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Cicer arietinum]
Length=1021

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 123/205 (60%), Gaps = 19/205 (9%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVN-------LSSFEPCDKNASWAPLEANPRIACDCS---  237
            TDP+E  ++N I   W + +          L S    D + +      NP I CDCS   
Sbjct  33   TDPSEARSLNSIFSKWGISADQTQWNKSGELCSGRAIDSSTTIEDTAYNPFIKCDCSYNN  92

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T CHI  LK+Y LD++ EIP+         D  L QN L GS+PP+IG LT+M+++S G
Sbjct  93   KTTCHITALKVYALDVISEIPQ---------DRKLGQNYLTGSLPPDIGNLTRMQYMSIG  143

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+G +P ++GNL+ LI LSF +NN +G LP ELG L  LE++Y+DS+ ++GPIP  +
Sbjct  144  INALSGELPKQLGNLTQLIVLSFGSNNFSGTLPSELGKLLKLEQLYMDSSGISGPIPPTI  203

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + LKNL  +WAS    TG +P+F+G
Sbjct  204  ASLKNLVTVWASDTELTGSIPDFIG  228


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 69/140 (49%), Gaps = 0/140 (0%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L +    I G IP  +  LK ++ +  +   L GS+P  IG  +K++ L F 
Sbjct  180  GKLLKLEQLYMDSSGISGPIPPTIASLKNLVTVWASDTELTGSIPDFIGNWSKLQTLRFQ  239

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+  GPIP    NL+ L  L  +  +        + N+ +L  + + +N+++G IP  +
Sbjct  240  GNSFEGPIPSSFSNLTSLTELRISGLSNGSSSLEVIRNMKSLTILELRNNKMSGSIPPNI  299

Query  598  SKLKNLRVLWASSNNFTGKL  657
             + +NL  L  S NN +G +
Sbjct  300  GEFRNLTQLDLSFNNISGHI  319



>gb|ACN59258.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=528

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 130/205 (63%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E +A+N I   W +R+  + N+S  E C   A  A +       NP I CDCS   
Sbjct  36   THPDEALALNSIFAAWRIRAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFEN  94

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I  +K+Y +++VG IP++L+ L+ + +LNL QNVL GS+PP +G LT+M+W++FG
Sbjct  95   STICRITNIKVYAMEVVGSIPQQLWTLEYLTNLNLGQNVLTGSLPPALGNLTRMRWMTFG  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP EIG L+ L  LS ++NN +G +P E+G  T L+++YIDS+ L+G +P   
Sbjct  155  INALSGPIPKEIGLLTDLRLLSISSNNFSGSIPDEIGRCTKLQQIYIDSSGLSGGLPVSF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L  L   W +    TG++P+F+G
Sbjct  215  ANLVELEQAWIADMELTGQIPDFIG  239


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 94/198 (47%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L   + +S     +   +W A +E   +I  D  G +  + 
Sbjct  187  PDEIGRCTKLQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIP-DFIGDWTKLT  245

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L + + NG+   E I  +  +  L    NNLTG
Sbjct  246  TLRILGTGLSGPIPASFSNLTSLTELRLGE-ISNGNSSLEFIKDMKSLSILVLRNNNLTG  304

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  L  + N ++G +P  L NL  L  +++ +N L G +P +  K ++L
Sbjct  305  TIPSNIGEYSSLRQLDLSFNKLHGTIPASLFNLRQLTHLFLGNNTLNGSLPTQ--KGQSL  362

Query  616  RVLWASSNNFTGKLPEFL  669
              +  S N+ +G LP ++
Sbjct  363  SNVDVSYNDLSGSLPSWV  380



>gb|KHG01148.1| hypothetical protein F383_22594 [Gossypium arboreum]
Length=1039

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 134/231 (58%), Gaps = 20/231 (9%)
 Frame = +1

Query  37   SFFVLGLLNTVI--------AQSNITDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKN  186
            ++F+L L   V+        AQ+  TDP E  A+N I   W  ++    N+S  EPC  +
Sbjct  12   AYFLLHLFFFVVSFCCSKSNAQNATTDPAEARALNSIFQQWGTQAVDSWNISG-EPCSGS  70

Query  187  A---SWAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
            A   S +  E    NP I CDCS    T CHI RL++Y LD  G IP+EL  L  +  L 
Sbjct  71   ALSQSDSVFEDPTNNPAIRCDCSFNSNTLCHITRLRVYALDRTGVIPEELLGLPFLTFLK  130

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            + QN   GS+P  IG +++++ LS   N+ +GPIP E+GNL  L  LSF  N  +G LPP
Sbjct  131  IDQNFFTGSLPAFIGNMSRLESLSIAHNDFSGPIPKELGNLRQLKLLSFGENRFSGTLPP  190

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ELGNL  LE++YI+S  L G +P   +   NL+VLWAS N FTGK+P+F G
Sbjct  191  ELGNLVNLEQLYINSCGLGGEVPSTFANFGNLQVLWASDNAFTGKIPDFGG  241


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 57/110 (52%), Gaps = 5/110 (5%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            L  + DL L   +L G++P  I +L  ++ L    NNLTG IP  + N+  L  L    N
Sbjct  293  LNNLPDLVLRNVLLTGTLPSYITELQSLQKLDLSFNNLTGQIPSALFNMDSLTYLFLGNN  352

Query  496  NMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNF  645
            +++GP+P       TL+ + I  N L+G +P  ++   NL  +   +NNF
Sbjct  353  SLSGPIPSRKSE--TLQTIDISYNMLSGNLPSWINSDLNLNFV---ANNF  397



>ref|XP_009341206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Pyrus x bretschneideri]
Length=243

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 129/233 (55%), Gaps = 18/233 (8%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPC---  177
            +M IL   F          A+   TDP+EV A+N I + W+ ++   + N+S  EPC   
Sbjct  7    MMRILLLCFLSCFWFQLSFARKATTDPSEVRALNSIFEQWDTQAEPGQWNISG-EPCSGY  65

Query  178  -----DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMD  333
                 D N S   L  NP I C+CS      CHI  L +YGLD  G  P+E   L+ +  
Sbjct  66   AINRTDINNS---LYINPGIVCNCSYDNNATCHITNLTVYGLDKRGVFPEEFVALRYLTS  122

Query  334  LNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPL  513
            L + QN   G +P  IG +  + +LS   N+ +GPIP E+GNL  L  L   +NN +G L
Sbjct  123  LRINQNYFTGPLPAFIGNMFALTYLSISDNSFSGPIPKELGNLKELTYLDIRSNNFSGTL  182

Query  514  PPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            PPELGNL  LE +YIDS  L+G IP   +KL N+++  AS N F+GK+P+F+G
Sbjct  183  PPELGNLVKLERLYIDSCGLSGEIPSTFAKLTNMQMFSASDNPFSGKIPDFIG  235



>gb|KCW68790.1| hypothetical protein EUGRSUZ_F023912, partial [Eucalyptus grandis]
Length=992

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 128/197 (65%), Gaps = 11/197 (6%)
 Frame = +1

Query  112  INKIIDHWNLRSKV---NLSSFEPCDKNA----SWAPLEANPRIACDCS---GTFCHINR  261
            +N I   W L S+    N+S  EPC   A    S+     NP I C CS    T CHI  
Sbjct  3    LNSIWSTWELTSQAPKWNISG-EPCSGAAIDSTSFIDTNYNPFIKCVCSFNSSTTCHITG  61

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPI  441
            LK+  + + G IP +L+ L  ++DLNLAQN L GS+ P IG LT+M++L+ G N L+G +
Sbjct  62   LKVLAMSVAGPIPDQLWKLTYILDLNLAQNFLTGSLSPSIGNLTRMQYLTVGKNALSGEL  121

Query  442  PPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRV  621
            PP++G L+ L++LSF TNN +G LP ELGNL+ L+++Y++S+ ++  IP   SKLKNL++
Sbjct  122  PPQLGQLTELLSLSFTTNNFSGSLPSELGNLSKLQQLYMESSGVSSEIPSTFSKLKNLQI  181

Query  622  LWASSNNFTGKLPEFLG  672
            +  S NNFTG +PEF+G
Sbjct  182  VRVSDNNFTGNIPEFIG  198


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = +1

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN---LAQNVLNGSVPPEIGQLTKMKWLS  411
            TF ++  LK   +  V  +   L  ++ M +L+   L  N ++ S+P +      +  L 
Sbjct  220  TFSNLTSLKDLRISDVSNVSSSLEFIRNMKNLSILILRNNNISDSLPSDFSGYQSLSQLD  279

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
               N LTG IP  + NLS L  L    N++NG LP +     +L  + +  N L G IP 
Sbjct  280  LSFNKLTGQIPDSLFNLSSLTYLFLGNNSLNGTLPEQKS--ASLRNIDVSYNNLMGSIPS  337

Query  592  ELS  600
             +S
Sbjct  338  WVS  340



>ref|XP_002444009.1| hypothetical protein SORBIDRAFT_07g005820 [Sorghum bicolor]
 gb|EES13504.1| hypothetical protein SORBIDRAFT_07g005820 [Sorghum bicolor]
Length=1009

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 132/209 (63%), Gaps = 12/209 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPC-----DKNASWAPLEANPRIACDC  234
            Q+  TDP EV A+N I+  W L++    N+S  EPC     D     +    NP I CDC
Sbjct  39   QTARTDPAEVAALNTILGRWGLKASAAWNISG-EPCSGVAVDTTDVDSNPNINPAIKCDC  97

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            +    T CHI +LK+Y L++VG+IP EL  L  + +LNL QN L G VP  +G+   M++
Sbjct  98   TYNNATVCHITKLKVYALNVVGQIPAELQNLTYLNNLNLQQNYLTGPVPSFMGKF-PMQY  156

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS   N L+G +P E+GNL+ LI+L  + NN  G LP ELGNL+ LE++Y DS+  +GP 
Sbjct  157  LSLAINPLSGTLPKELGNLTNLISLGISLNNFTGELPSELGNLSKLEQIYFDSSGFSGPF  216

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLK L++LWAS N FTGK+P+F+G
Sbjct  217  PSTFSKLKKLKILWASDNEFTGKIPDFIG  245



>gb|KJB69968.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=1045

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 138/232 (59%), Gaps = 18/232 (8%)
 Frame = +1

Query  31   GFSFFVLGLL----NTVIAQSN----ITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDK  183
            G  FF L +L     ++ AQ+N     TDP+EV A+  I   W+L++    + S EPC  
Sbjct  16   GLLFFYLVVLFSCSQSIDAQTNQTNATTDPSEVRALISIFQQWDLQAPDTWNISGEPCSG  75

Query  184  NA---SWAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDL  336
             A   S++  E    NP I CDCS    T CHI  L+++GLD  G IP E+  L  +  L
Sbjct  76   TALTTSFSEFEDPSNNPAIRCDCSFNASTVCHITSLRVFGLDKRGVIPDEILELPYLDFL  135

Query  337  NLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLP  516
             + +N  +GS+P  IG L+++  LS   NN +GPIP EIGNL  L  LS   N+++G LP
Sbjct  136  KIDKNFFSGSLPAFIGNLSRLGLLSIAQNNFSGPIPKEIGNLKKLYLLSLGNNDLSGTLP  195

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            PELGNL  L E+YI+S  L+  IP   + LK +R++WAS N FTGK+P+F+G
Sbjct  196  PELGNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVG  247


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 75/193 (39%), Gaps = 51/193 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    +  EIP     LKEM  +  + N   G +P  +G  TK+  L F 
Sbjct  199  GNLVELGELYINSCGLSAEIPSSFANLKEMRIVWASDNAFTGKIPDFVGNWTKLTQLRFE  258

Query  418  TNNLTGPIPPEIGNLS----------------------------------ILIT------  477
             N+  GPIP    NL+                                  +L+T      
Sbjct  259  GNSFEGPIPSSFSNLTSLNSLRIGDIYNGSSSSLDFVRNLKNLTDLVLRNVLLTGNFPSY  318

Query  478  ---------LSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
                     L  + NN+ G +P  L N+ +L  +++ +N L+G IP +  K + L+ +  
Sbjct  319  ITELQSLQKLDLSFNNLTGQIPSTLFNMNSLIYLFLGNNSLSGSIPSQ--KSETLQTIDL  376

Query  631  SSNNFTGKLPEFL  669
            S N  +G LP ++
Sbjct  377  SYNFLSGNLPSWV  389



>gb|KDO77509.1| hypothetical protein CISIN_1g0380191mg, partial [Citrus sinensis]
Length=679

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 130/207 (63%), Gaps = 12/207 (6%)
 Frame = +1

Query  85   ITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDK---NASWAPLEA---NPRIACDCS-  237
            + D + V A+N I+  W+  +    N+S   PC     NA+ +  E+   NP I C+C+ 
Sbjct  1    MHDKHAVRALNSILQQWDAPAVPLWNISG-NPCSGSALNATDSEFESPNNNPAIVCNCTF  59

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
              G  CHI +L++YGL+  G IP+EL  L+ +  L + QN   G +P  IG L+++ +LS
Sbjct  60   DNGATCHITKLRVYGLNKKGVIPEELVTLQYLTVLKIDQNFFTGPLPSFIGNLSRLMFLS  119

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
            F  N+ +GP+P E+GNL  L  L+F TNN +G LPPELGNL  LE++YIDS    G IP 
Sbjct  120  FSHNDFSGPVPRELGNLKELTVLAFGTNNFSGALPPELGNLAKLEQLYIDSCGAGGEIPS  179

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              +KL+N++ LWAS N FTGK+P+F+G
Sbjct  180  TFAKLRNMQTLWASDNPFTGKIPDFIG  206


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 73/145 (50%), Gaps = 2/145 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I      GEIP     L+ M  L  + N   G +P  IG  TK+K L F 
Sbjct  158  GNLAKLEQLYIDSCGAGGEIPSTFAKLRNMQTLWASDNPFTGKIPDFIGNWTKLKSLRFQ  217

Query  418  TNNLTGPIPPEIGNLSILITLSFA-TNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP  +  L+ L +L  +   N++  L   + +L  L ++ + +  +TG IP  
Sbjct  218  GNSFQGPIPSSLSKLASLESLQMSDIYNVSSSLDFVM-SLKNLTDLSLRNALITGTIPFG  276

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
            + +L+ L++L  S NN TG++P  L
Sbjct  277  IGELQMLQILDLSFNNLTGQIPATL  301



>gb|KDP25093.1| hypothetical protein JCGZ_22628 [Jatropha curcas]
Length=1035

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 133/223 (60%), Gaps = 10/223 (4%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVN-------LSSFEPCDKNAS  192
            +   ++G+++        TD NE  A+N I   W +++  N       L S      + +
Sbjct  17   YCICMIGIVHAQNQTQATTDSNEASALNSIFQQWGIQANQNQWNISGELCSGAALGSSPT  76

Query  193  WAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
                E NP I CDCS   GT CHI  LK+Y +D+VG IP EL+ L  + ++ L QN L G
Sbjct  77   TDDGEYNPFIKCDCSDNNGTTCHITALKVYAIDVVGVIPDELWTLTFLTNMKLDQNYLTG  136

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
            ++ P IG LT+M++L+ G N+L+G +P E+G L+ L +L F +NN +GPLP ELGN + L
Sbjct  137  NLSPSIGNLTRMQYLTVGINSLSGELPKELGLLTDLRSLGFGSNNFSGPLPSELGNCSRL  196

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E++Y  S+ ++G IP   + L+N+  +WAS    TG++P+F+G
Sbjct  197  EQIYFGSSGVSGEIPPTFANLRNMVTVWASDTELTGRIPDFIG  239


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 10/151 (7%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP  L  L  + +L ++ ++ NGS    +  L  MK L
Sbjct  236  DFIGNWSKLVTLRFEGNSFEGPIPSALSNLTSLTELRIS-DLSNGS--SSLAFLKDMKSL  292

Query  409  S---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            +      +N++  IP  IG    L  L ++ NN+ G +P  L NL+ L  +++ +N+L G
Sbjct  293  TVLVLRNDNISDSIPSSIGEYQNLTQLDWSFNNIIGRIPDSLFNLSQLSFLFLGNNKLEG  352

Query  580  PIP-EELSKLKNLRVLWASSNNFTGKLPEFL  669
            P+P +++S L N+ V   S NN +G LP ++
Sbjct  353  PLPAQKVSSLLNVDV---SYNNLSGSLPSWV  380



>ref|XP_008353269.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Malus domestica]
Length=671

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 128/209 (61%), Gaps = 15/209 (7%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKNA-SWAPLEA-------NPRIACDC  234
            TDP+EV A+N I + W+ ++   + N+S  EPC  +A +    E+       NP I CDC
Sbjct  56   TDPSEVRALNSIFEQWDTQAMSGQWNISG-EPCSGSAINGTDFESPNDIPDINPAIECDC  114

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            +   GT CHI +LK+Y L+  G  P+E   L+ +  L +  N   G +P  IG ++ M  
Sbjct  115  TYNNGTTCHITKLKVYQLNKRGVFPEEFVALRYLTILRIDYNYFTGPLPAFIGNMSAMTV  174

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    N+ +GPIP E+GNL  L  LS  +NN +GP+PPELGNL  LE +Y+DS  L+G I
Sbjct  175  LYIRFNSFSGPIPKELGNLKELTVLSIGSNNFSGPIPPELGNLVKLERLYMDSCGLSGEI  234

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   +KL N++VLWAS N F+GK+P+F+G
Sbjct  235  PSTFAKLANMQVLWASDNPFSGKIPDFIG  263


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            LK ++DL L   ++ G++P  IG+   ++ L    N L G +P  + NLS L +L    N
Sbjct  313  LKNLIDLKLRNALITGTIPSGIGEYQSLQTLDLSFNTLAGQLPSSLFNLSSLTSLFLGNN  372

Query  496  NMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNF  645
            +++GPLP +  +   L+ + + +N L+G +P+ ++ +  L +++   NNF
Sbjct  373  SLSGPLPSQXSB--QLZTIDLSNNFLSGSLPQWVTTISQLNLVF---NNF  417



>ref|XP_010480178.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Camelina sativa]
Length=1028

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 134/224 (60%), Gaps = 14/224 (6%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNL--RSKVNLSSFEPCDKNASWAPL  204
            F + G ++ V +Q+     T P+E  A+N I   W +  RSK N+S  E C   A  A +
Sbjct  17   FCIAGSVHVVRSQNQTGATTHPDEARALNSIFAAWKIQERSKWNISG-ELCTGAAIDASV  75

Query  205  -----EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
                   NP I CDCS    T C IN +K+Y LD+ G IP+EL+ L  + +LNL QN L 
Sbjct  76   LDTNTAFNPLIKCDCSFENSTICRINNIKVYALDVKGPIPQELWTLTFLTNLNLGQNFLT  135

Query  361  GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            GS+PP IG LT+M+W++FG N L+GP+P EIG L+ L  LS  +NN +G +P E+GN T 
Sbjct  136  GSLPPAIGNLTRMQWMTFGINALSGPLPKEIGLLTDLRLLSIGSNNFSGSIPDEIGNCTK  195

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            L+++YIDS+ L+G IP   +    L   W      TG++P+F+G
Sbjct  196  LQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIPDFIG  239


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 97/198 (49%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS     +   +W   LE   +I  D  G +  + 
Sbjct  187  PDEIGNCTKLQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIP-DFIGKWTKLT  245

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  246  TLRILGTGLSGPIPSSFANLTALTELRLG-DISNGSSSLEFIKDMKSLSVLVLRNNNLTG  304

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K+++L
Sbjct  305  TIPSTIGGYSSLQQVDLSFNKLHGPIPASLFNLSLLTHLFLGNNTLNGSLPTQ--KIQSL  362

Query  616  RVLWASSNNFTGKLPEFL  669
              +  S N+ +G LP ++
Sbjct  363  SNIDVSYNDLSGSLPSWV  380



>ref|XP_010480179.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X3 [Camelina sativa]
Length=1013

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 134/224 (60%), Gaps = 14/224 (6%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNL--RSKVNLSSFEPCDKNASWAPL  204
            F + G ++ V +Q+     T P+E  A+N I   W +  RSK N+S  E C   A  A +
Sbjct  17   FCIAGSVHVVRSQNQTGATTHPDEARALNSIFAAWKIQERSKWNISG-ELCTGAAIDASV  75

Query  205  -----EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
                   NP I CDCS    T C IN +K+Y LD+ G IP+EL+ L  + +LNL QN L 
Sbjct  76   LDTNTAFNPLIKCDCSFENSTICRINNIKVYALDVKGPIPQELWTLTFLTNLNLGQNFLT  135

Query  361  GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            GS+PP IG LT+M+W++FG N L+GP+P EIG L+ L  LS  +NN +G +P E+GN T 
Sbjct  136  GSLPPAIGNLTRMQWMTFGINALSGPLPKEIGLLTDLRLLSIGSNNFSGSIPDEIGNCTK  195

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            L+++YIDS+ L+G IP   +    L   W      TG++P+F+G
Sbjct  196  LQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIPDFIG  239


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 97/198 (49%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS     +   +W   LE   +I  D  G +  + 
Sbjct  187  PDEIGNCTKLQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIP-DFIGKWTKLT  245

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  246  TLRILGTGLSGPIPSSFANLTALTELRLG-DISNGSSSLEFIKDMKSLSVLVLRNNNLTG  304

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K+++L
Sbjct  305  TIPSTIGGYSSLQQVDLSFNKLHGPIPASLFNLSLLTHLFLGNNTLNGSLPTQ--KIQSL  362

Query  616  RVLWASSNNFTGKLPEFL  669
              +  S N+ +G LP ++
Sbjct  363  SNIDVSYNDLSGSLPSWV  380



>ref|XP_008225769.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103325393 
[Prunus mume]
Length=2198

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 129/210 (61%), Gaps = 9/210 (4%)
 Frame = +1

Query  70   IAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA----SWAPLEANPRIACD  231
            +AQ+  TDP+EV A+N I + W+ ++   L   S EPC  +A     +     NP I CD
Sbjct  32   MAQNATTDPSEVRALNSIFEQWDAQAVPGLWNISGEPCSGSAINGTEFEDPANNPAIICD  91

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            C+    T CHI +L++Y L+  G  P+E   L+ +  L + QN   G +P  IG ++ + 
Sbjct  92   CTYEKSTTCHITKLRVYALNKQGVFPQEFVALRYLTVLKIDQNYFTGPLPAFIGNMSTLT  151

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             LS   N+ +GPIP E+GNL+ L +LSF +NN +G LPPELGNL  LE+ Y+DS  L+G 
Sbjct  152  SLSIAINSFSGPIPKELGNLTELTSLSFGSNNFSGTLPPELGNLVKLEQWYMDSCGLSGE  211

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   +KL N+++LWAS   F+GK+P F+G
Sbjct  212  IPSTFAKLINMQILWASDVAFSGKIPAFIG  241


 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 125/210 (60%), Gaps = 10/210 (5%)
 Frame = +1

Query  70    IAQSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNA----SWAPLEANPRIACD  231
             +AQ+  TDP+EV A+N I + W+ ++    N+S  EPC  +A     +     NP I CD
Sbjct  1187  MAQNATTDPSEVRALNSIFEQWDTQAGGLWNISG-EPCSGSAINGTEFEDPANNPAIICD  1245

Query  232   CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
             C+    T CHI +L++Y L+  G  P+E   L+ +  L + QN   G +P  IG ++ + 
Sbjct  1246  CTYEKSTTCHITQLRVYALNKQGVFPQEFVALRYLTYLKIDQNYFTGPLPAFIGNMSALT  1305

Query  403   WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
              LS   N+ +GPIP E+GNL  L  LS  +NN +G LPPELGNL  LEE+YI+S   +G 
Sbjct  1306  LLSIAHNSFSGPIPKELGNLKELKLLSIGSNNFSGTLPPELGNLVKLEELYINSGGFSGE  1365

Query  583   IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             IP   +KL N+++L AS    +GK+P F+G
Sbjct  1366  IPSTFAKLINMQILGASDIPLSGKIPAFIG  1395


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 5/132 (4%)
 Frame = +1

Query  253   INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
             +N L+I  +  V      +  LK + DL L   ++NGS+P +IG+  ++  L  G NNLT
Sbjct  1424  LNSLRISDIYNVSSSLDFISTLKNLTDLALRNALINGSIPTDIGEYQRLLILDLGFNNLT  1483

Query  433   GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
             G +P  + N+S L  L    N+++GPLP +  NL  L  + +  N  +G  P  ++    
Sbjct  1484  GQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSNL--LHTIDLSYNYFSGSFPPWVTTTLQ  1541

Query  613   LRVLWASSNNFT  648
             L ++    NNFT
Sbjct  1542  LNLV---VNNFT  1550


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 73/132 (55%), Gaps = 5/132 (4%)
 Frame = +1

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
            +N L+I  +  V      +  LK + +L L   ++NGS+P  IG+   ++ L+ G NNLT
Sbjct  270  LNTLRISDISNVSSSLDFIRNLKNLTELVLRNALINGSIPSNIGEYEGLQILNLGFNNLT  329

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
            G +P  + N+S L  L    N+++GPLP +  N   L+ + +  N L+G +P+ ++ +  
Sbjct  330  GQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSN--RLQTIDLSYNYLSGSLPQWVTTISQ  387

Query  613  LRVLWASSNNFT  648
            L ++    NNFT
Sbjct  388  LNLV---VNNFT  396


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 70/189 (37%), Gaps = 50/189 (26%)
 Frame = +1

Query  238   GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             G    +  L I      GEIP     L  M  L  +   L+G +P  IG  TK+  L F 
Sbjct  1347  GNLVKLEELYINSGGFSGEIPSTFAKLINMQILGASDIPLSGKIPAFIGNWTKLTVLRFQ  1406

Query  418   TNNLTGPIPP------------------------------------------------EI  453
              N+  GPIP                                                 +I
Sbjct  1407  GNSFEGPIPTSFSQLTSLNSLRISDIYNVSSSLDFISTLKNLTDLALRNALINGSIPTDI  1466

Query  454   GNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWAS  633
             G    L+ L    NN+ G LP  L N+++L  +++ +N L+GP+P + S L  L  +  S
Sbjct  1467  GEYQRLLILDLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSNL--LHTIDLS  1524

Query  634   SNNFTGKLP  660
              N F+G  P
Sbjct  1525  YNYFSGSFP  1533



>ref|XP_010480176.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Camelina sativa]
Length=1065

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 134/224 (60%), Gaps = 14/224 (6%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNL--RSKVNLSSFEPCDKNASWAPL  204
            F + G ++ V +Q+     T P+E  A+N I   W +  RSK N+S  E C   A  A +
Sbjct  17   FCIAGSVHVVRSQNQTGATTHPDEARALNSIFAAWKIQERSKWNISG-ELCTGAAIDASV  75

Query  205  -----EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
                   NP I CDCS    T C IN +K+Y LD+ G IP+EL+ L  + +LNL QN L 
Sbjct  76   LDTNTAFNPLIKCDCSFENSTICRINNIKVYALDVKGPIPQELWTLTFLTNLNLGQNFLT  135

Query  361  GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            GS+PP IG LT+M+W++FG N L+GP+P EIG L+ L  LS  +NN +G +P E+GN T 
Sbjct  136  GSLPPAIGNLTRMQWMTFGINALSGPLPKEIGLLTDLRLLSIGSNNFSGSIPDEIGNCTK  195

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            L+++YIDS+ L+G IP   +    L   W      TG++P+F+G
Sbjct  196  LQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIPDFIG  239


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 97/198 (49%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS     +   +W   LE   +I  D  G +  + 
Sbjct  187  PDEIGNCTKLQQIYIDSSGLSGRIPLSFANFMELEQAWLVDLEVTGQIP-DFIGKWTKLT  245

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  246  TLRILGTGLSGPIPSSFANLTALTELRLG-DISNGSSSLEFIKDMKSLSVLVLRNNNLTG  304

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K+++L
Sbjct  305  TIPSTIGGYSSLQQVDLSFNKLHGPIPASLFNLSLLTHLFLGNNTLNGSLPTQ--KIQSL  362

Query  616  RVLWASSNNFTGKLPEFL  669
              +  S N+ +G LP ++
Sbjct  363  SNIDVSYNDLSGSLPSWV  380



>gb|KGN44274.1| hypothetical protein Csa_7G237890 [Cucumis sativus]
Length=1035

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 143/241 (59%), Gaps = 31/241 (13%)
 Frame = +1

Query  28   LGFSFFVLGLLNTVI-------AQSN---ITDPNEVVAINKIIDHW-------------N  138
            LGF F +  +++ V        AQ++   ITDP++  A+N +   W             N
Sbjct  7    LGFIFVLCAIVSIVSHLIVSSQAQNSPQPITDPDQARALNSVFRQWRISAPSGAWNISGN  66

Query  139  LRSKVNLSSFEPCDKNASWAPLEANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKEL  309
            L S   + +  P D N +      NP I CDCS    T C I +L +Y +++VG +P EL
Sbjct  67   LCSGRAVDTTTPIDTNGNL-----NPLIKCDCSANGSTTCLITQLHVYAMNVVGVLPPEL  121

Query  310  FVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFA  489
            + L  +  L L QN L G++   IG L++++ LS G N L+G +P E+G+LS L  L+F 
Sbjct  122  WTLTSLTYLKLDQNFLTGTLSSSIGALSELRTLSLGINALSGELPKELGSLSKLELLAFG  181

Query  490  TNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +NN +GPLP ELGNL+ L E+YIDS+ ++G IP   S+L+NL+++WAS N FTG++P+F+
Sbjct  182  SNNFSGPLPSELGNLSVLRELYIDSSGVSGGIPPSFSRLRNLQIVWASDNEFTGRIPDFI  241

Query  670  G  672
            G
Sbjct  242  G  242



>ref|XP_002894563.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70822.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=2002

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 137/222 (62%), Gaps = 14/222 (6%)
 Frame = +1

Query  37    SFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPLE-  207
             S +V+   N  +A    T P+E  A+N I   W +R+  + N+S  E C   A  A ++ 
Sbjct  1034  SVYVVRAQNRTVA---TTHPDEARALNSIFAAWRIRAPREWNISG-ELCSGAAIDASVQD  1089

Query  208   ----ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
                  NP I CDCS    T C I  +K+Y +++VG IP++L+ L+ + +LNL QNVL GS
Sbjct  1090  SNPAYNPLIKCDCSFENSTICRITNIKVYAMEVVGPIPQQLWTLEYLTNLNLGQNVLTGS  1149

Query  367   VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
             +PP IG LT+M+W++FG N L+GP+P EIG L+ L  LS ++NN +G +P E+G  T L+
Sbjct  1150  LPPAIGNLTRMQWMTFGINALSGPVPKEIGLLTNLKLLSISSNNFSGSIPDEIGRCTKLQ  1209

Query  547   EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             ++YIDS+ L+G IP   + L  L   W +    TG++P+F+G
Sbjct  1210  QIYIDSSGLSGRIPVSFANLVELEQAWIADMELTGQIPDFIG  1251


 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 130/231 (56%), Gaps = 15/231 (6%)
 Frame = +1

Query  25   ILGFS-FFVL--GLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKV------NLSSF  168
            IL F  +FVL  GL + V  Q+     TDP+E  A+N I   W + +         L S 
Sbjct  5    ILSFVLWFVLMSGLFHVVRPQNRTRATTDPDEARALNNIFRTWKITATKAWNISGELCSG  64

Query  169  EPCDKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               D + S   L  NP I CDCS    T C I  L+  G+D+ G IP++L+ L  + +LN
Sbjct  65   AAIDDSVSIDNLAFNPLIKCDCSFVDSTICRIVALRARGMDVAGPIPEDLWTLVYISNLN  124

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QN L G + P IG L +M+W++FG N L+GP+P EIG L+ L +L+   NN +G LP 
Sbjct  125  LNQNFLTGPLSPGIGNLNRMQWMTFGANALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPL  184

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E+GN T L +MYI S+ L+G IP   +   NL   W +    TG++P+F+G
Sbjct  185  EIGNCTRLVKMYIGSSGLSGEIPSSFANFVNLEEAWINDIQLTGQIPDFIG  235


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G ++ G IP     L  + +L L +     S    I ++  +  L
Sbjct  232  DFIGNWTKLTTLRILGTNLSGPIPSTFGNLISLTELRLGEISNINSSLQFIREMKSISVL  291

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + N + G +P  L N   L  +++ +N+L G +P
Sbjct  292  VLRNNNLTGTIPSNIGDYLWLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNKLNGSLP  351

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+  G LP ++
Sbjct  352  TQKSPSLSNIDV---SYNDLAGDLPSWV  376


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 68/167 (41%), Gaps = 28/167 (17%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKEL--FVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            G    + ++ I    + GEIP     FV  E   +N  Q  L G +P  IG  TK+  L 
Sbjct  187  GNCTRLVKMYIGSSGLSGEIPSSFANFVNLEEAWINDIQ--LTGQIPDFIGNWTKLTTLR  244

Query  412  FGTNNLTGPIPPEIGNLSILITLSFA------------------------TNNMNGPLPP  519
                NL+GPIP   GNL  L  L                            NN+ G +P 
Sbjct  245  ILGTNLSGPIPSTFGNLISLTELRLGEISNINSSLQFIREMKSISVLVLRNNNLTGTIPS  304

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +G+   L ++ +  N+LTG IP  L   + L  L+  +N   G LP
Sbjct  305  NIGDYLWLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNKLNGSLP  351


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 54/124 (44%), Gaps = 2/124 (2%)
 Frame = +1

Query  229   DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
             D  G    + ++ I    + G IP     L E+    +A   L G +P  IG  T +  L
Sbjct  1200  DEIGRCTKLQQIYIDSSGLSGRIPVSFANLVELEQAWIADMELTGQIPDFIGDWTNLTTL  1259

Query  409   SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                   L+GPIP    NL+ L  L    N +NG LP +     +L  + +  N L+G +P
Sbjct  1260  RILGTGLSGPIPASFSNLTSLTELFLGNNTLNGSLPTQ--KRQSLSNIDVSYNDLSGSLP  1317

Query  589   EELS  600
               +S
Sbjct  1318  SWVS  1321



>ref|XP_008663599.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
Length=1028

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 126/212 (59%), Gaps = 24/212 (11%)
 Frame = +1

Query  88   TDPNEVVAINKII--------DHWNLRSKVNLSSFEPCDKNASWAPL-----EANPRIAC  228
            TDP E  A+N +           WN+       S +PC   A+           NP I C
Sbjct  48   TDPVEAAAVNAVFAKLGQAATSAWNI-------SGDPCTGAATDGTNIDNDPTFNPAIKC  100

Query  229  DCS----GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTK  396
            +CS     T CH+ +LKIY L+  G IP+EL  L  + +LNLAQN L G +P  +G LT 
Sbjct  101  ECSVQNNRTVCHVTKLKIYALNAFGPIPQELQNLTRLTNLNLAQNYLTGPLPSFLGNLTA  160

Query  397  MKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLT  576
            M+++S G N L+G +P E+GNL  L++L   +N +NG LP ELGNL  LE++YIDS  L+
Sbjct  161  MQYMSLGINALSGSVPKELGNLVNLVSLGIGSNYLNGSLPSELGNLAKLEQLYIDSAGLS  220

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            GP+P   S+L  ++ LWAS N+FTG++P+++G
Sbjct  221  GPLPSSFSRLTRMKTLWASDNDFTGEIPDYIG  252



>ref|XP_004139892.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Cucumis sativus]
 ref|XP_004159184.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Cucumis sativus]
Length=1122

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 143/241 (59%), Gaps = 31/241 (13%)
 Frame = +1

Query  28   LGFSFFVLGLLNTVI-------AQSN---ITDPNEVVAINKIIDHW-------------N  138
            LGF F +  +++ V        AQ++   ITDP++  A+N +   W             N
Sbjct  94   LGFIFVLCAIVSIVSHLIVSSQAQNSPQPITDPDQARALNSVFRQWRISAPSGAWNISGN  153

Query  139  LRSKVNLSSFEPCDKNASWAPLEANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKEL  309
            L S   + +  P D N +      NP I CDCS    T C I +L +Y +++VG +P EL
Sbjct  154  LCSGRAVDTTTPIDTNGNL-----NPLIKCDCSANGSTTCLITQLHVYAMNVVGVLPPEL  208

Query  310  FVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFA  489
            + L  +  L L QN L G++   IG L++++ LS G N L+G +P E+G+LS L  L+F 
Sbjct  209  WTLTSLTYLKLDQNFLTGTLSSSIGALSELRTLSLGINALSGELPKELGSLSKLELLAFG  268

Query  490  TNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +NN +GPLP ELGNL+ L E+YIDS+ ++G IP   S+L+NL+++WAS N FTG++P+F+
Sbjct  269  SNNFSGPLPSELGNLSVLRELYIDSSGVSGGIPPSFSRLRNLQIVWASDNEFTGRIPDFI  328

Query  670  G  672
            G
Sbjct  329  G  329



>ref|NP_564709.2| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 sp|C0LGH3.2|Y5614_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g56140; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33348.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1033

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 130/205 (63%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E +A+N I   W +R+  + N+S  E C   A  A +       NP I CDCS   
Sbjct  36   THPDEALALNSIFAAWRIRAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFEN  94

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I  +K+Y +++VG IP++L+ L+ + +LNL QNVL GS+PP +G LT+M+W++FG
Sbjct  95   STICRITNIKVYAMEVVGSIPQQLWTLEYLTNLNLGQNVLTGSLPPALGNLTRMRWMTFG  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP EIG L+ L  LS ++NN +G +P E+G  T L+++YIDS+ L+G +P   
Sbjct  155  INALSGPIPKEIGLLTDLRLLSISSNNFSGSIPDEIGRCTKLQQIYIDSSGLSGGLPVSF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L  L   W +    TG++P+F+G
Sbjct  215  ANLVELEQAWIADMELTGQIPDFIG  239


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 94/198 (47%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L   + +S     +   +W A +E   +I  D  G +  + 
Sbjct  187  PDEIGRCTKLQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIP-DFIGDWTKLT  245

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NG+   E I  +  +  L    NNLTG
Sbjct  246  TLRILGTGLSGPIPASFSNLTSLTELRLG-DISNGNSSLEFIKDMKSLSILVLRNNNLTG  304

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  L  + N ++G +P  L NL  L  +++ +N L G +P +  K ++L
Sbjct  305  TIPSNIGEYSSLRQLDLSFNKLHGTIPASLFNLRQLTHLFLGNNTLNGSLPTQ--KGQSL  362

Query  616  RVLWASSNNFTGKLPEFL  669
              +  S N+ +G LP ++
Sbjct  363  SNVDVSYNDLSGSLPSWV  380



>gb|AGT17045.1| SHR5-receptor-like kinase [Saccharum hybrid cultivar R570]
Length=949

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLS---SFEPCDKNASWAPLEA------NPRIAC  228
            Q+  TDP EV A+N I+  W  ++  + +   S EPC   A  +  E       NP I C
Sbjct  31   QTPRTDPVEVAALNTILGRWGQKASRSPAWNISGEPCSGAAVDSSTEIDGNYYFNPGIKC  90

Query  229  DCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
            DCS    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L G +P  IGQ + M
Sbjct  91   DCSFNSNTICHITKLRVYALNVVGQIPSELQNLTYLSYLNLDQNYLTGPIPSFIGQFSAM  150

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N L+GP+P E+GNL+ L  L  + +N +G LP ELGNL+ LE++Y DS+  +G
Sbjct  151  QHLSLGFNPLSGPLPKELGNLTNLNLLGISLDNFSGGLPEELGNLSNLEQLYTDSSGFSG  210

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L+AS N+FTGK+P++ G
Sbjct  211  PFPWTFSKLKKLRILYASDNDFTGKIPDYFG  241


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P+EL  L  +  L    +  +G  P    +L K++ L    N+ TG IP   G+L+ 
Sbjct  186  GGLPEELGNLSNLEQLYTDSSGFSGPFPWTFSKLKKLRILYASDNDFTGKIPDYFGSLTN  245

Query  469  LITLSFATNNMNGPLPPEL------------------------GNLTTLEEMYIDSNRLT  576
            L  L F  N+  GP+P  L                         NLT+L  + + + +++
Sbjct  246  LEDLGFQGNSFVGPIPASLSNLTRLTNLMVGDIVNGSSSLAFISNLTSLSTLILRNCKVS  305

Query  577  GPIPE-ELSKLKNLRVLWASSNNFTGKLPE  663
            G +   ++SKL NL +L  S NN TG++P+
Sbjct  306  GNLGTVDISKLTNLILLDLSFNNITGQVPQ  335


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 74/148 (50%), Gaps = 5/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP-PEIGQLTKMKW  405
            D  G+  ++  L   G   VG IP  L  L  + +L +  +++NGS     I  LT +  
Sbjct  238  DYFGSLTNLEDLGFQGNSFVGPIPASLSNLTRLTNL-MVGDIVNGSSSLAFISNLTSLST  296

Query  406  LSFGTNNLTGPIPP-EIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
            L      ++G +   +I  L+ LI L  + NN+ G +P  +  L  LE +++ +NRLTG 
Sbjct  297  LILRNCKVSGNLGTVDISKLTNLILLDLSFNNITGQVPQSILTLDKLEFLFLGNNRLTGS  356

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEF  666
            +P+  +K  +L+ L  S N  TG  P +
Sbjct  357  LPD--AKSASLKNLDFSYNQLTGNFPSW  382



>ref|XP_007214610.1| hypothetical protein PRUPE_ppa000890mg [Prunus persica]
 gb|EMJ15809.1| hypothetical protein PRUPE_ppa000890mg [Prunus persica]
Length=968

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 128/210 (61%), Gaps = 9/210 (4%)
 Frame = +1

Query  70   IAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA----SWAPLEANPRIACD  231
            ++ +  TDP+EV A+N I + W+ + +  L   S +PC  +A     +   E NP I CD
Sbjct  30   VSMAEKTDPSEVRALNSIFEQWDTKPRAGLWNISGDPCSGSALNGTEFEKPENNPAITCD  89

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            C+      CHI++L+++ L+  G  P+E   L+ +  LN+ QN   G +P  IG ++ + 
Sbjct  90   CTYDKNATCHISKLRVFSLNKQGVFPEEFVALRYLTFLNIDQNYFTGPLPAFIGNMSALT  149

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             LS   N+ +GPIP E+GNL  L  LSF +NN +G LPPELGNL  LEE+YI+S  L+G 
Sbjct  150  ILSIAQNSFSGPIPKELGNLKELTMLSFGSNNFSGTLPPELGNLVKLEELYIESCGLSGE  209

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   +KL N+R+L AS   F+GK+P F+G
Sbjct  210  IPSTFAKLINMRILHASDIAFSGKIPAFIG  239


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 66/140 (47%), Gaps = 5/140 (4%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G +  +  L+  G    G IP     L  + DL ++      S    I  L  +K L+ G
Sbjct  239  GNWTKLTDLRFQGNSFEGPIPTNFSQLTSLNDLRISDISNVSSSLDFIRNLKNLKVLNLG  298

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             NNLTG +P  + N+S L  L    N+++GPLP +   L  L  + +  N L+G  P  +
Sbjct  299  FNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQ--RLDRLHTIDLSYNYLSGSFPAWV  356

Query  598  SKLKNLRVLWASS---NNFT  648
            + L  L V + S+   NNFT
Sbjct  357  TPLLQLYVSFLSNLVVNNFT  376



>ref|NP_001055039.1| Os05g0257100 [Oryza sativa Japonica Group]
 dbj|BAF16953.1| Os05g0257100, partial [Oryza sativa Japonica Group]
Length=555

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLR--SKVNLSSFEPCDKNAS----WAPL-EANPRIACDCS---  237
            TDP E  A+N I+  W  +  S+ N+S  E C   AS    W      NP I CDCS   
Sbjct  31   TDPTEAAALNTILGRWGKKASSEWNISG-ELCSGLASDKTNWDDYPNINPFIKCDCSYNN  89

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             + CHI +L++Y L++VG++P EL     M DLNLA N L+G VP  IG+ T M++L+  
Sbjct  90   NSVCHIIKLRVYKLNVVGQLPSELQNFTYMEDLNLAYNYLSGVVPSFIGKFTSMEYLNLA  149

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+G +P EIGNL+ L+ L  + NN  G LP ELGNL  LE++YIDS+  +GP P   
Sbjct  150  FNPLSGQLPKEIGNLTNLLMLGVSFNNFTGELPEELGNLVKLEQLYIDSSGFSGPFPLTF  209

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKL+ L++L A  N+FTGK+P+  G
Sbjct  210  SKLQRLKILRAQDNDFTGKIPDNFG  234


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 75/171 (44%), Gaps = 30/171 (18%)
 Frame = +1

Query  241  TFCHINRLKIYGL---DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            TF  + RLKI      D  G+IP     +  + D+    N   G +P  + +LTK+  L 
Sbjct  208  TFSKLQRLKILRAQDNDFTGKIPDNFGSMSSLEDMAFQGNSFEGPIPASLSKLTKLTNLR  267

Query  412  FG-----------TNNLTG---------PIPPEIG-----NLSILITLSFATNNMNGPLP  516
             G            +NLT           I   +G       + L  L  + NN  G +P
Sbjct  268  IGDIVNGSSSLAFISNLTSLSNMILRNCRISGNLGLVDFSKFANLTYLDLSFNNFTGQIP  327

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
              + NL +LE +++ +N LTG +P+ +S   +L+ L  S N  +G+ P ++
Sbjct  328  QSILNLGSLEFLFLGNNSLTGSLPDPIS--SSLKTLDFSYNQLSGRFPSWV  376



>ref|XP_004976815.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Setaria italica]
Length=1049

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 118/181 (65%), Gaps = 10/181 (6%)
 Frame = +1

Query  157  LSSFEPC------DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKEL  309
             S  +PC      D +    P + NP I CDC+    T CHI RLK+Y L++ G IP+EL
Sbjct  94   FSGVDPCAGAATDDTDVDNDP-KMNPGIKCDCTYQNNTVCHITRLKMYALNLAGPIPEEL  152

Query  310  FVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFA  489
              L  +  LNL QN L G +P  +G+LT +++LS   N L+G +P E+G L  LI L  +
Sbjct  153  RNLTHLTSLNLMQNYLTGPIPSFLGELTALQYLSLAMNALSGSVPKELGKLVNLIALGIS  212

Query  490  TNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
             NN+NG LPPELGN+  LE++YIDS+ L+GP+P   SKL +L+ LWAS N+FTG++P+++
Sbjct  213  INNLNGSLPPELGNMVKLEQLYIDSSGLSGPLPPSFSKLTSLKTLWASDNDFTGQIPDYI  272

Query  670  G  672
            G
Sbjct  273  G  273



>ref|XP_002894560.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70819.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1058

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 133/221 (60%), Gaps = 15/221 (7%)
 Frame = +1

Query  52   GLLNTVIAQSN----ITDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPLE--  207
            G ++ V+   N     T P++  A+N I   W +R+  + N+S  E C   A  A ++  
Sbjct  21   GSVHVVVRAQNRTRATTHPDDARALNSIFATWKIRAPKEWNMSG-ELCSGVAIDASVQDT  79

Query  208  ---ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSV  369
                NP I CDCS    T C IN +K+Y +D+VG IP+EL+ L  + +LNL QN L GS+
Sbjct  80   NPAYNPLIKCDCSFENSTICRINNIKVYAIDVVGPIPQELWTLIFLTNLNLGQNYLTGSL  139

Query  370  PPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEE  549
            PP IG LT+M+W++FG N L+GPIP EIG L+ L  L  ++NN +G +P E+G+ T L++
Sbjct  140  PPAIGNLTRMQWMTFGINALSGPIPKEIGLLTDLRLLGISSNNFSGSIPAEIGSCTKLQQ  199

Query  550  MYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            MYIDS+ L+G IP   +    L V W      TG +P+F+G
Sbjct  200  MYIDSSGLSGEIPLSFANFVELEVAWIMDVELTGPIPDFIG  240


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 77/148 (52%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+I G  + G IP     L  + +L L  ++ NGS   + I  +  +  
Sbjct  237  DFIGKWTKLTTLRILGTGLRGPIPSSFSNLTSLTELRLG-DISNGSSSLDFIKDMKSLSV  295

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    +NLTG IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +
Sbjct  296  LVLRNSNLTGTIPSTIGGYSSLQQVDLSFNKLHGPIPASLFNLSRLTHLFLGNNTLNGSL  355

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P    K ++LR +  S N+F+G LP ++
Sbjct  356  PT--LKGQSLRNVDVSYNDFSGSLPSWV  381



>ref|XP_010501248.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Camelina sativa]
Length=1030

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 134/222 (60%), Gaps = 14/222 (6%)
 Frame = +1

Query  46   VLGLLNTVIAQSN---ITDPNEVVAINKIIDHWNL--RSKVNLSSFEPCDKNASWAPL--  204
            + G ++ V +Q+    IT P+E  A+N I   W +  RSK N+S  E C   A  A +  
Sbjct  21   IAGSVHVVRSQNQTGAITHPDEARALNSIFAAWKIQERSKWNISG-ELCTGAAIDASVLD  79

Query  205  ---EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
                 NP I CDCS    T C IN +K+Y LD+ G IP+EL+ L  + +LNL QN+L GS
Sbjct  80   TNTAFNPLIKCDCSFENSTICRINNIKVYALDVKGPIPQELWTLTFLTNLNLGQNLLTGS  139

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +PP IG LT+M+W++ G N L+GP+P EIG L+ L  L   +NN +G +P E+G+ T L+
Sbjct  140  LPPAIGNLTRMQWMTLGINALSGPLPKEIGLLTDLRLLGIGSNNFSGSIPAEIGSCTKLQ  199

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +MYIDS+ L+G IP   +   +L   W      TG++P+F+G
Sbjct  200  QMYIDSSGLSGEIPLSFANFLDLEQAWIMDLELTGQIPDFIG  241


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 8/197 (4%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L  ++ LS     D   +W   LE   +I  D  G +  + 
Sbjct  189  PAEIGSCTKLQQMYIDSSGLSGEIPLSFANFLDLEQAWIMDLELTGQIP-DFIGNWTKLT  247

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             L+I G  + G IP     L  + +L L      GS    I  +  +  L    NNLTG 
Sbjct  248  TLRIVGTGLSGPIPSSFSRLISLTELRLGDISNGGSSLDFIKDMKNLSTLVLRNNNLTGT  307

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            IP  IG  S L  +  + N + GP+P  L NL+ L  +++ +N L G +P +  K ++L 
Sbjct  308  IPSNIGGYSSLQQVDLSFNKLQGPIPASLFNLSELALLFLGNNTLNGSLPTQ--KGQSLS  365

Query  619  VLWASSNNFTGKLPEFL  669
             +  S N+ +G LP ++
Sbjct  366  TVDVSYNDLSGSLPSWV  382



>ref|XP_011069383.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Sesamum indicum]
Length=1042

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 132/216 (61%), Gaps = 10/216 (5%)
 Frame = +1

Query  55   LLNTVIAQ----SNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNA--SWAPLEAN  213
            L++T  AQ    +  TDP E  A+N +   W + +  N + S E C   A      +  N
Sbjct  25   LMDTAGAQNRTTTATTDPLEARALNAMFARWRISATNNWNISGELCSGVAIDDTEIITLN  84

Query  214  PRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIG  384
            P I CDC+    T CHI  L++Y LDI G IP EL+ L  M DLNLA+N L G +P  IG
Sbjct  85   PGIKCDCTYNNRTTCHITALRVYELDITGTIPDELWNLTYMDDLNLARNYLTGPIPASIG  144

Query  385  QLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS  564
             L +M++LSFG N L+G +P E+G L+ L +LSF  NN++GPLP ELGNL+ L ++Y DS
Sbjct  145  ILNRMQYLSFGENALSGEVPRELGLLTDLRSLSFNRNNLSGPLPAELGNLSRLAQIYFDS  204

Query  565  NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            + ++G IP   + L++L  +W S    TG++P+F+G
Sbjct  205  SGVSGQIPPTFANLRSLERVWGSDTELTGQIPDFIG  240


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 75/159 (47%), Gaps = 14/159 (9%)
 Frame = +1

Query  217  RIACDCSG-------TFCHINRL-KIYGLD--IVGEIPKELFVLKEMMDLNLAQNVLNGS  366
            +I  D SG       TF ++  L +++G D  + G+IP  +     ++ L    N   G 
Sbjct  199  QIYFDSSGVSGQIPPTFANLRSLERVWGSDTELTGQIPDFIGNWSNLIQLRFHGNSFQGL  258

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPP--EIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            +PP    LT +  L      L+  IP    + N++ L TL    NN++G +P  LG L +
Sbjct  259  LPPSFSSLTSLNDLRI--TELSNGIPSLDFLRNMTSLATLVLRNNNISGSIPSFLGELPS  316

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKL  657
            L  + +  N L G IP+ L   + L  L+  +N F+G L
Sbjct  317  LSLLDLSFNNLRGRIPDSLFNHRVLTNLYLGNNRFSGSL  355


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 71/149 (48%), Gaps = 6/149 (4%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP--EIGQLTKMK  402
            D  G + ++ +L+ +G    G +P     L  + DL + +  L+  +P    +  +T + 
Sbjct  237  DFIGNWSNLIQLRFHGNSFQGLLPPSFSSLTSLNDLRITE--LSNGIPSLDFLRNMTSLA  294

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             L    NN++G IP  +G L  L  L  + NN+ G +P  L N   L  +Y+ +NR +G 
Sbjct  295  TLVLRNNNISGSIPSFLGELPSLSLLDLSFNNLRGRIPDSLFNHRVLTNLYLGNNRFSGS  354

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +  + S    LR +  S N  +G  P ++
Sbjct  355  LSSQKSPF--LRNIDLSYNELSGSFPSWV  381



>gb|EYU33781.1| hypothetical protein MIMGU_mgv1a000612mg [Erythranthe guttata]
Length=1044

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 132/225 (59%), Gaps = 12/225 (5%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSN-----ITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNA--  189
            +S F+LG L       N      TDP E   +N+I   W  ++  + + S E C   A  
Sbjct  18   WSVFILGQLVDFAGAQNSTTNATTDPAEARIVNRIFQLWRRQATRDWNISGELCTGVAID  77

Query  190  SWAPLEANPRIACDCS---GTFCHINRLKIYGL-DIVGEIPKELFVLKEMMDLNLAQNVL  357
            S      NP I CDC+    T C I  L++Y   DIVG IP EL+ L  + +LNL QN L
Sbjct  78   STDLNNINPGIKCDCTFNRSTVCRITGLRVYAFEDIVGPIPDELWSLTYLTNLNLGQNYL  137

Query  358  NGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
             G + P IG LT+M++LS G N L+GP+P E+G L+ L +LSF+TNN +GPLP ELG LT
Sbjct  138  TGPLSPSIGNLTRMQYLSLGINALSGPVPRELGLLTDLRSLSFSTNNFSGPLPSELGALT  197

Query  538  TLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L ++Y DS  ++GPIP   + L+ +  +W S N  TG++P+F+G
Sbjct  198  ELTQIYFDSAGVSGPIPPSFANLRKMERVWGSDNALTGRIPDFIG  242


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 76/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G++ ++ +L++ G    G IP     L  + DL +++ + NGS   + +  LT +  
Sbjct  239  DFIGSWTNLIQLRLQGNSFQGPIPASFSNLTALNDLRISE-LANGSSSLDFVRSLTAIST  297

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    +N++G I    G L  L  L  + NN+ G +P  L N ++L  +++ +N+LTG +
Sbjct  298  LVIRNSNISGSILSFFGELPSLSFLDLSFNNLTGTIPASLFNRSSLTNLFLGNNKLTGGL  357

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P    K  +LR +  S N  +G  P +L
Sbjct  358  PA--GKSPSLRTIDLSYNELSGSFPPWL  383



>ref|XP_010480181.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Camelina sativa]
Length=1028

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 138/231 (60%), Gaps = 26/231 (11%)
 Frame = +1

Query  40   FFV--LGLLNTVIAQSNI---TDPNEVVAINKIIDHWNL--RSKVNLSSFEPC-------  177
            FF+   G +  V AQ+     T P+E  A+N I   W +  RSK N+S  E C       
Sbjct  16   FFLCNFGSVQVVRAQNRTGATTYPDEARALNSIFAAWKIQERSKWNISG-ELCSGAAIDP  74

Query  178  ---DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               D N ++     NP I CDCS    T C I  +K++  ++VG IP+EL+ LK + +LN
Sbjct  75   NVLDDNPAY-----NPLIKCDCSFENSTICRITNIKVFAREVVGPIPEELWTLKYLTNLN  129

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QNVL GS+PP IG LT+M+W++FG N L+GPIP EIG L+ L  LS ++NN +G +P 
Sbjct  130  LGQNVLTGSLPPAIGNLTRMQWMTFGINALSGPIPKEIGFLTDLRLLSISSNNFSGSIPD  189

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E GN   L++++IDS+ L+G IP   + L +L   W +    TG++P+F+G
Sbjct  190  EFGNCAKLQQIFIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIPDFIG  240


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 90/185 (49%), Gaps = 6/185 (3%)
 Frame = +1

Query  121  IIDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHINRLKIYGLDIVGEI  297
             ID   L  ++ LS     D   +W A LE   +I  D  G +  +  L+I G  + G I
Sbjct  201  FIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIP-DFIGKWTKLTTLRILGTGLSGPI  259

Query  298  PKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILI  474
            P     L  + +L L  ++ NGS   E I  +  +  L    NNLTG IP  IG  S L 
Sbjct  260  PSSFANLTALTELRLG-DISNGSSSLEFIKDMKSLSVLVLRNNNLTGTIPSNIGGYSSLQ  318

Query  475  TLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGK  654
             +  + N ++GP+P  L NL  L  +++ +N L G +P +  K ++L  +  S N+ +G 
Sbjct  319  QVDLSFNKLHGPIPASLFNLIGLTHLFLGNNTLNGSLPTQ--KSQSLSYIDVSYNDLSGS  376

Query  655  LPEFL  669
            LP ++
Sbjct  377  LPSWV  381


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 69/168 (41%), Gaps = 24/168 (14%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G    + ++ I    + G IP     L ++    LA   + G +P  IG+ TK+  L
Sbjct  189  DEFGNCAKLQQIFIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIPDFIGKWTKLTTL  248

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFA------------------------TNNMNGPLP  516
                  L+GPIP    NL+ L  L                            NN+ G +P
Sbjct  249  RILGTGLSGPIPSSFANLTALTELRLGDISNGSSSLEFIKDMKSLSVLVLRNNNLTGTIP  308

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
              +G  ++L+++ +  N+L GPIP  L  L  L  L+  +N   G LP
Sbjct  309  SNIGGYSSLQQVDLSFNKLHGPIPASLFNLIGLTHLFLGNNTLNGSLP  356



>ref|XP_008668884.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
Length=284

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 134/206 (65%), Gaps = 12/206 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIID--HWNLRSKVNLSSFEPCDKNASWAPL-----EANPRIACDCSG--  240
            TDP E  A+N +         S+ N+S  +PC   A+   +       NP I C+CS   
Sbjct  48   TDPVEAAAVNAVFAKLRQTASSEWNISG-DPCTGIATDGTVIEDNGNFNPGIKCECSDQN  106

Query  241  --TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSF  414
              T CH+ +LKIY L+ VG IP+EL  L  +++L+L++N L GS+P  +G LT M++++ 
Sbjct  107  NITVCHVTKLKIYALNAVGPIPQELQNLTRLINLDLSKNYLTGSLPSFLGNLTAMQYMTL  166

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
            GTN L+G +P E+GNL  L++L F +N +NGPLP ELGNL  LE++YIDS  L+G +P  
Sbjct  167  GTNALSGSVPKELGNLVNLVSLGFGSNYLNGPLPWELGNLAKLEQLYIDSAGLSGLLPSS  226

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
            LS+L  + +LWAS N+FTG++P+++G
Sbjct  227  LSRLTRMNILWASDNDFTGQIPDYIG  252



>gb|EYU27557.1| hypothetical protein MIMGU_mgv1a018669mg [Erythranthe guttata]
Length=1046

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 138/213 (65%), Gaps = 13/213 (6%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNAS--WAPLEANPRIACDCS--  237
            A + +TDP+E  AIN I   W +++    + S E C   AS     L+ +P I CDCS  
Sbjct  35   ATTPVTDPSEARAINAIFARWRIKAGNGWNISGELCSGIASDDVTTLDFSPGIKCDCSYN  94

Query  238  -GTFCHINRLKIYGL-------DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLT  393
              T CH+  L++Y +       ++VG++P+EL+ L  +  LNLAQN L G +P  +G LT
Sbjct  95   NRTTCHVISLRVYSMSDWDSSSNVVGQLPRELWSLTYLTSLNLAQNYLTGPLPSSVGNLT  154

Query  394  KMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRL  573
            +M++LS   N L+G +P E+G L+ L +L+ +TNN +G LPPE+GN T LE+++IDS+ +
Sbjct  155  RMQYLSISINALSGELPNELGKLTDLRSLAVSTNNFSGSLPPEIGNCTRLEQLWIDSSGV  214

Query  574  TGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +G IP   ++L+N+++++AS N  TG++P+F+G
Sbjct  215  SGAIPSTFARLQNMQIVFASDNALTGRIPDFIG  247


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 74/149 (50%), Gaps = 8/149 (5%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G++  +  L+  G  + G IP     L  + DL +  ++ NGS P +   LT MK L
Sbjct  244  DFIGSWSQLTALRFEGTSLQGPIPSMFSNLTALTDLRIT-DLSNGSSPLDF--LTNMKSL  300

Query  409  S---FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            +      NN++G +P  +     L  L  + NN  G +P  L N ++L  +++ +N+LTG
Sbjct  301  TTLVLRNNNISGSVPSNLDGYPSLSLLDLSFNNFTGQIPDSLFNSSSLVHLFLGNNKLTG  360

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEF  666
             +P + + L  L+ +  S N  +G  P +
Sbjct  361  SLPSQKTSL--LQFIDLSYNELSGSFPSW  387



>ref|XP_006655140.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=986

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 129/209 (62%), Gaps = 11/209 (5%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLR--SKVNLSSFEPCDKNAS----WAPL-EANPRIACDC  234
            +  I + +   A+N I+  W ++  S+ N+S  E C   AS    W      NP I CDC
Sbjct  9    RDGIMEDDTAAALNTILGRWGIKASSEWNISG-ELCSGKASDKTNWDDYPNINPFIKCDC  67

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    + CHI +L+++ LD+VG+IP EL     M D+N+A N L+G VP   G+ T M++
Sbjct  68   SYKNNSVCHIIKLRVFKLDVVGQIPMELQNFTYMEDMNIAYNYLSGGVPSFFGKFTAMQY  127

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L+   N L+GP+P EIGNL+ L++L  + NN  G LP E+GNL  L+++YIDS+  +GP 
Sbjct  128  LNLAFNPLSGPLPKEIGNLTNLLSLGISFNNFTGRLPEEMGNLVKLQQLYIDSSGFSGPF  187

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKL+NL++L A  N+FTGK+P+  G
Sbjct  188  PSTFSKLQNLKILRAQDNDFTGKIPDNFG  216


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 72/171 (42%), Gaps = 30/171 (18%)
 Frame = +1

Query  241  TFCHINRLKIYGL---DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            TF  +  LKI      D  G+IP     +  + D+    N   G +P  +  LTK+  L 
Sbjct  190  TFSKLQNLKILRAQDNDFTGKIPDNFGSMSSLEDMAFQGNSFEGPIPASLSNLTKLTNLR  249

Query  412  FG-----------TNNLTG---------PIPPEIGNLSI-----LITLSFATNNMNGPLP  516
             G            +NLT           I   +G ++      L  L  + NNM G +P
Sbjct  250  LGDIVNGSSSLAFVSNLTSLSNLILRNCRISGNLGLINFSKFEKLTYLDLSFNNMTGQIP  309

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
              + NL  LE +++  N LTG +P+ +S   +L+ L  S N  TG  P ++
Sbjct  310  LSIVNLRNLEFLFLGDNNLTGSLPDVIS--SSLKTLDFSYNQLTGGFPSWV  358



>ref|XP_008371824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Malus domestica]
Length=271

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 132/228 (58%), Gaps = 9/228 (4%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA  189
            +M IL   F          AQ   TDP+EV A+N I + W+ ++   L   S EPC  +A
Sbjct  9    MMRILLLFFLSCFWFQLSFAQIATTDPSEVRALNSIFEQWDTQAVPGLWNISGEPCSGSA  68

Query  190  -SWAPLEA---NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
             +    E+   NP IACDC+   GT CHI +L++      G  P+E   L+ +  L + Q
Sbjct  69   INGTGFESEINNPAIACDCTYDNGTTCHITKLRVQARYKRGVFPEEFLALRYLAVLKIDQ  128

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N   G +P  IG ++ +  LS   N+ +GPIP E+GNL+ L  L+  +NN  G LP ELG
Sbjct  129  NYFKGPLPAFIGNMSALITLSIAHNSFSGPIPKELGNLTELNILAIGSNNFTGTLPLELG  188

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            NL  L+E+Y+DS+ L+G IP   +KL ++++ WA+ + F+GK+P+F+G
Sbjct  189  NLVKLQEIYMDSSGLSGEIPSTFAKLTSMQIFWATDSLFSGKIPDFIG  236



>ref|XP_009341192.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Pyrus x bretschneideri]
Length=1037

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 131/230 (57%), Gaps = 12/230 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKN  186
            +M IL   F          AQ+  TDP+EV A+N I + W+ ++   + N+S  EPC   
Sbjct  9    MMRILLLCFLSCFWFQLSFAQNATTDPSEVRALNSIFEQWDTQAEPGQWNISG-EPCSGY  67

Query  187  ASWA-----PLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL  342
            A         L  NP I C+CS      CHI  L +YGLD  G  P+E   L+ +  L +
Sbjct  68   AIKRTDINNSLYINPGIVCNCSYDNNATCHITNLTVYGLDKRGVFPEEFVALRYLTSLFI  127

Query  343  AQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPE  522
             +N   G +P  IG ++ +  L  GTN+ +GPIP E+GNL  L  L+  +NN +G LPPE
Sbjct  128  DKNYFTGPLPAFIGNMSALTELYIGTNSFSGPIPKELGNLKELTVLNIRSNNFSGTLPPE  187

Query  523  LGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            LGNL  LE ++IDS  L+G IP   +KL N+++ WAS N F+GK+P+F+G
Sbjct  188  LGNLVKLERLHIDSCGLSGEIPSTFAKLTNMQMFWASDNPFSGKIPDFIG  237


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 4/147 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+  G    G IP     L  +  L ++ ++ NGS   + I  +  +  
Sbjct  234  DFIGNWTQLTSLRFQGNSFEGPIPTSFSQLTSLNYLRIS-DIYNGSSSLDFIKNMKNLTE  292

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L      +TG IP +IG    L TL  + NN+ G LP  L NL+ L  +Y+ +N L+GP+
Sbjct  293  LQLRNAVITGTIPSDIGEFQSLETLDLSFNNLTGQLPSSLFNLSNLTSLYLGNNSLSGPL  352

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEF  666
            P +  K   L  +  S N  +G  PE+
Sbjct  353  PSQ--KSHQLETIDLSYNFLSGSFPEW  377



>ref|XP_009105697.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brassica rapa]
Length=639

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 123/204 (60%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T PNE  A+N I   W + +         L S    D   +      NP I CDC+    
Sbjct  37   THPNEARALNSIFAKWKIHAPREWNISGELCSGAAIDDGVTIDSRAYNPLIKCDCNFVNS  96

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  LK+Y +D+VG IP+EL+ L+ + +LNL QN L G +   IG LT+M+WL+FG 
Sbjct  97   TICRITALKVYAIDVVGTIPEELWTLEYLTNLNLGQNYLTGPLSRAIGNLTRMEWLTFGI  156

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GPIP EIG L  L +L+ ++NN +G +P E+G+ T L+++YIDS+ L+G IP   +
Sbjct  157  NALSGPIPKEIGLLRELKSLAVSSNNFSGSIPAEIGSCTKLQQIYIDSSGLSGEIPLSFA  216

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L +L+V+W      TG++P+F+G
Sbjct  217  NLVDLQVVWMMDLEVTGRIPDFIG  240


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 98/199 (49%), Gaps = 12/199 (6%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L  ++ LS     D    W   LE   RI  D  G +  + 
Sbjct  188  PAEIGSCTKLQQIYIDSSGLSGEIPLSFANLVDLQVVWMMDLEVTGRIP-DFIGNWTKLV  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    +NL G
Sbjct  247  SLRILGTGLSGPIPSSFSNLASLTELRLG-DISNGSSSLEFIKTMKSLSILVLRNSNLEG  305

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
             IP  IG  S L+ +  + N ++GP+P  L NL+ L  +++ +N+L G +P + S+ LKN
Sbjct  306  TIPSNIGEYSSLLQVDLSFNKLHGPIPTSLFNLSRLSHLFLGNNKLIGSLPTQKSQSLKN  365

Query  613  LRVLWASSNNFTGKLPEFL  669
            + V   S NN +G LP ++
Sbjct  366  IDV---SYNNLSGSLPSWV  381



>ref|XP_009106800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Brassica rapa]
Length=1025

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 132/225 (59%), Gaps = 12/225 (5%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVN------LSSFEPCDKN  186
            F   + G ++ V +Q+     TDP+E  A+N I   W  ++  +      L S     +N
Sbjct  11   FILCIFGSIHLVRSQNRTGATTDPDEARALNSIFAAWGKQAPRDWNISGQLCSGVAIGEN  70

Query  187  ASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVL  357
             +      NP I CDC+    T C I  LK+Y +D++G IP +L+ L  + +LNLAQN L
Sbjct  71   ITIDDKAYNPLIKCDCTFNGSTICRITALKVYAMDVIGPIPPQLWTLTHLTNLNLAQNFL  130

Query  358  NGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
             GS+ P IG LT+M+WL+FG N L+GP+P EIG L+ L +LS ++N  +G +P E+GN T
Sbjct  131  TGSLSPAIGNLTRMEWLTFGINALSGPVPKEIGLLTELKSLSISSNKFSGSIPAEIGNCT  190

Query  538  TLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+++Y+DS+  TG IP   + L  L+  W      TG++P+F+G
Sbjct  191  KLQQIYMDSSDFTGAIPSSFANLVELQTAWMMDLGVTGRIPDFIG  235


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 78/149 (52%), Gaps = 6/149 (4%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+I G D+ G IP     L  + +L L  ++ NGS   E I  +T +  
Sbjct  232  DFIGRWTKLTVLRIVGTDLSGPIPSSFSSLTSLTELRLG-DISNGSSSLEFIKDMTSLSV  290

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    +NLTG IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +
Sbjct  291  LVLRNSNLTGTIPSYIGQFSSLKQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSL  350

Query  586  PEELSK-LKNLRVLWASSNNFTGKLPEFL  669
            P + S+ L N+ V   S N+ +G  P ++
Sbjct  351  PTQKSQTLSNIDV---SYNDLSGIPPSWV  376



>emb|CDY42407.1| BnaA08g00070D [Brassica napus]
Length=1033

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 132/223 (59%), Gaps = 12/223 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNAS  192
            +F+ G ++ V AQ+     TDP+E  A+N I   W + +         L S    D + +
Sbjct  16   WFLSGSVHVVRAQNRTGATTDPDEARALNSIFAAWRIPAPREWNISGELCSGAAMDDSVT  75

Query  193  WAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
                  NP I CDC   S   C I  LK+Y +++VG IP +L+ L  + +LNL QNVL G
Sbjct  76   IDDKAYNPLIKCDCTFNSSKICRITALKVYAIEVVGPIPPQLWTLHYLTNLNLGQNVLTG  135

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
            S+PP IG LT+M++++FG N L+GP+P EIG L  L +L  ++NN +G +PPE+G+ T L
Sbjct  136  SLPPAIGNLTRMQYMTFGINALSGPVPKEIGLLKDLRSLGISSNNFSGSIPPEIGSCTKL  195

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++MYI S+ LTG IP+  + L  L   W +    TG +P+F+G
Sbjct  196  QKMYIGSSGLTGGIPQSFANLVQLEDAWITDLEVTGPIPDFIG  238


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 76/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI-GQLTKMKW  405
            D  G +  +  L+I G  + G IP     L  + +L L  ++ NGS   E    +  +  
Sbjct  235  DFIGNWTKLTTLRILGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLEFFKDMKSLST  293

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L F  +NLTG IP  IG  S L  +  + N + GP+P  L NL+ L  +++ +N L GP+
Sbjct  294  LVFRNSNLTGTIPSFIGEFSSLQQVDLSFNKLGGPIPASLFNLSRLTHLFLGNNTLNGPL  353

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P +  K + LR +  S N+ +G LP ++
Sbjct  354  PSQ--KSQTLRNIDVSYNDLSGSLPSWV  379



>ref|XP_009106801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Brassica rapa]
Length=1033

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 132/223 (59%), Gaps = 12/223 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNAS  192
            +F+ G ++ V AQ+     TDP+E  A+N I   W + +         L S    D + +
Sbjct  16   WFLSGSVHVVRAQNRTGATTDPDEARALNSIFAAWRIPAPREWNISGELCSGAAMDDSVT  75

Query  193  WAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
                  NP I CDC   S   C I  LK+Y +++VG IP +L+ L  + +LNL QNVL G
Sbjct  76   IDDKAYNPLIKCDCTFNSSKICRITALKVYAIEVVGPIPPQLWTLHYLTNLNLGQNVLTG  135

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
            S+PP IG LT+M++++FG N L+GP+P EIG L  L +L  ++NN +G +PPE+G+ T L
Sbjct  136  SLPPAIGNLTRMQYMTFGINALSGPVPKEIGLLKDLRSLGISSNNFSGSIPPEIGSCTKL  195

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++MYI S+ LTG IP+  + L  L   W +    TG +P+F+G
Sbjct  196  QKMYIGSSGLTGGIPQSFANLVQLEDAWITDLEVTGPIPDFIG  238


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 76/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI-GQLTKMKW  405
            D  G +  +  L+I G  + G IP     L  + +L L  ++ NGS   E    +  +  
Sbjct  235  DFIGNWTKLTTLRILGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLEFFKDMKSLST  293

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L F  +NLTG IP  IG  S L  +  + N + GP+P  L NL+ L  +++ +N L GP+
Sbjct  294  LVFRNSNLTGTIPSFIGEFSSLQQVDLSFNKLGGPIPASLFNLSRLTHLFLGNNTLNGPL  353

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P +  K + LR +  S N+ +G LP ++
Sbjct  354  PSQ--KSQTLRNIDVSYNDLSGSLPSWV  379



>ref|XP_010657565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Vitis vinifera]
Length=993

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 122/199 (61%), Gaps = 8/199 (4%)
 Frame = +1

Query  100  EVVAINKIIDHWNLRSKVNL-SSFEPCDKNA----SWAPLEANPRIACDCS---GTFCHI  255
            +V  +N I   W + +     +S EPC   A    S    + NP I CDCS    + CHI
Sbjct  6    KVRVLNSIFQQWGISASNQWNTSGEPCTGAAIDSTSIDSSDYNPGIKCDCSYDNASTCHI  65

Query  256  NRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTG  435
             +LK+Y LD+VG IP EL+ L  + +LNL QN L G +   IG LT M++LS G N L+G
Sbjct  66   TQLKVYALDVVGVIPDELWNLTFLTNLNLGQNYLTGPLSASIGNLTSMQYLSMGINALSG  125

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             +P E+G L+ L +L+F TNN +G LP E+GNL  LE++Y DS+ ++G IP   + L++L
Sbjct  126  ELPKELGQLTDLRSLAFGTNNFSGSLPSEIGNLVKLEQLYFDSSGVSGEIPSTFANLQSL  185

Query  616  RVLWASSNNFTGKLPEFLG  672
              +WAS N  TG +P+F+G
Sbjct  186  TTVWASDNELTGNIPDFIG  204



>ref|XP_009621779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nicotiana tomentosiformis]
Length=548

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  328  MDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNG  507
            MDLNL QNV+NG++P EI QL+KM++LS G NNLTGP+P E+G+L+ LI+LSF++NN NG
Sbjct  1    MDLNLGQNVINGTIPAEIRQLSKMQYLSLGINNLTGPVPAELGSLTNLISLSFSSNNFNG  60

Query  508  PLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            PLPP+LG L +L+++YIDS+ + GPIP ELS LK+L +LWAS N FTGKLPEF G
Sbjct  61   PLPPQLGKLISLQQLYIDSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFG  115


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            ++ G +P EL  L  ++ L+ + N  NG +PP++G+L  ++ L   ++ + GPIP E+ N
Sbjct  33   NLTGPVPAELGSLTNLISLSFSSNNFNGPLPPQLGKLISLQQLYIDSSGVNGPIPGELSN  92

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE---LSKLKNLRV  621
            L  L  L  + N   G LP   G+    + + ++   L GPIP     L KL++LR+
Sbjct  93   LKSLEILWASDNRFTGKLPEFFGHFMNFQVLRLEGTLLEGPIPSNYGVLIKLQDLRI  149


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I    + G IP EL  LK +  L  + N   G +P   G     + L   
Sbjct  67   GKLISLQQLYIDSSGVNGPIPGELSNLKSLEILWASDNRFTGKLPEFFGHFMNFQVLRLE  126

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
               L GPIP   G                        NL+ L  LS     + G LP +L
Sbjct  127  GTLLEGPIPSNYGVLIKLQDLRIGDLRNEDSSLDFIQNLTSLSILSLRNCRIIGQLPEKL  186

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +   LE + + SN+LTG IP       +LR L+  SNN +G+LP
Sbjct  187  SSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGELP  231


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
            I+G++P++L     +  L+L+ N L G +P        +++L  G+NNL+G +PP I + 
Sbjct  178  IIGQLPEKLSSFGNLEILDLSSNKLTGQIPRSFQDFASLRFLYLGSNNLSGELPPNIMS-  236

Query  463  SILITLSFATNNMNGPLPPELGNLT  537
            S L  L  + N+++G L P+   L+
Sbjct  237  SNLTALDVSFNSLSGDLTPKRSGLS  261



>gb|ACN59257.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=522

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 125/205 (61%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E  A+N I   W +++  + N+S  E C   A  A +       NP I CDCS   
Sbjct  37   THPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFQN  95

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I  +K+Y +D+VG IP EL+ L  + +LNL QNVL GS+PP IG LT+M+W++FG
Sbjct  96   STICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG  155

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIG L+ L  L  ++NN +G +P E+G  T L++MYIDS+ L+G IP   
Sbjct  156  INALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSF  215

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L  L   W +    T ++P+F+G
Sbjct  216  ANLVQLEQAWIADLEVTDQIPDFIG  240


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 8/197 (4%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS         +W A LE   +I  D  G +  + 
Sbjct  188  PDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIP-DFIGDWTKLT  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             L+I G  + G IP     L  + +L L       S    I  +  +  L    NNLTG 
Sbjct  247  TLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGT  306

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G  P +  K ++LR
Sbjct  307  IPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQ--KTQSLR  364

Query  619  VLWASSNNFTGKLPEFL  669
             +  S N+ +G LP ++
Sbjct  365  NVDVSYNDLSGSLPSWV  381



>gb|EMT06735.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1043

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 110/155 (71%), Gaps = 4/155 (3%)
 Frame = +1

Query  220  IACD-CSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
            I C+ C+G   + C I RLKIY LD VG IP+EL  L  + DL+L QN L G +P  IG+
Sbjct  104  IKCEVCTGGNTSVCRITRLKIYALDAVGPIPEELRNLTALTDLDLGQNYLTGPLPSFIGE  163

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            LT MK+++FG N L+GP+P E+GNL  LI L    NN +G LP ELGNL  LEE+YIDS+
Sbjct  164  LTDMKFMTFGINALSGPVPKELGNLKNLIKLGLGGNNFSGSLPSELGNLAKLEELYIDSS  223

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+GP+P  LS+L  ++ +WAS N+FTG++P+++G
Sbjct  224  GLSGPLPSSLSQLTKMKKVWASDNDFTGQIPDYIG  258


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 78/171 (46%), Gaps = 26/171 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G   ++ +L + G +  G +P EL  L ++ +L +  + L+G +P  + QLTKMK +   
Sbjct  186  GNLKNLIKLGLGGNNFSGSLPSELGNLAKLEELYIDSSGLSGPLPSSLSQLTKMKKVWAS  245

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-----------  564
             N+ TG IP  IG+ S L  L    N+  GP+P  L NL  L  + I             
Sbjct  246  DNDFTGQIPDYIGSWSSLTELRLQGNSFQGPIPATLSNLGQLASLRIGDILNGSSSSLAF  305

Query  565  -NRLTG--------------PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             N LT                +  + SK  +L +L+  +N+ +G LP  +G
Sbjct  306  VNNLTSLNTLVLRNCRISDKLVSIDFSKFTSLNLLFLGNNSLSGSLPSSVG  356



>ref|NP_176008.4| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE33346.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1047

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 125/205 (61%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P++  A+N I   W +R+  + N+S  E C   A  A +       NP I CDCS   
Sbjct  12   THPDDARALNSIFAAWKIRAPREWNISG-ELCSGVAIDASVLDSNHAYNPLIKCDCSFQN  70

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C IN +K+Y +D+VG IP EL+ L  + +LNL QN L GS+ P IG LT+M+W++FG
Sbjct  71   STICRINNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNYLTGSLSPAIGNLTRMQWMTFG  130

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP EIG L+ L  L  ++NN +G LP E+G+ T L++MYIDS+ L+G IP   
Sbjct  131  INALSGPIPKEIGLLTDLRLLGISSNNFSGSLPAEIGSCTKLQQMYIDSSGLSGGIPLSF  190

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            +    L V W      TG++P+F+G
Sbjct  191  ANFVELEVAWIMDVELTGRIPDFIG  215


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 94/198 (47%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L   + LS     +   +W   +E   RI  D  G +  + 
Sbjct  163  PAEIGSCTKLQQMYIDSSGLSGGIPLSFANFVELEVAWIMDVELTGRIP-DFIGFWTKLT  221

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   + I  +  +  L    NNLTG
Sbjct  222  TLRILGTGLSGPIPSSFSNLIALTELRLG-DISNGSSSLDFIKDMKSLSVLVLRNNNLTG  280

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  + L  +  + N ++GP+P  L NL+ L  +++ +N L G +P    K ++L
Sbjct  281  TIPSTIGGYTSLQQVDLSFNKLHGPIPASLFNLSRLTHLFLGNNTLNGSLPTL--KGQSL  338

Query  616  RVLWASSNNFTGKLPEFL  669
              L  S N+ +G LP ++
Sbjct  339  SNLDVSYNDLSGSLPSWV  356



>gb|KFK44732.1| hypothetical protein AALP_AA1G295500 [Arabis alpina]
Length=1012

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 126/218 (58%), Gaps = 9/218 (4%)
 Frame = +1

Query  46   VLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVN------LSSFEPCDKNASWAPLE  207
            VL  L+  +   N TDP E  ++N I   W +++         L S    D + +     
Sbjct  9    VLFFLSGSVRAQNRTDPEEARSLNSIFATWKIQASKEWNISGELCSGAAIDDSITIDDNT  68

Query  208  ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
             NP I C C+    T CHI  LK+Y +D+VG IP +L+ L  + +LNLAQNVL GS+ P 
Sbjct  69   YNPLIKCRCNFLNSTICHITALKVYAIDVVGPIPPQLWTLIHLTNLNLAQNVLTGSLSPA  128

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IG   +M+W++FG N L+G +P EIG L+ L  LS ++NN +G LP E+GN   L +MYI
Sbjct  129  IGSFIRMEWMTFGINALSGSVPKEIGLLTELKLLSISSNNFSGSLPAEIGNCKKLVQMYI  188

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            DS+ LTG IP   + L  L V+W      TG++P+F+G
Sbjct  189  DSSGLTGEIPLSFANLVELEVVWIMDLGVTGRIPDFIG  226


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 77/149 (52%), Gaps = 6/149 (4%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+I+G  + G IP     L  + +L L  ++ N S   E I  +  +  
Sbjct  223  DFIGKWTKLTTLRIFGTGLSGPIPLSFSNLTSLTELRLG-DISNVSSSFEFIKDMKSLSV  281

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NNLTG IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +
Sbjct  282  LVLRNNNLTGTIPSNIGEYSSLQQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNSLNGSL  341

Query  586  PEELS-KLKNLRVLWASSNNFTGKLPEFL  669
            P +++  L N+ V   S N+ +G LP ++
Sbjct  342  PAQITYSLDNIDV---SYNDLSGSLPSWI  367



>ref|XP_002894562.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70821.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1031

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 136/222 (61%), Gaps = 14/222 (6%)
 Frame = +1

Query  46   VLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL--  204
            + G ++ V +Q+     T P+E  A+N I   W +++  + N+S  E C   A  A +  
Sbjct  20   IAGSVHVVRSQNQTGATTHPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLD  78

Query  205  ---EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
                 NP I CDCS    T C I  +K+Y +D+VG IP+EL+ L  + +LNL QNVL GS
Sbjct  79   TNPAYNPLIKCDCSFENSTICRITNIKVYAVDVVGPIPQELWTLIFLTNLNLGQNVLTGS  138

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            +PP IG LT+M+W++FG N L+GP+P EIG L+ L  LS ++NN +G +P E+GN   L+
Sbjct  139  LPPAIGNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLSISSNNFSGSIPDEIGNCAKLQ  198

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YIDS+ L+G IP   + L  L   W +    TG++P+F+G
Sbjct  199  QIYIDSSGLSGRIPLSFANLVELEQAWIADLEVTGQIPDFIG  240


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 98/198 (49%), Gaps = 10/198 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS     +   +W A LE   +I  D  G++  + 
Sbjct  188  PDEIGNCAKLQQIYIDSSGLSGRIPLSFANLVELEQAWIADLEVTGQIP-DFIGSWTKLT  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   + I  +  +  L    NNLTG
Sbjct  247  TLRILGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLDFIKDMKSLSVLVLRNNNLTG  305

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K + L
Sbjct  306  TIPSTIGGYSSLQQVDLSFNKLHGPIPASLFNLSRLTHLFLGNNTLNGSLPTQ--KTQTL  363

Query  616  RVLWASSNNFTGKLPEFL  669
            R +  S N+ +G LP ++
Sbjct  364  RNVDVSYNDLSGSLPSWV  381



>ref|XP_004976817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Setaria italica]
Length=1029

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 136/211 (64%), Gaps = 23/211 (11%)
 Frame = +1

Query  88   TDPNEVVAINKII--------DHWNLRSKVNLSSFEPCDKNASWAP-LEA----NPRIAC  228
            TDP E  A+N +           WN+       S +PC   A+    ++     NP I C
Sbjct  41   TDPVEAAAVNAVFAKLGQTASSAWNI-------SGDPCTGAATDGTNMDTDPTFNPAIKC  93

Query  229  DCSG---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
            +CSG   T CH+ +LKIY L+ VG IP EL  L  + +LNLAQN L G +P  +G+LT M
Sbjct  94   ECSGQNNTVCHVTKLKIYALNAVGAIPAELQNLTRLTNLNLAQNYLTGPLPSFLGKLTAM  153

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            +++S G N+L+G +P E+GNL+ L++LSF++NN+NG LP ELGNL  LE++YIDS  L+G
Sbjct  154  QYMSLGINSLSGSVPKELGNLTNLVSLSFSSNNLNGSLPLELGNLVKLEQLYIDSAGLSG  213

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             +P  LS L  +++LWAS N+FTG++P+++G
Sbjct  214  SLPSSLSSLTRMKILWASDNDFTGQIPDYIG  244



>ref|XP_008363409.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Malus domestica]
Length=363

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 124/210 (59%), Gaps = 9/210 (4%)
 Frame = +1

Query  70   IAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA----SWAPLEANPRIACD  231
             AQ+  TDP+EV A+N I + W+ +    L   S EPC  +A     +   + NP I CD
Sbjct  27   FAQNATTDPSEVRALNSIFEQWDTQPVPGLWNISGEPCSGSAINGNDFDSPDNNPAIVCD  86

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            CS      CHI +L++  L   G  P+EL  L+ +  L +  N   G +P  IG+++ + 
Sbjct  87   CSYNNNATCHITKLRVQALYRRGVFPEELLALRYLAVLKIDMNYFKGHLPAFIGKMSALI  146

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             LS G N+ +GPIP EIGNL  L  L+  TNN +G LPPELGNL  L+++Y+DS  L+G 
Sbjct  147  VLSIGHNSFSGPIPKEIGNLKELNMLAIGTNNFSGTLPPELGNLVKLQQIYMDSCGLSGE  206

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   +KL + +V W S + F+GK+P+F+G
Sbjct  207  IPSTFAKLTSTQVFWVSDSPFSGKIPDFIG  236


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  316  LKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATN  495
            +K + DL L   ++ G++P +IG+   +K L    NNLTG +P  + ++S L +L    N
Sbjct  287  MKNLTDLKLRNALITGTIPSDIGEYQSLKILDLSFNNLTGQLPSSLFSMSSLTSLFLGNN  346

Query  496  NMNGPLPPELGN  531
            +++GPLP +  N
Sbjct  347  SLSGPLPSQKSN  358


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/158 (25%), Positives = 68/158 (43%), Gaps = 32/158 (20%)
 Frame = +1

Query  223  ACDCSG----TFCHINRLKIYGLD---IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
            +C  SG    TF  +   +++ +      G+IP  +    ++  L    N   G +P   
Sbjct  200  SCGLSGEIPSTFAKLTSTQVFWVSDSPFSGKIPDFIGNWTQLTSLRFQGNSFEGPIPTSF  259

Query  382  GQLTKMKWLSF-----GTNN--------------------LTGPIPPEIGNLSILITLSF  486
             QLT +K L       G ++                    +TG IP +IG    L  L  
Sbjct  260  SQLTSLKSLQISDIYHGRSSSLDFIKKMKNLTDLKLRNALITGTIPSDIGEYQSLKILDL  319

Query  487  ATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            + NN+ G LP  L ++++L  +++ +N L+GP+P + S
Sbjct  320  SFNNLTGQLPSSLFSMSSLTSLFLGNNSLSGPLPSQKS  357



>dbj|BAF01001.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=835

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 133/231 (58%), Gaps = 12/231 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNIT---DPNEVVAINKIIDHWNLRSKV------NLSSF  168
            ++ ++ +  F+ GL + V +Q+  T   DP+E  A+NKI   W + +         L S 
Sbjct  5    ILSLVVWFVFMSGLFHVVRSQNRTTATTDPDEARALNKIFRTWKITATKAWNISGELCSG  64

Query  169  EPCDKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               D + S   L  NP I CDCS    T C I  L+  G+D+ G IP +L+ L  + +LN
Sbjct  65   AAIDDSVSIDNLAFNPLIKCDCSFVDSTICRIVALRARGMDVAGPIPDDLWTLVYISNLN  124

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QN L G + P IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPP
Sbjct  125  LNQNFLTGPLSPGIGNLTRMQWMTFGANALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPP  184

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E+GN T L +MYI S+ L+G IP   +   NL   W +    TG++P+F+G
Sbjct  185  EIGNCTRLVKMYIGSSGLSGEIPSSFANFVNLEEAWINDIRLTGQIPDFIG  235


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +     S    I ++  +  L
Sbjct  232  DFIGNWTKLTTLRILGTSLSGPIPSTFANLISLTELRLGEISNISSSLQFIREMKSISVL  291

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + N + G +P  L N   L  +++ +NRL G +P
Sbjct  292  VLRNNNLTGTIPSNIGDYLGLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNRLNGSLP  351

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+ TG LP ++
Sbjct  352  TQKSPSLSNIDV---SYNDLTGDLPSWV  376



>emb|CDY11604.1| BnaC06g31350D [Brassica napus]
Length=639

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 121/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T P+E  A+N I   W +R+         L S    D   +      NP I CDC+    
Sbjct  37   THPDEARALNSIFATWKIRAPREWNISGELCSGAAIDDGVTIDSRAYNPLIKCDCNFVNS  96

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
              C I  LK+Y +D+VG IP+EL+ L  + +LNL QN L G + P IG LT+M+WL+FG 
Sbjct  97   KICRITALKVYAIDVVGTIPEELWTLHYLTNLNLGQNFLTGPLSPAIGNLTRMEWLTFGI  156

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GPIP EIG L  L +L+ ++NN +G +P E+G+ T L+++YIDS+ L+G IP   +
Sbjct  157  NALSGPIPKEIGLLRELKSLAVSSNNFSGSIPAEIGSCTKLQQIYIDSSGLSGEIPLSFA  216

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L  L+V+W      TG +P+F+G
Sbjct  217  NLVELQVVWMMDLEVTGPIPDFIG  240



>ref|NP_001052392.1| Os04g0291900 [Oryza sativa Japonica Group]
 dbj|BAF14306.1| Os04g0291900 [Oryza sativa Japonica Group]
Length=1146

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 123/198 (62%), Gaps = 9/198 (5%)
 Frame = +1

Query  106  VAINKIIDHWNLRSKV------NLSSFEPCDKNASWAPLEANPRIACDCS---GTFCHIN  258
            VA+N I+  W   +        +L S    DKN        NP I CDC+    T C I 
Sbjct  29   VALNTIMRRWGKEASSEWNVSGDLCSGFAADKNDWDYYPNINPFIKCDCTFSNNTLCRIT  88

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
            +L++  LD+VG+IP EL  L  + +L+L  N L G +P  IG+ T MK+L+ G N L+GP
Sbjct  89   KLRVNKLDVVGQIPSELQNLTRLENLDLNYNYLTGFIPSFIGKFTSMKYLALGFNPLSGP  148

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            +P E+GNL+ LI+L  + NN  G LP ELGNLT L+++YIDS+  +GP P   SKL+NL+
Sbjct  149  LPKELGNLTNLISLGISLNNFTGGLPEELGNLTKLKQLYIDSSGFSGPFPSTFSKLQNLQ  208

Query  619  VLWASSNNFTGKLPEFLG  672
            +L AS N FTGK+P++LG
Sbjct  209  ILLASDNGFTGKIPDYLG  226



>ref|NP_001185247.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE33350.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1039

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 133/231 (58%), Gaps = 12/231 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNIT---DPNEVVAINKIIDHWNLRSKV------NLSSF  168
            ++ ++ +  F+ GL + V +Q+  T   DP+E  A+NKI   W + +         L S 
Sbjct  5    ILSLVVWFVFMSGLFHVVRSQNRTTATTDPDEARALNKIFRTWKITATKAWNISGELCSG  64

Query  169  EPCDKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               D + S   L  NP I CDCS    T C I  L+  G+D+ G IP +L+ L  + +LN
Sbjct  65   AAIDDSVSIDNLAFNPLIKCDCSFVDSTICRIVALRARGMDVAGPIPDDLWTLVYISNLN  124

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QN L G + P IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPP
Sbjct  125  LNQNFLTGPLSPGIGNLTRMQWMTFGANALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPP  184

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E+GN T L +MYI S+ L+G IP   +   NL   W +    TG++P+F+G
Sbjct  185  EIGNCTRLVKMYIGSSGLSGEIPSSFANFVNLEEAWINDIRLTGQIPDFIG  235


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +     S    I ++  +  L
Sbjct  232  DFIGNWTKLTTLRILGTSLSGPIPSTFANLISLTELRLGEISNISSSLQFIREMKSISVL  291

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + N + G +P  L N   L  +++ +NRL G +P
Sbjct  292  VLRNNNLTGTIPSNIGDYLGLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNRLNGSLP  351

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+ TG LP ++
Sbjct  352  TQKSPSLSNIDV---SYNDLTGDLPSWV  376



>ref|XP_010243682.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nelumbo nucifera]
Length=1013

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 138/235 (59%), Gaps = 21/235 (9%)
 Frame = +1

Query  28   LGFSF-----FVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFE------P  174
            L F+F     F+  L++   AQ   TDPNEV A++ I+  W +  + + S+++      P
Sbjct  19   LAFAFLHIWIFLFYLVDLSEAQPK-TDPNEVSALDAILRRWRISPQPSNSTYQWYTTGDP  77

Query  175  CD-----KNASWAPLEA-NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEM  327
            C       NAS    EA N  I CDC+   G+ CHI RLK+  + + GEIP EL  L  +
Sbjct  78   CSGVALANNASIIDDEAFNAGIICDCNYDNGSTCHIIRLKVMEMGMDGEIPNELLNLTYL  137

Query  328  MDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNG  507
            + L L +N L G +P  + +LTK+K L+   N+L+GPIP E+G L  LI LS   NN +G
Sbjct  138  VYLKLDKNYLTGPLPAFLARLTKLKILAVAFNSLSGPIPEELGTLKDLIVLSLEYNNFSG  197

Query  508  PLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LP +LGNL  L+  YI S  L+G IP   SKL N++++WAS N F GK+P+F+G
Sbjct  198  ALPSQLGNLINLQHFYISSTGLSGEIPSSFSKLSNMKIMWASDNKFVGKIPDFIG  252


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 2/141 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G   ++    I    + GEIP     L  M  +  + N   G +P  IG  T ++ L F 
Sbjct  204  GNLINLQHFYISSTGLSGEIPSSFSKLSNMKIMWASDNKFVGKIPDFIGNWTLLEDLRFQ  263

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+  GPIP    +L+ L  L  + NN+ G +P  L  L  L  +++ +N L GP+P ++
Sbjct  264  GNSFEGPIPSSFSSLTNLNELDLSFNNLTGRIPSSLFTLQNLNILFLGNNGLFGPLPAQM  323

Query  598  SKLKNLRVLWASSNNFTGKLP  660
                NL  +  S N  +G  P
Sbjct  324  G--PNLVYIDLSYNELSGSFP  342



>ref|NP_564710.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59259.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33349.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1012

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 133/231 (58%), Gaps = 12/231 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNIT---DPNEVVAINKIIDHWNLRSKV------NLSSF  168
            ++ ++ +  F+ GL + V +Q+  T   DP+E  A+NKI   W + +         L S 
Sbjct  5    ILSLVVWFVFMSGLFHVVRSQNRTTATTDPDEARALNKIFRTWKITATKAWNISGELCSG  64

Query  169  EPCDKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN  339
               D + S   L  NP I CDCS    T C I  L+  G+D+ G IP +L+ L  + +LN
Sbjct  65   AAIDDSVSIDNLAFNPLIKCDCSFVDSTICRIVALRARGMDVAGPIPDDLWTLVYISNLN  124

Query  340  LAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP  519
            L QN L G + P IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPP
Sbjct  125  LNQNFLTGPLSPGIGNLTRMQWMTFGANALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPP  184

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E+GN T L +MYI S+ L+G IP   +   NL   W +    TG++P+F+G
Sbjct  185  EIGNCTRLVKMYIGSSGLSGEIPSSFANFVNLEEAWINDIRLTGQIPDFIG  235


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +     S    I ++  +  L
Sbjct  232  DFIGNWTKLTTLRILGTSLSGPIPSTFANLISLTELRLGEISNISSSLQFIREMKSISVL  291

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + N + G +P  L N   L  +++ +NRL G +P
Sbjct  292  VLRNNNLTGTIPSNIGDYLGLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNRLNGSLP  351

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+ TG LP ++
Sbjct  352  TQKSPSLSNIDV---SYNDLTGDLPSWV  376



>ref|XP_010243680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nelumbo nucifera]
Length=1061

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 138/235 (59%), Gaps = 21/235 (9%)
 Frame = +1

Query  28   LGFSF-----FVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLSSFE------P  174
            L F+F     F+  L++   AQ   TDPNEV A++ I+  W +  + + S+++      P
Sbjct  19   LAFAFLHIWIFLFYLVDLSEAQPK-TDPNEVSALDAILRRWRISPQPSNSTYQWYTTGDP  77

Query  175  CD-----KNASWAPLEA-NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEM  327
            C       NAS    EA N  I CDC+   G+ CHI RLK+  + + GEIP EL  L  +
Sbjct  78   CSGVALANNASIIDDEAFNAGIICDCNYDNGSTCHIIRLKVMEMGMDGEIPNELLNLTYL  137

Query  328  MDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNG  507
            + L L +N L G +P  + +LTK+K L+   N+L+GPIP E+G L  LI LS   NN +G
Sbjct  138  VYLKLDKNYLTGPLPAFLARLTKLKILAVAFNSLSGPIPEELGTLKDLIVLSLEYNNFSG  197

Query  508  PLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             LP +LGNL  L+  YI S  L+G IP   SKL N++++WAS N F GK+P+F+G
Sbjct  198  ALPSQLGNLINLQHFYISSTGLSGEIPSSFSKLSNMKIMWASDNKFVGKIPDFIG  252



>ref|XP_004955904.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X3 [Setaria italica]
Length=1044

 Score =   165 bits (418),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNASWAP-----LEANPRIAC  228
            Q+  TDP EV A+N I+  W  ++  + +++    EPC   A          + NP I C
Sbjct  31   QAASTDPIEVAALNTILGRWGKKATRSPAAWNISGEPCSGAAVDGTELDGNYKFNPGITC  90

Query  229  DCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
             CS    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L G +P  IGQ + M
Sbjct  91   LCSFDNNTVCHITKLRVYALNVVGQIPSELQNLTYLTYLNLDQNYLTGPIPSFIGQFSGM  150

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N  +GP+P E+GNL+ L  L  + +N +G LP ELGNL+ LE++Y DS+ L+G
Sbjct  151  QHLSLGFNPFSGPLPKELGNLTNLNLLGISLDNFSGGLPEELGNLSKLEQLYTDSSGLSG  210

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L AS N+FTGK+P++LG
Sbjct  211  PFPSTFSKLKKLRILRASDNDFTGKMPDYLG  241


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P+EL  L ++  L    + L+G  P    +L K++ L    N+ TG +P  +G+L+ 
Sbjct  186  GGLPEELGNLSKLEQLYTDSSGLSGPFPSTFSKLKKLRILRASDNDFTGKMPDYLGSLTN  245

Query  469  LITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            L  ++F  N+  GP+P  L NLT L  + +
Sbjct  246  LEDMAFQGNSFEGPIPASLSNLTRLTNLAV  275



>emb|CDY38804.1| BnaA07g28760D [Brassica napus]
Length=639

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 122/204 (60%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T PNE  A+N I   W + +         L S    D   +      NP I CDC+    
Sbjct  37   THPNEARALNSIFAKWKIHAPREWNISGELCSGAAIDDGVTIDSRAYNPLIKCDCNFVNS  96

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  LK+Y +D+VG IP+EL+ L+ + +LNL QN L G +   IG LT+M+WL+FG 
Sbjct  97   TMCRITALKVYAIDVVGTIPEELWTLEYLTNLNLGQNYLTGPLSRAIGNLTRMEWLTFGI  156

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GPIP EIG L  L +L+ ++NN +G +P E+G+ T L+++YIDS+  +G IP   +
Sbjct  157  NALSGPIPKEIGLLRELKSLAVSSNNFSGSIPAEIGSCTKLQQIYIDSSGHSGEIPLSFA  216

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L +L+V+W      TG++P+F+G
Sbjct  217  NLVDLQVVWMMDLEVTGRIPDFIG  240


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 12/199 (6%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID      ++ LS     D    W   LE   RI  D  G +  + 
Sbjct  188  PAEIGSCTKLQQIYIDSSGHSGEIPLSFANLVDLQVVWMMDLEVTGRIP-DFIGNWTKLV  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    +NL G
Sbjct  247  SLRILGTGLSGPIPSSFSNLASLTELRLG-DISNGSSSLEFIKTMKSLSILVLRNSNLEG  305

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
             IP  IG  S L+ +  + N ++GP+P  L NL+ L  +++ +N+L G +P   S+ LKN
Sbjct  306  TIPSNIGEYSSLLQVDLSFNKLHGPIPTSLFNLSRLSHLFLGNNKLIGSLPTRKSQSLKN  365

Query  613  LRVLWASSNNFTGKLPEFL  669
            + V   S NN +G LP ++
Sbjct  366  IDV---SYNNLSGSLPSWV  381



>emb|CDY10508.1| BnaC03g71060D [Brassica napus]
Length=1033

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 131/223 (59%), Gaps = 12/223 (5%)
 Frame = +1

Query  40   FFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNAS  192
            +F+ G ++ V AQ+     TDP+E  A+N I   W + +         L S    D + +
Sbjct  16   WFLSGSVHVVRAQNRTGATTDPDEARALNSIFAAWRIPAPREWNISGELCSGAAMDDSVT  75

Query  193  WAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
                  NP I CDC   S   C I  LK+Y +++VG IP +L+ L  + +LNL QNVL G
Sbjct  76   IDDKAYNPLIKCDCTFNSSKICRITALKVYAIEVVGPIPPQLWTLHYLTNLNLGQNVLTG  135

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
            S+PP IG LT+M++++FG N L+GP+P EIG L  L +L  ++NN +G +PPE+G+ T L
Sbjct  136  SLPPAIGNLTRMQYMTFGINALSGPVPKEIGLLKDLRSLGISSNNFSGSIPPEIGSCTKL  195

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++MYI S+ LTG IP   + L  L   W +    TG +P+F+G
Sbjct  196  QKMYIGSSGLTGVIPLSFANLVQLEDAWITDLQVTGPIPDFIG  238


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 77/148 (52%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI-GQLTKMKW  405
            D  G +  +  L+I+G  + G IP     L  + +L L  ++ NGS   EI   +  +  
Sbjct  235  DFIGNWTKLTTLRIFGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLEIFKDMKSLST  293

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L F  +NLTG IP  IG  S L  +  + N + GP+P  L NL+ L  +++ +N L G +
Sbjct  294  LVFRNSNLTGTIPSFIGEFSSLQQVDLSFNKLGGPIPASLFNLSRLTHLFLGNNTLNGSL  353

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P +  K + LR +  S N+ +G LP ++
Sbjct  354  PSQ--KSQTLRNIDVSYNDLSGSLPSWV  379



>ref|XP_004955905.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X4 [Setaria italica]
Length=1036

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNASWAP-----LEANPRIAC  228
            Q+  TDP EV A+N I+  W  ++  + +++    EPC   A          + NP I C
Sbjct  31   QAASTDPIEVAALNTILGRWGKKATRSPAAWNISGEPCSGAAVDGTELDGNYKFNPGITC  90

Query  229  DCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
             CS    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L G +P  IGQ + M
Sbjct  91   LCSFDNNTVCHITKLRVYALNVVGQIPSELQNLTYLTYLNLDQNYLTGPIPSFIGQFSGM  150

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N  +GP+P E+GNL+ L  L  + +N +G LP ELGNL+ LE++Y DS+ L+G
Sbjct  151  QHLSLGFNPFSGPLPKELGNLTNLNLLGISLDNFSGGLPEELGNLSKLEQLYTDSSGLSG  210

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L AS N+FTGK+P++LG
Sbjct  211  PFPSTFSKLKKLRILRASDNDFTGKMPDYLG  241


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 73/149 (49%), Gaps = 25/149 (17%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P+EL  L ++  L    + L+G  P    +L K++ L    N+ TG +P  +G+L+ 
Sbjct  186  GGLPEELGNLSKLEQLYTDSSGLSGPFPSTFSKLKKLRILRASDNDFTGKMPDYLGSLTN  245

Query  469  LITLSFATNNMNGPLPPELGNLT------------------------TLEEMYIDSNRLT  576
            L  ++F  N+  GP+P  L NLT                        +L  + + + +++
Sbjct  246  LEDMAFQGNSFEGPIPASLSNLTRLTNLAVGDILSGSSSLAFISNLSSLSTLILRNCKVS  305

Query  577  GPIPE-ELSKLKNLRVLWASSNNFTGKLP  660
            G + E  +SKL NL +L  S NN TG++P
Sbjct  306  GNLGEVNISKLANLILLDLSFNNITGQVP  334


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 57/195 (29%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L      + G  P     LK++  L  + N   G +P  +G LT ++ ++F 
Sbjct  193  GNLSKLEQLYTDSSGLSGPFPSTFSKLKKLRILRASDNDFTGKMPDYLGSLTNLEDMAFQ  252

Query  418  TNNLTGPIPPEIGNLS--------------------------------------------  465
             N+  GPIP  + NL+                                            
Sbjct  253  GNSFEGPIPASLSNLTRLTNLAVGDILSGSSSLAFISNLSSLSTLILRNCKVSGNLGEVN  312

Query  466  -------ILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS-KLKNLRV  621
                   IL+ LSF  NN+ G +PP +  L  LE +++ +N LTG +P+  S  LKNL  
Sbjct  313  ISKLANLILLDLSF--NNITGQVPPSILTLDKLEFLFLGNNSLTGSLPDVKSPSLKNLDF  370

Query  622  LWASSNNFTGKLPEF  666
               S N  TG  P +
Sbjct  371  ---SYNQLTGSFPSW  382



>ref|XP_004955902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X1 [Setaria italica]
Length=1067

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNASWAP-----LEANPRIAC  228
            Q+  TDP EV A+N I+  W  ++  + +++    EPC   A          + NP I C
Sbjct  31   QAASTDPIEVAALNTILGRWGKKATRSPAAWNISGEPCSGAAVDGTELDGNYKFNPGITC  90

Query  229  DCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
             CS    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L G +P  IGQ + M
Sbjct  91   LCSFDNNTVCHITKLRVYALNVVGQIPSELQNLTYLTYLNLDQNYLTGPIPSFIGQFSGM  150

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N  +GP+P E+GNL+ L  L  + +N +G LP ELGNL+ LE++Y DS+ L+G
Sbjct  151  QHLSLGFNPFSGPLPKELGNLTNLNLLGISLDNFSGGLPEELGNLSKLEQLYTDSSGLSG  210

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L AS N+FTGK+P++LG
Sbjct  211  PFPSTFSKLKKLRILRASDNDFTGKMPDYLG  241


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P+EL  L ++  L    + L+G  P    +L K++ L    N+ TG +P  +G+L+ 
Sbjct  186  GGLPEELGNLSKLEQLYTDSSGLSGPFPSTFSKLKKLRILRASDNDFTGKMPDYLGSLTN  245

Query  469  LITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            L  ++F  N+  GP+P  L NLT L  + +
Sbjct  246  LEDMAFQGNSFEGPIPASLSNLTRLTNLAV  275



>ref|XP_004955903.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X2 [Setaria italica]
Length=1059

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLSSF----EPCDKNASWAP-----LEANPRIAC  228
            Q+  TDP EV A+N I+  W  ++  + +++    EPC   A          + NP I C
Sbjct  31   QAASTDPIEVAALNTILGRWGKKATRSPAAWNISGEPCSGAAVDGTELDGNYKFNPGITC  90

Query  229  DCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
             CS    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L G +P  IGQ + M
Sbjct  91   LCSFDNNTVCHITKLRVYALNVVGQIPSELQNLTYLTYLNLDQNYLTGPIPSFIGQFSGM  150

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N  +GP+P E+GNL+ L  L  + +N +G LP ELGNL+ LE++Y DS+ L+G
Sbjct  151  QHLSLGFNPFSGPLPKELGNLTNLNLLGISLDNFSGGLPEELGNLSKLEQLYTDSSGLSG  210

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L AS N+FTGK+P++LG
Sbjct  211  PFPSTFSKLKKLRILRASDNDFTGKMPDYLG  241


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P+EL  L ++  L    + L+G  P    +L K++ L    N+ TG +P  +G+L+ 
Sbjct  186  GGLPEELGNLSKLEQLYTDSSGLSGPFPSTFSKLKKLRILRASDNDFTGKMPDYLGSLTN  245

Query  469  LITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            L  ++F  N+  GP+P  L NLT L  + +
Sbjct  246  LEDMAFQGNSFEGPIPASLSNLTRLTNLAV  275



>ref|NP_001055041.1| Os05g0261700 [Oryza sativa Japonica Group]
 dbj|BAF16955.1| Os05g0261700, partial [Oryza sativa Japonica Group]
Length=486

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 121/201 (60%), Gaps = 9/201 (4%)
 Frame = +1

Query  97   NEVVAINKIIDHWNLRSK------VNLSSFEPCDKNASWAPLEANPRIACDCS---GTFC  249
            +   A+N I+  W  ++         L S    DK       + NP I CDC+    T C
Sbjct  3    HAAAALNTILGRWGKKASPEWNISGELCSGFAADKTDWDNYRDINPFIKCDCTFNNNTLC  62

Query  250  HINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNL  429
            HI RL++  LD+VG+IP EL  L  ++DLNL +N L G +P  IG+ T M++LS   N L
Sbjct  63   HITRLRVTYLDVVGQIPAELQNLTHLVDLNLFRNYLTGPIPSFIGKFTSMQYLSLSFNPL  122

Query  430  TGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLK  609
            +G +P E+GNL+ L++L  +++N  G LP ELGNLT L+++Y DS+  +GP P   SKL+
Sbjct  123  SGLLPKELGNLTNLLSLGISSDNFTGSLPEELGNLTKLQQLYFDSSGFSGPFPSSFSKLQ  182

Query  610  NLRVLWASSNNFTGKLPEFLG  672
            NL+ L AS N F GK+P +LG
Sbjct  183  NLKFLSASDNVFKGKIPAYLG  203


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 74/192 (39%), Gaps = 51/192 (27%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L        G  P     L+ +  L+ + NV  G +P  +G +T ++ ++F 
Sbjct  155  GNLTKLQQLYFDSSGFSGPFPSSFSKLQNLKFLSASDNVFKGKIPAYLGTMTNLEDIAFH  214

Query  418  TNNLTGPIPPEIGNLSILITL---------------------------------------  480
             N+  GP+P  + NL+ L  L                                       
Sbjct  215  GNSFEGPVPESLSNLTKLTRLWIGDIINGVSPLAFISNMASLSTLILRNCKISSDLGAVE  274

Query  481  ----------SFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWA  630
                        + NN+ G +P  + NL  L  +++ +N LTG +P+ +S   +L+V+  
Sbjct  275  FSMFKQLKLLDLSFNNITGEVPQSILNLGNLNSLFLGNNSLTGKLPDGIS--SSLKVIDF  332

Query  631  SSNNFTGKLPEF  666
            S N  TG +P +
Sbjct  333  SYNQLTGSIPSW  344



>ref|XP_009759495.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nicotiana sylvestris]
Length=548

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  328  MDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNG  507
            MDLNL QNV+NG++P EI QL KM++LS G NNLTG +PPE+G+L+ LI+LSF +NN NG
Sbjct  1    MDLNLGQNVINGTIPAEIRQLPKMQYLSLGINNLTGSVPPELGSLTNLISLSFGSNNFNG  60

Query  508  PLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            PLPP+LGNL +L+++YID + + GPIP ELS LK+L +LWAS N FTGKLPEF 
Sbjct  61   PLPPQLGNLVSLQQLYIDGSGVNGPIPRELSNLKSLEILWASDNRFTGKLPEFF  114


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
            I G IP E+  L +M  L+L  N L GSVPPE+G LT +  LSFG+NN  GP+PP++GNL
Sbjct  10   INGTIPAEIRQLPKMQYLSLGINNLTGSVPPELGSLTNLISLSFGSNNFNGPLPPQLGNL  69

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNN  642
              L  L    + +NGP+P EL NL +LE ++   NR TG +PE      N +VL      
Sbjct  70   VSLQQLYIDGSGVNGPIPRELSNLKSLEILWASDNRFTGKLPEFFVNFMNFQVLRLEGTL  129

Query  643  FTGKLPEFLG  672
              G +P   G
Sbjct  130  LEGPIPSNYG  139


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 3/117 (3%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            ++ G +P EL  L  ++ L+   N  NG +PP++G L  ++ L    + + GPIP E+ N
Sbjct  33   NLTGSVPPELGSLTNLISLSFGSNNFNGPLPPQLGNLVSLQQLYIDGSGVNGPIPRELSN  92

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE---ELSKLKNLRV  621
            L  L  L  + N   G LP    N    + + ++   L GPIP     L+KL++LR+
Sbjct  93   LKSLEILWASDNRFTGKLPEFFVNFMNFQVLRLEGTLLEGPIPSNYGALNKLQDLRI  149


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + +L I G  + G IP+EL  LK +  L  + N   G +P         + L   
Sbjct  67   GNLVSLQQLYIDGSGVNGPIPRELSNLKSLEILWASDNRFTGKLPEFFVNFMNFQVLRLE  126

Query  418  TNNLTGPIPPEIG------------------------NLSILITLSFATNNMNGPLPPEL  525
               L GPIP   G                        NL+ L  LS     + G LP +L
Sbjct  127  GTLLEGPIPSNYGALNKLQDLRIGDLHTEDSSLDFVENLTSLSILSLRNCRIIGQLPEKL  186

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +   LE + +  N+LTG IP       +LR L+  SNN +GKLP
Sbjct  187  SSFGNLEILDLSFNKLTGQIPRSFEDFASLRFLYLGSNNLSGKLP  231



>ref|XP_002513383.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48786.1| ATP binding protein, putative [Ricinus communis]
Length=1016

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 128/205 (62%), Gaps = 21/205 (10%)
 Frame = +1

Query  91   DPNEVVAINKIIDHWNL---RSKVNLSSFEPCDKNA-----SWAPLEANPRIACDCS---  237
            DP+E  A+N I + W +   +S+ N+S  E C   A     +      NP I CDCS   
Sbjct  30   DPDEGRALNSIFEQWGISAAQSQWNISG-ELCSGAALGTSPTIDDQAYNPFIKCDCSDNN  88

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            GT CHI  LK++ +D+VG +P EL         NL QN L G++ P IG LT+M++L+FG
Sbjct  89   GTTCHITALKVFAIDVVGVLPDEL---------NLGQNFLTGNLSPSIGNLTRMQYLNFG  139

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+L+G +P E+G L+ L ++ F +NN +GPLP ELGN T L+++Y DS+ ++G IP   
Sbjct  140  INSLSGELPKELGLLTDLRSIGFGSNNFSGPLPSELGNCTRLDQIYFDSSGVSGEIPPTF  199

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L+N+  +WAS N  TG++P+F+G
Sbjct  200  ANLRNMVTVWASDNELTGRIPDFIG  224


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 0/142 (0%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    ++++      + GEIP     L+ M+ +  + N L G +P  IG  +K+  L   
Sbjct  176  GNCTRLDQIYFDSSGVSGEIPPTFANLRNMVTVWASDNELTGRIPDFIGNWSKLATLRLE  235

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N+  GPIP  + NLS L  L  +  +        + ++T+L  + + +N ++  IP  +
Sbjct  236  GNSFEGPIPSALSNLSSLTELRISGLSNGSSSLAFIRDMTSLTVLVLRNNNISDSIPSNI  295

Query  598  SKLKNLRVLWASSNNFTGKLPE  663
               +NL  L  S NN TG++PE
Sbjct  296  GDYQNLTQLDLSFNNITGQIPE  317


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 74/148 (50%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L++ G    G IP  L  L  + +L ++      S    I  +T +  L
Sbjct  221  DFIGNWSKLATLRLEGNSFEGPIPSALSNLSSLTELRISGLSNGSSSLAFIRDMTSLTVL  280

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NN++  IP  IG+   L  L  + NN+ G +P  L NL+ L  +++ +N+L GP+P
Sbjct  281  VLRNNNISDSIPSNIGDYQNLTQLDLSFNNITGQIPEPLFNLSKLSFLFLGNNKLDGPLP  340

Query  589  -EELSKLKNLRVLWASSNNFTGKLPEFL  669
             ++ S L+N+ V   S NN +G  P ++
Sbjct  341  AQKSSSLQNIDV---SYNNLSGSFPSWV  365



>ref|XP_010246434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Nelumbo nucifera]
Length=552

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 139/229 (61%), Gaps = 12/229 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLR--SKVNLSSFEPCDKNA  189
            V  I+    ++L L++    Q+  TDP EV A+N I   W +   S  N+S  EPC   A
Sbjct  12   VFAIICSCIYLLFLVSKSNGQA-TTDPIEVKALNSIFQQWGISDVSSWNISG-EPCSGVA  69

Query  190  -----SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLA  345
                 +    + NP I C+CS   G+ CHI  LK+Y  D+   IP+EL  L  +  LNL 
Sbjct  70   ILNSTNIDDTDFNPGIKCNCSYNNGSTCHITHLKVYEKDVNSVIPEELANLTYLTYLNLD  129

Query  346  QNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
            +N   GS+P  +GQL+ M+ LS   N L+G IP  IGNL  LI+LSF++NN +G LP +L
Sbjct  130  RNYFTGSMPTFLGQLSAMQNLSLAINALSGSIPKAIGNLKDLISLSFSSNNFSGALPSQL  189

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            GNL  LEE+YIDS+ ++G IP     L N+R++WAS NNFTGK+P+F+G
Sbjct  190  GNLVKLEELYIDSSGVSGEIPTSFGSLVNMRIMWASDNNFTGKIPDFIG  238


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 69/142 (49%), Gaps = 2/142 (1%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L I    + GEIP     L  M  +  + N   G +P  IG  TK+  L F 
Sbjct  190  GNLVKLEELYIDSSGVSGEIPTSFGSLVNMRIMWASDNNFTGKIPDFIGNWTKLTELRFQ  249

Query  418  TNNLTGPIPPEIGNLSILITLSFAT-NNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
             N+  GPIP    NL++L  L  +  +N++  L   + ++  L  + + +N ++G IP  
Sbjct  250  GNSFQGPIPASFSNLTLLTDLRISELSNVSSTL-DFIKDMKALTTLVLRNNMISGTIPSN  308

Query  595  LSKLKNLRVLWASSNNFTGKLP  660
            + + + L+ L  S NN TG++P
Sbjct  309  IGEYEKLQRLDLSFNNLTGQIP  330



>ref|XP_006655141.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1028

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 122/204 (60%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHW-NLRSKVNLSSFEPCDKNAS----WAPL-EANPRIACDCS---G  240
            T P E  A+N I+  W    S V   S EPC   A+    W      NP I CDC+    
Sbjct  43   THPLEKAALNTILGRWGKAASPVWNISGEPCSGLAADKSDWDNYPNINPFIKCDCTFSNN  102

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T CHI RL++  L +VG+IP EL     M+DLNL  N L G +P   G+ T MK L+   
Sbjct  103  TLCHITRLRVINLGVVGQIPSELQNFTYMLDLNLGSNYLTGPLPSFFGKFTSMKHLALPF  162

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GP+P E+GNL+ L++L  + NN  G LP ELGN+T L++MYIDS+  +GP P   S
Sbjct  163  NLLSGPLPKELGNLTNLLSLGISFNNFTGQLPEELGNMTNLQQMYIDSSGFSGPFPLTFS  222

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
            KL NL++L AS N FTGK+P+ LG
Sbjct  223  KLDNLKILRASDNEFTGKIPDNLG  246


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 74/170 (44%), Gaps = 30/170 (18%)
 Frame = +1

Query  241  TFCHINRLKIYGL---DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            TF  ++ LKI      +  G+IP  L  +  + D+    N   G +P     LTK+  L 
Sbjct  220  TFSKLDNLKILRASDNEFTGKIPDNLGSMSNLADMAFQGNSFEGPIPASFSNLTKLTNLR  279

Query  412  FG-----------TNNLT-------------GPIPP-EIGNLSILITLSFATNNMNGPLP  516
             G            +NLT             G I   +   L+ L+ L  + NN+ G +P
Sbjct  280  IGDIVNGISPLAFISNLTSLTNLILRNCKISGNIAEVDFSKLASLMLLDLSFNNITGQIP  339

Query  517  PELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEF  666
              + NL  L  +++ SN LTG +P+ +S   +L+ +  S N  TG LP +
Sbjct  340  QTILNLGNLTFVFLGSNSLTGSLPDAIS--PSLKTVDVSYNQLTGSLPSW  387



>ref|XP_006390899.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum]
 gb|ESQ28185.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum]
Length=1023

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 132/219 (60%), Gaps = 12/219 (5%)
 Frame = +1

Query  52   GLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPL  204
            G ++ V AQ+     T P++  A+N I   W +R+         L S    D + S    
Sbjct  22   GSVHVVRAQNQTGATTHPDDARALNTIFATWKIRAPKEWNISGELCSGAAIDDSISVNNG  81

Query  205  EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I C C+    T C I  LK+Y +D+VG IP EL+ L+ + +L+L QNVL+GS+ P
Sbjct  82   AYNPLIKCGCNFVNSTICRITALKVYAIDVVGTIPDELWTLEYLTNLDLGQNVLSGSLSP  141

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT+M+W++FG N L+GP+P EIG L+ L  LS ++NN +G +P E+G+ T L+++Y
Sbjct  142  AIGNLTRMEWMTFGINALSGPVPKEIGLLTDLKLLSISSNNFSGSMPAEIGSCTKLQQIY  201

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ L+G IP   + L  L+V W      TG++P+F+G
Sbjct  202  IDSSGLSGGIPLSFANLVELQVAWIMDLEVTGRIPDFIG  240


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 10/195 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L   + LS     +   +W   LE   RI  D  G +  + 
Sbjct  188  PAEIGSCTKLQQIYIDSSGLSGGIPLSFANLVELQVAWIMDLEVTGRIP-DFIGNWTKLT  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NG+   E I  +  +  L    NNLTG
Sbjct  247  TLRILGTGLSGPIPSSFSNLTSLTELRLG-DITNGNSSLEFIKDMKSLSTLVLRNNNLTG  305

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G +P +  KL++L
Sbjct  306  TIPSNIGEYSSLQQVDLSFNKLHGPIPASLFNLSRLTHLFLGNNTLNGSLPSQ--KLQSL  363

Query  616  RVLWASSNNFTGKLP  660
              +  S NN +G LP
Sbjct  364  SNIDVSYNNLSGSLP  378



>ref|XP_004955901.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Setaria italica]
Length=1037

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 125/211 (59%), Gaps = 12/211 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWNLRSKVNLS---SFEPCDKNA-SWAPLEAN----PRIACD  231
            Q+  TDP E  A+N I+  W  ++  + +   S EPC   A     L+ N    P I C 
Sbjct  34   QAARTDPIEAAALNTILGRWGQKAMPSPAWNISGEPCSGAAVDGTGLDGNNDFNPGITCA  93

Query  232  CS----GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKM  399
            CS     + CHI  LK+Y L++VG+IP EL  L  +  LNL  N L G +P  IG  + M
Sbjct  94   CSFGVNSSVCHITMLKVYALNVVGQIPSELQNLTYLTYLNLDLNYLTGPIPSFIGHFSAM  153

Query  400  KWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTG  579
            + LS G N L+GP+P E+GNL+ +  L  + +N  G LP ELGNL+ LE++YIDS+  +G
Sbjct  154  QHLSLGFNPLSGPLPKELGNLTNVNLLGISLDNFTGGLPEELGNLSKLEQLYIDSSGFSG  213

Query  580  PIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P P   SKLK LR+L AS N+FTGK+P + G
Sbjct  214  PFPSTFSKLKKLRILRASDNDFTGKIPYYFG  244


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/191 (24%), Positives = 71/191 (37%), Gaps = 49/191 (26%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G   ++N L I   +  G +P+EL  L ++  L +  +  +G  P    +L K++ L   
Sbjct  172  GNLTNVNLLGISLDNFTGGLPEELGNLSKLEQLYIDSSGFSGPFPSTFSKLKKLRILRAS  231

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-----------  564
             N+ TG IP   G+L+ L  L    N+  GP+P  L NLT L  + I             
Sbjct  232  DNDFTGKIPYYFGSLTNLEDLVLYGNSFEGPIPASLSNLTRLTNLIIGDIVNGSSSLAFI  291

Query  565  --------------------------------------NRLTGPIPEELSKLKNLRVLWA  630
                                                  N +TG +P  +  L  L  L  
Sbjct  292  SNLTSLSTLILRNCKLSGNLGAVNISKLANLILLDLSFNNITGQVPRSILTLDKLEFLIL  351

Query  631  SSNNFTGKLPE  663
             +N+ +G LP+
Sbjct  352  GNNSLSGSLPD  362



>ref|XP_006306656.1| hypothetical protein CARUB_v10008172mg [Capsella rubella]
 gb|EOA39554.1| hypothetical protein CARUB_v10008172mg [Capsella rubella]
Length=1030

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 127/220 (58%), Gaps = 13/220 (6%)
 Frame = +1

Query  52   GLLNTVI-AQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAP  201
            GL + V+ AQ+     T P+E  A+N I   W + +         L S    D       
Sbjct  22   GLFHVVVRAQTRTGPTTHPDEARALNSIFAAWKIPAPKEWNISGELCSGAAIDTGVLDTD  81

Query  202  LEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP  372
               NP I C C+    T C IN +K+Y LD+VG IP+EL+ LK + +LNLAQN L GS+P
Sbjct  82   PAYNPLIKCICTFEMSTICRINNIKVYALDVVGPIPQELWTLKYLTNLNLAQNFLTGSLP  141

Query  373  PEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM  552
            P IG LT+M+W++FG N L+GP+P EIG L  L  LS  +NN +G +P E+GN   LE++
Sbjct  142  PAIGNLTRMQWMTFGINALSGPLPKEIGLLDDLRLLSIGSNNFSGSIPAEIGNCKKLEQI  201

Query  553  YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            Y+DS+ L+G IP   +    L+  W      TG++P+F+G
Sbjct  202  YMDSSGLSGRIPSSFANFVELQQAWIMDLELTGRIPDFIG  241


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 3/156 (2%)
 Frame = +1

Query  202  LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
            LE   RI  D  G +  +  L+I G  + G IP     L  + +L L      GS    I
Sbjct  230  LELTGRIP-DFIGKWTKLTTLRIIGTGLSGPIPSSFSNLTSLEELRLGDISNGGSSLDFI  288

Query  382  GQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYID  561
              +  +  L    NNLTG IP  IG  S L  +  + N + GP+P  L NL+ L  +++ 
Sbjct  289  KDMKSLSVLVLRNNNLTGTIPSTIGGYSSLKQVDLSFNKLQGPIPASLFNLSQLTHLFLG  348

Query  562  SNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +N L G +P +  K ++L  +  S N+ +G LP ++
Sbjct  349  NNTLHGSLPNQ--KGQSLSTVDVSYNDLSGNLPSWV  382


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (47%), Gaps = 0/139 (0%)
 Frame = +1

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
            F  + +  I  L++ G IP  +    ++  L +    L+G +P     LT ++ L  G  
Sbjct  219  FVELQQAWIMDLELTGRIPDFIGKWTKLTTLRIIGTGLSGPIPSSFSNLTSLEELRLGDI  278

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
            +  G     I ++  L  L    NN+ G +P  +G  ++L+++ +  N+L GPIP  L  
Sbjct  279  SNGGSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGGYSSLKQVDLSFNKLQGPIPASLFN  338

Query  604  LKNLRVLWASSNNFTGKLP  660
            L  L  L+  +N   G LP
Sbjct  339  LSQLTHLFLGNNTLHGSLP  357



>gb|KFK35533.1| hypothetical protein AALP_AA4G003000 [Arabis alpina]
Length=975

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 122/204 (60%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            TDP+E  A+NKI + W +++         L S +  D + S   L  NP I CDCS    
Sbjct  33   TDPDEARALNKIFETWKIKAIPSWNISGELCSGDAIDDSVSIDNLAFNPLIKCDCSYENN  92

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  L+  G+D+ G IP EL+ L  + +LNL QN L GS+ P IG LTKM+W++FG 
Sbjct  93   TICRIFALRARGMDVAGPIPDELWSLVYISNLNLNQNFLTGSLSPGIGNLTKMQWMTFGA  152

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+GP+P EIG L+ L +L+   NN +G LPPE+GN T L +MYI S+ +TG +P   +
Sbjct  153  NALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPPEIGNCTKLVKMYIGSSGITGELPSSFA  212

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
               +L   W +    TG +P+F+G
Sbjct  213  NFVDLEEAWINDIQLTGPIPDFIG  236


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  I  L+I G ++ G IP     L  + +L L +   + S    I  +  +  L
Sbjct  233  DFIGNWTKITVLRILGTNMSGPIPSTFANLISLTELRLGEISNSNSSLQFIRDMKFLSVL  292

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + NN+ G +P  L N + L  +++ +N+LTG +P
Sbjct  293  VLRNNNLTGTIPSNIGDYLQLRQLDLSFNNLTGEIPASLFNSSQLTHLFLGNNKLTGSLP  352

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L NL V   S N+  G LP ++
Sbjct  353  TQKSPSLTNLDV---SYNDLAGNLPSWV  377



>emb|CAD41886.2| OSJNBa0093O08.5 [Oryza sativa Japonica Group]
Length=970

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 132/224 (59%), Gaps = 25/224 (11%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAP----LEANPRIACDCSG  240
            A +  TD  E  A+  + +  + +++ N +  +PC   A+ +        NP I CDCS 
Sbjct  19   APTATTDRIEAEALKAVFEKLDQKAEWNTTG-DPCSGAATDSTDINDSSINPAIKCDCSD  77

Query  241  ---TFCHINRLKIYGLDIVGEIPKELFVLKEMMDL-----------------NLAQNVLN  360
               T CHI  LKIY  D  G+IP EL  L  +  L                 NL+ N L 
Sbjct  78   QNNTVCHITGLKIYDKDATGQIPGELRNLTHLTHLYELSDFLRGVAVLQLPRNLSHNFLV  137

Query  361  GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
            G++P  IG+L  M++++FG N L+G IP E+GNL+ L++L F++NN +G LP ELG+L  
Sbjct  138  GTIPSFIGELAAMQYMTFGINALSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFK  197

Query  541  LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            LEE++IDS  L+G +P  LSKL  +++LWAS NNFTG++P+++G
Sbjct  198  LEELFIDSAGLSGELPSSLSKLTRMKILWASDNNFTGQIPDYIG  241


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
            + G IPKEL  L  ++ L  + N  +GS+P E+G L K++ L   +  L+G +P  +  L
Sbjct  160  LSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFKLEELFIDSAGLSGELPSSLSKL  219

Query  463  SILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS---KLKNLRV  621
            + +  L  + NN  G +P  +G+   L ++    N   GP+P  LS   +L NLR+
Sbjct  220  TRMKILWASDNNFTGQIPDYIGSW-NLTDLRFQGNSFQGPLPANLSNLVQLTNLRI  274



>ref|NP_176009.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGH2.2|Y1561_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g56130; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33347.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=1032

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 125/205 (61%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E  A+N I   W +++  + N+S  E C   A  A +       NP I CDCS   
Sbjct  37   THPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFQN  95

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
             T C I  +K+Y +D+VG IP EL+ L  + +LNL QNVL GS+PP IG LT+M+W++FG
Sbjct  96   STICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG  155

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIG L+ L  L  ++NN +G +P E+G  T L++MYIDS+ L+G IP   
Sbjct  156  INALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSF  215

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L  L   W +    T ++P+F+G
Sbjct  216  ANLVQLEQAWIADLEVTDQIPDFIG  240


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 8/197 (4%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS         +W A LE   +I  D  G +  + 
Sbjct  188  PDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIP-DFIGDWTKLT  246

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             L+I G  + G IP     L  + +L L       S    I  +  +  L    NNLTG 
Sbjct  247  TLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGT  306

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G  P +  K ++LR
Sbjct  307  IPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQ--KTQSLR  364

Query  619  VLWASSNNFTGKLPEFL  669
             +  S N+ +G LP ++
Sbjct  365  NVDVSYNDLSGSLPSWV  381



>ref|XP_008663598.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Zea mays]
Length=834

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  211  NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
            NP I CDCS    T CHI  LK+  LD+VG IP+EL  L  +  LNL QN L G +P  +
Sbjct  2    NPGIKCDCSDHNNTICHITELKMNKLDVVGPIPEELRNLSHLTTLNLQQNYLTGPLPSFL  61

Query  382  GQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYID  561
            G+LT ++ +S   N L+G IP E+GNL  LI LS  TNN+ G LP ELGNL  LE MYID
Sbjct  62   GELTALQQMSLSGNALSGTIPKELGNLVNLIILSLGTNNLTGSLPSELGNLVKLEHMYID  121

Query  562  SNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            S  L+GPIP   SKL  L+ L AS N+FTGK+P+++G
Sbjct  122  SAGLSGPIPSSFSKLTRLKTLCASDNDFTGKIPDYIG  158



>gb|EEE68222.1| hypothetical protein OsJ_26394 [Oryza sativa Japonica Group]
Length=938

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 18/209 (9%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWN-LRSKVNLSSFEPCDKNASWAPLEA----------NPRIACDC  234
            TDP EV A+  I+  WN   S V   S EPC       P++           NP I CDC
Sbjct  29   TDPVEVAALEAILGRWNKTNSPVWSMSGEPCRG----VPVDGVTGLDGNPKNNPGIKCDC  84

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S   GT CHI +LK+Y L++VG+IP EL  L  +  L+L QN L+G +P  IGQLT +  
Sbjct  85   SYINGTVCHITQLKVYALNVVGQIPAELQNLTYLNYLDLDQNYLSGPIPSFIGQLTALTE  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L  G N L+GPIP E+GNL+ L  L  +  N  G LP ELGNLT L+ +Y DS  L+GP 
Sbjct  145  LHVGFNALSGPIPKELGNLTNLNLLGISLTNFTGQLPEELGNLTKLQRLYTDSAGLSGPF  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL++L AS N+FTGK+P+++G
Sbjct  205  PSTFSKLKNLKLLRASDNDFTGKIPDYIG  233


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  G++P+EL  L ++  L      L+G  P    +L  +K L    N+ TG IP  IG+
Sbjct  175  NFTGQLPEELGNLTKLQRLYTDSAGLSGPFPSTFSKLKNLKLLRASDNDFTGKIPDYIGS  234

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE-ELSKLKNLRVLWASS  636
            L+ L  L+F  N+  GP+P  L NLT L    + + R++G +   + SK   L  L   +
Sbjct  235  LTNLEDLAFQGNSFEGPIPESLSNLTKLTTFVLRNCRISGDLGAVDFSKFTKLAFLNLVA  294

Query  637  NNF  645
            NNF
Sbjct  295  NNF  297



>emb|CDY03757.1| BnaA02g14800D [Brassica napus]
Length=2043

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 134/220 (61%), Gaps = 12/220 (5%)
 Frame = +1

Query  46   VLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCD----KNASWA  198
            + GL++ V AQ+     T P+E  A+N I   W +R+  + N+S  E C      N S  
Sbjct  19   IHGLVHVVRAQNRTRATTHPDEARALNSIFATWKIRASNEWNISG-ELCSGAAIDNVSID  77

Query  199  PLEANPRIACDC--SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP  372
                NP I C C  + + C I  LK+Y +D+VG IP EL+ L+ + +LNLAQN L G + 
Sbjct  78   DGAYNPMIKCTCTFANSTCRITALKVYAIDVVGSIPDELWTLEYLTNLNLAQNFLTGPLS  137

Query  373  PEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM  552
            P IG LT+M+W++FG N L+GP+P EIG L+ L  LS ++NN +G +P E+G+ T L+++
Sbjct  138  PAIGNLTRMEWMTFGINALSGPVPKEIGLLTNLKLLSISSNNFSGSMPAEIGSCTKLQQI  197

Query  553  YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            YIDS+ L G IP   + L  ++  W     FTG++P+F+G
Sbjct  198  YIDSSGLGGEIPLSFANLVEMQQAWMMDLEFTGRIPDFIG  237


 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 132/224 (59%), Gaps = 19/224 (8%)
 Frame = +1

Query  46    VLGLLNTVIAQSN---ITDPNEVVAINKIIDHWNLRSKVNLS-----SFEPCDKNASWAP  201
             +  L++ V AQ+    IT P++  A+N I   W    K+N S     S E C   A+   
Sbjct  1042  IYSLVHVVRAQNRTGTITHPDDARALNSIFATW----KINASNDWNISGELCSGAATNGN  1097

Query  202   LEA-----NPRIACDC--SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLN  360
             ++      NP I C C  + + C I  LK+Y  D+VG IP EL+ L+ + +LNL QN+L 
Sbjct  1098  VDVDDPAYNPIIKCACTFANSTCRITALKVYSRDVVGTIPDELWTLEHLTNLNLGQNLLT  1157

Query  361   GSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTT  540
             G + P IG L +M+W++FG N L+GP+P EIG L+ L  LS  +NN +G +P E+G+ T 
Sbjct  1158  GPLSPAIGNLIRMEWMTFGINALSGPVPKEIGLLTNLKLLSIGSNNFSGSMPAEIGSCTK  1217

Query  541   LEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+++YIDS+ L+G IP   + L  L+ +W      TG++PEF+G
Sbjct  1218  LQQIYIDSSGLSGEIPLSFANLVELQRVWMMDLEVTGRIPEFIG  1261


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 99/199 (50%), Gaps = 12/199 (6%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L  ++ LS     +   +W   LE   RI  D  G +  + 
Sbjct  185  PAEIGSCTKLQQIYIDSSGLGGEIPLSFANLVEMQQAWMMDLEFTGRIP-DFIGNWTKLT  243

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  244  TLRIVGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSTLEFIKNMKSLSTLVLRNNNLTG  302

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
             IP +IG+ S L  +  + N ++GP+P  L NLT L  +++ +N L G +P + S+ L N
Sbjct  303  EIPSDIGDYSSLQQVDLSFNKLHGPIPSSLFNLTRLTHLFLGNNTLNGSLPTQKSQSLSN  362

Query  613  LRVLWASSNNFTGKLPEFL  669
            + V   S NN +G LP ++
Sbjct  363  IDV---SYNNLSGILPSWV  378


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 99/199 (50%), Gaps = 12/199 (6%)
 Frame = +1

Query  94    PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
             P E+ +  K+    ID   L  ++ LS     +    W   LE   RI  +  G +  + 
Sbjct  1209  PAEIGSCTKLQQIYIDSSGLSGEIPLSFANLVELQRVWMMDLEVTGRIP-EFIGNWTKLI  1267

Query  259   RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
              L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    +NLTG
Sbjct  1268  VLRIVGTGLSGPIPSSFSNLTYLTELRLG-DISNGSSSLEFIRDMKNLSILVLRNSNLTG  1326

Query  436   PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
              IP +IG  S L  +  + N ++GP+P  L NLT+L  +++ +N L G +P + S+ L N
Sbjct  1327  EIPSDIGEYSSLGEVDLSFNKLHGPIPSSLFNLTSLTHLFLGNNTLNGSLPTQKSQSLSN  1386

Query  613   LRVLWASSNNFTGKLPEFL  669
             + V   S NNF+G LP ++
Sbjct  1387  IDV---SYNNFSGSLPSWV  1402



>gb|AFW59454.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=808

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 112/176 (64%), Gaps = 9/176 (5%)
 Frame = +1

Query  169  EPC-----DKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKE  324
            +PC     D  + +A  + NP I CDCS    T CHI  LK+  LD+VG IP+EL  L  
Sbjct  59   DPCVGAATDGTSIYAD-KMNPGIKCDCSDHNNTICHITELKMNKLDVVGPIPEELRNLSH  117

Query  325  MMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMN  504
            +  LNL QN L G +P  +G+LT ++ +S   N L+G IP E+GNL  LI LS  TNN+ 
Sbjct  118  LTTLNLQQNYLTGPLPSFLGELTALQQMSLSGNALSGTIPKELGNLVNLIILSLGTNNLT  177

Query  505  GPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            G LP ELGNL  LE MYIDS  L+GPIP   SKL  L+ L AS N+FTGK+P+++G
Sbjct  178  GSLPSELGNLVKLEHMYIDSAGLSGPIPSSFSKLTRLKTLCASDNDFTGKIPDYIG  233



>ref|XP_007024832.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27454.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1034

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 124/210 (59%), Gaps = 10/210 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCD------KNASWAPLEANPRIACD  231
            AQ+  TDP+EV A+N I   W+ ++  + + S EPC        ++     E NP I CD
Sbjct  28   AQNATTDPSEVRALNTIFQKWDTQAVASWNISGEPCSGLALSPSDSVLEDPENNPAIRCD  87

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            CS    T CHI RL++Y LD  G IP+EL     +  L + QN  +G +P  IG +++++
Sbjct  88   CSFNSNTLCHITRLRVYALDRRGVIPEELLDFPFLTFLKIDQNFFSGPLPAFIGNMSRLE  147

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             LS   N+ +GPIP E+G+L  L  LSF  NN +G LPPELGNL  L+E+YI+S  L G 
Sbjct  148  ILSIAHNDFSGPIPKELGSLKALNMLSFGHNNFSGTLPPELGNLVNLQEIYINSCGLGGE  207

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IP   + L+ L  +WAS   FTG +P F+G
Sbjct  208  IPSTFANLEKLETVWASDVAFTGNIPNFIG  237


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 66/140 (47%), Gaps = 4/140 (3%)
 Frame = +1

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP-PEIGQLTKMKWLSFGTNNL  429
            +  L++ G    G IP     L  +  L +   + NGS     +  L  +  L      L
Sbjct  243  LTTLRLEGNSFAGPIPSSFANLTSLTSLRIG-GIYNGSSSLGFVRNLRNLTDLVLRNVLL  301

Query  430  TGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLK  609
            TG +P  I  L  L  L F+ NN+ G +P  L N+ +LE +++ +N L+G +P +  K  
Sbjct  302  TGNLPSFITELQSLQKLDFSFNNLTGQIPSALFNMNSLENLFLGNNSLSGTLPTQ--KSD  359

Query  610  NLRVLWASSNNFTGKLPEFL  669
             L+ +  S N  +G LP ++
Sbjct  360  TLQTIDLSYNFLSGNLPSWI  379



>ref|XP_008663594.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Zea mays]
 ref|XP_008663595.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Zea mays]
 ref|XP_008663596.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Zea mays]
Length=929

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  211  NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
            NP I CDCS    T CHI  LK+  LD+VG IP+EL  L  +  LNL QN L G +P  +
Sbjct  2    NPGIKCDCSDHNNTICHITELKMNKLDVVGPIPEELRNLSHLTTLNLQQNYLTGPLPSFL  61

Query  382  GQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYID  561
            G+LT ++ +S   N L+G IP E+GNL  LI LS  TNN+ G LP ELGNL  LE MYID
Sbjct  62   GELTALQQMSLSGNALSGTIPKELGNLVNLIILSLGTNNLTGSLPSELGNLVKLEHMYID  121

Query  562  SNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            S  L+GPIP   SKL  L+ L AS N+FTGK+P+++G
Sbjct  122  SAGLSGPIPSSFSKLTRLKTLCASDNDFTGKIPDYIG  158



>gb|KDP35216.1| hypothetical protein JCGZ_09375 [Jatropha curcas]
Length=1008

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 124/202 (61%), Gaps = 20/202 (10%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNASWAPL-----EANPRIACDCS---GT  243
            T+PNE          WN+  +V       C   A  A +     + NP + CDC+   GT
Sbjct  36   TEPNEADQ-----SQWNITGEV-------CSGAAVLASISIDDGKHNPFVKCDCADNNGT  83

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             CHI  LK+Y +DIVG++P EL+ L  + +LNLA N L G++ P IG LT+M++L    N
Sbjct  84   TCHITALKVYEMDIVGDMPAELWTLTYLTNLNLAHNYLTGNLSPFIGNLTRMQYLYLSVN  143

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
            +L+G +P E+G L+ L +L F TNN +GPLP EL N T LE++Y DS+ ++G IP E + 
Sbjct  144  SLSGELPKELGLLADLRSLGFGTNNFSGPLPSELANCTKLEQIYFDSSGVSGEIPLEFAN  203

Query  604  LKNLRVLWASSNNFTGKLPEFL  669
            L+N+ ++W S N+ TG++P F+
Sbjct  204  LQNIVIMWGSDNDLTGRIPNFI  225


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 4/137 (3%)
 Frame = +1

Query  262  LKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTGP  438
            L+  G    G IP  L  L  + +L ++ ++ NGS   E +  +  +  L    +N+   
Sbjct  234  LRFEGNRFEGPIPSALSSLTSLTELRIS-DLSNGSSSLEFLENMKSLAVLVLRNDNIADA  292

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            IP        L  L  + NN+ G +P  L  L +L  +++ SN L GP+P +  K  +LR
Sbjct  293  IPSSFREYQYLTLLDLSFNNIAGRIPDSLFQLNSLTTLFLGSNNLDGPLPAQ--KSPSLR  350

Query  619  VLWASSNNFTGKLPEFL  669
            ++  S NN  G LP ++
Sbjct  351  IIDVSYNNLVGSLPTWV  367



>ref|XP_006422235.1| hypothetical protein CICLE_v10007054mg, partial [Citrus clementina]
 gb|ESR35475.1| hypothetical protein CICLE_v10007054mg, partial [Citrus clementina]
Length=962

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 121/203 (60%), Gaps = 23/203 (11%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLSSFEPC-----DKNASWAPLEANPRIACDCS---GT  243
            TDPNE          WN        S +PC     D +  +   + NP I CDCS   GT
Sbjct  8    TDPNE--------GQWN-------RSGDPCTGAALDDSIVFDNTDYNPFIKCDCSSQNGT  52

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             CHI +LK+Y L++VG IP EL+ L  + +LNL QN L G + P +G LT M++L+   N
Sbjct  53   VCHITQLKVYALNVVGVIPDELWNLTSLFNLNLGQNYLTGPLSPSVGNLTAMQYLNLAIN  112

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
             L+G +P E+G L+ L+ L   TNN +GPLP ELG+L+ L+E+YIDS  ++G IP   + 
Sbjct  113  ALSGELPKELGQLTELLILGIGTNNFSGPLPSELGSLSKLQELYIDSAGVSGEIPSSFAN  172

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            L++L   WAS    TG++P+F+G
Sbjct  173  LQSLTKWWASDTRLTGRIPDFIG  195


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP-PEIGQLTKMKW  405
            D  G +  +  L+  G    G IP     L  + +L ++ ++ NGS     I  +  +  
Sbjct  192  DFIGNWSKLTALRFQGNSFNGPIPSSFSNLTSLTELRIS-DLSNGSSKLAFIRDMKSLSI  250

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L    NN++  IP  IG    L  L  + NN+ G +P  L NL++L  +++ +N+L G +
Sbjct  251  LELRNNNISDSIPSNIGEYRSLQHLDLSFNNLGGSIPDSLFNLSSLTHLFLGNNKLNGTL  310

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P   S L  L  +  S NN  G LP ++
Sbjct  311  PARKSPL--LLNIDVSYNNLQGNLPSWI  336



>gb|AFW59455.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=943

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 112/176 (64%), Gaps = 9/176 (5%)
 Frame = +1

Query  169  EPC-----DKNASWAPLEANPRIACDCSG---TFCHINRLKIYGLDIVGEIPKELFVLKE  324
            +PC     D  + +A  + NP I CDCS    T CHI  LK+  LD+VG IP+EL  L  
Sbjct  59   DPCVGAATDGTSIYAD-KMNPGIKCDCSDHNNTICHITELKMNKLDVVGPIPEELRNLSH  117

Query  325  MMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMN  504
            +  LNL QN L G +P  +G+LT ++ +S   N L+G IP E+GNL  LI LS  TNN+ 
Sbjct  118  LTTLNLQQNYLTGPLPSFLGELTALQQMSLSGNALSGTIPKELGNLVNLIILSLGTNNLT  177

Query  505  GPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            G LP ELGNL  LE MYIDS  L+GPIP   SKL  L+ L AS N+FTGK+P+++G
Sbjct  178  GSLPSELGNLVKLEHMYIDSAGLSGPIPSSFSKLTRLKTLCASDNDFTGKIPDYIG  233



>gb|KDO77514.1| hypothetical protein CISIN_1g0025621mg, partial [Citrus sinensis]
Length=720

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 130/219 (59%), Gaps = 12/219 (5%)
 Frame = +1

Query  49   LGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDK---NASWAPLEA-  210
            +GL       ++ TDP EV A+N I+  W+  +    N+S  EPC     NA+ +  E+ 
Sbjct  26   IGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISG-EPCSGSALNATDSEFESP  84

Query  211  --NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDC+   G  CHI +L++Y L+  G IP+EL  L+ +  L + QN   G +P 
Sbjct  85   NNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPS  144

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG L+++  LS   N  +G +P E+GNL  L  LSF  NN +G LPPE+GNL  LE++Y
Sbjct  145  FIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLY  204

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++S    G IP   +KL+N++ LWAS   FTGK+P+F+G
Sbjct  205  LNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIG  243


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 70/147 (48%), Gaps = 2/147 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP  L  L  +  L ++      S    +  L  +  L
Sbjct  240  DFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDL  299

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            S     +TG IP  IG L  L TL  + NN+ G +P  L N+ +L  +++ +N L+G +P
Sbjct  300  SLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLP  359

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             +  K +NL+ +  S N+ +G  P ++
Sbjct  360  TQ--KSENLQNIDLSYNHLSGPFPSWV  384



>ref|XP_006659920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1020

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 125/207 (60%), Gaps = 13/207 (6%)
 Frame = +1

Query  88   TDPNE-VVAINKIIDHWNLRSK--VNLSSFEPC------DKNASWAPLEANPRIACDCS-  237
            TDP E    +  I+  W   +    N++  EPC      D  A     + NP I CDCS 
Sbjct  34   TDPTEGTHRLKAILGRWGRTTSPLWNMTD-EPCRGVAVDDSTALDGNPQNNPGIKCDCSY  92

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
              GT CH+ +LK+Y L++VG+IP EL  L  + +L+L QN L+G +P  IG+LT +K L 
Sbjct  93   SSGTVCHVTQLKVYALNVVGQIPSELQNLTYLTNLDLDQNYLSGPIPSFIGKLTALKELH  152

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
             G N L+GPIP E+GNL+ L  L  +  N+ G LP ELGNL  L  ++ DS  L+GP P 
Sbjct  153  VGFNPLSGPIPKELGNLTNLELLGISLTNLTGGLPEELGNLAKLRRLFTDSAGLSGPFPS  212

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKLKNL +L AS NNFTGK+P+F+G
Sbjct  213  TFSKLKNLVLLRASDNNFTGKIPDFIG  239


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 75/169 (44%), Gaps = 27/169 (16%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + RL      + G  P     LK ++ L  + N   G +P  IG LT ++ L+F 
Sbjct  191  GNLAKLRRLFTDSAGLSGPFPSTFSKLKNLVLLRASDNNFTGKIPDFIGSLTNLEDLAFQ  250

Query  418  TNNLTGPIPPEIGNLSILITLS-------------FATNNM---------NGPLPPELG-  528
             N+  GPIP  + NL+ L TL              F+  N+         N  +   LG 
Sbjct  251  GNSFEGPIPASLSNLTKLNTLKIGDIINGSSSLAFFSNLNLSSLDTVILRNCRISDNLGA  310

Query  529  ----NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
                 LT L+ M +  N ++G +P+ +  L+NLR L   +N+ TG LP+
Sbjct  311  VDFTKLTGLKFMDLSFNNISGHVPQSILNLQNLRYLLLGNNSLTGGLPD  359



>ref|XP_006659921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1020

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 125/209 (60%), Gaps = 18/209 (9%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNASWAPLEA----------NPRIACDC  234
            TDP EV A++ I+  W  ++    S S EPC       P++           NP I CDC
Sbjct  31   TDPTEVAALDAILGRWGRKASPLWSMSGEPCRG----VPVDGSTDLDGNPKNNPGIKCDC  86

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S    T CHI +L++Y L++VG+IP EL  L  +  LNL QN L+G +P  IGQLT +  
Sbjct  87   SYNRSTVCHITQLRVYALNVVGQIPAELQNLTHLTYLNLDQNYLSGPIPSFIGQLTALTE  146

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L  G N L+GP+P E+GNL  L  L  +  N  G LP ELGNLT LE +Y DS   +GP 
Sbjct  147  LHVGFNPLSGPLPKELGNLKNLKLLGISLTNFTGELPEELGNLTNLEHLYTDSAGFSGPF  206

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL++L AS N+FTGK+P+F+G
Sbjct  207  PSTFSKLKNLKLLRASDNDFTGKIPDFIG  235


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 70/177 (40%), Gaps = 49/177 (28%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  GE+P+EL  L  +  L       +G  P    +L  +K L    N+ TG IP  IG 
Sbjct  177  NFTGELPEELGNLTNLEHLYTDSAGFSGPFPSTFSKLKNLKLLRASDNDFTGKIPDFIGT  236

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDS-------------------------  564
            LS L  L+F  N+  GP+P  L NLT L  + I                           
Sbjct  237  LSNLEDLAFQGNSFEGPIPASLSNLTKLTTLKIGDIVNGSSSLAFISDLTSLSTLVLRNC  296

Query  565  ------------------------NRLTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
                                    N ++G +P+ +  L+NL+ L+  +N+ TG+LP+
Sbjct  297  RISDNLGAVDFTKLTGLNFLDLSFNNISGHVPQSVLNLQNLQYLFLGNNSLTGRLPD  353



>ref|XP_010463512.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Camelina sativa]
Length=721

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 127/205 (62%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E  A+N I   W +R+  + N+S  E C   A    +       NP I CDCS   
Sbjct  36   THPDEARALNSIFAAWRIRAPREWNISG-ELCSGAAIDDTVLDNNPAYNPLIKCDCSFEN  94

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
               C I  +K++  ++VG IP+EL+ LK + +LNL QNVL GS+PP IG LT+M+W++FG
Sbjct  95   SRICRITNIKVFAREVVGPIPEELWTLKYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIG L+ L  LS ++NN +G +P E+GN   L++++IDS+ L+G IP   
Sbjct  155  INALSGPVPKEIGLLTDLRLLSISSNNFSGSIPDEIGNCAKLQQIFIDSSGLSGRIPLSF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L +L   W +    TG++P+F+G
Sbjct  215  ANLVDLEQAWLADLEVTGQIPDFIG  239


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (50%), Gaps = 6/185 (3%)
 Frame = +1

Query  121  IIDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHINRLKIYGLDIVGEI  297
             ID   L  ++ LS     D   +W A LE   +I  D  G + ++  L+I G  + G I
Sbjct  200  FIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIP-DFIGKWTNLTTLRILGTGLSGPI  258

Query  298  PKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILI  474
            P     L  + +L L  ++ NGS   E I  +  +  L    NNLTG IP  IG  S L 
Sbjct  259  PSSFANLTALTELRLG-DISNGSSSLEFIKDMKSLSVLVLRNNNLTGTIPSNIGGYSSLQ  317

Query  475  TLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGK  654
             +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K ++L  +  S N+ +G 
Sbjct  318  QVDLSFNKLHGPIPASLFNLSGLTHLFLGNNTLNGSLPTQ--KSQSLSYIDVSYNDLSGI  375

Query  655  LPEFL  669
            LP ++
Sbjct  376  LPSWV  380



>gb|EEC83077.1| hypothetical protein OsI_28200 [Oryza sativa Indica Group]
Length=1084

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 18/209 (9%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWN-LRSKVNLSSFEPCDKNASWAPLEA----------NPRIACDC  234
            TDP EV A+  I+  WN   S V   S EPC       P++           NP I CDC
Sbjct  29   TDPVEVAALEAILGRWNKTNSPVWSMSGEPC----RGVPVDGVTGLDGNPKNNPGIKCDC  84

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S   GT CHI +LK+Y L++VG+IP EL  L  +  L+L QN L+G +P  IGQLT +  
Sbjct  85   SYINGTVCHITQLKVYALNVVGQIPAELQNLTYLNYLDLDQNYLSGPIPSFIGQLTALTE  144

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L  G N L+GPIP E+GNL+ L  L  +  N  G LP ELGNLT L+ +Y DS  L+GP 
Sbjct  145  LHVGFNALSGPIPKELGNLTNLNLLGISLTNFTGQLPEELGNLTKLQRLYTDSAGLSGPF  204

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   SKLKNL++L AS N+FTGK+P+++G
Sbjct  205  PSTFSKLKNLKLLRASDNDFTGKIPDYIG  233


 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 124/205 (60%), Gaps = 18/205 (9%)
 Frame = +1

Query  100  EVVAINKIIDHWN-LRSKVNLSSFEPCDKNASWAPLEA----------NPRIACDCS---  237
            E+ A+  I+  WN   S V   S EPC       P++           NP I CDCS   
Sbjct  254  EMAALEAILGRWNKTTSPVWSMSGEPC----RGVPVDGVTGLDGNPKNNPGIKCDCSYIN  309

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            GT CHI +LK+Y L++VG+IP EL  L  +  L+L QN L+G +P  IGQLT +  L  G
Sbjct  310  GTVCHITQLKVYALNVVGQIPAELQNLTYLNYLDLDQNYLSGPIPSFIGQLTALTELHVG  369

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GPIP E+GNL+ L  L  +  N  G LP ELGNLT L+ +Y DS  L+GP P   
Sbjct  370  FNALSGPIPKELGNLTNLNLLGISLTNFTGQLPEELGNLTKLQRLYTDSAGLSGPFPSTF  429

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            SKLKNL++L AS N+FTGK+P+++G
Sbjct  430  SKLKNLKLLRASDNDFTGKIPDYIG  454


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (53%), Gaps = 1/129 (1%)
 Frame = +1

Query  280  DIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGN  459
            +  G++P+EL  L ++  L      L+G  P    +L  +K L    N+ TG IP  IG+
Sbjct  396  NFTGQLPEELGNLTKLQRLYTDSAGLSGPFPSTFSKLKNLKLLRASDNDFTGKIPDYIGS  455

Query  460  LSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE-ELSKLKNLRVLWASS  636
            L+ L  L+F  N+  GP+P  L NLT L    + + R++G +   + SK   L  L  S 
Sbjct  456  LTNLEDLAFQGNSFEGPIPESLSNLTKLTTFVLRNCRISGDLGAVDFSKFTKLAFLDLSF  515

Query  637  NNFTGKLPE  663
            NN +GK+P+
Sbjct  516  NNISGKVPQ  524


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 67/152 (44%), Gaps = 26/152 (17%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + RL      + G  P     LK +  L  + N   G +P  IG LT ++ L+F 
Sbjct  406  GNLTKLQRLYTDSAGLSGPFPSTFSKLKNLKLLRASDNDFTGKIPDYIGSLTNLEDLAFQ  465

Query  418  TNNLTGPIPPEIGNLSILIT-------------------------LSFATNNMNGPLPPE  522
             N+  GPIP  + NL+ L T                         L  + NN++G +P  
Sbjct  466  GNSFEGPIPESLSNLTKLTTFVLRNCRISGDLGAVDFSKFTKLAFLDLSFNNISGKVPQS  525

Query  523  LGNLTTLEEMYIDSNRLTGPIPEELS-KLKNL  615
            + NL  L ++++ +N LTG +P+ +S  LKN 
Sbjct  526  ILNLQMLTDLFLGNNSLTGGLPDGISPSLKNF  557



>ref|XP_008374903.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Malus domestica]
Length=621

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 127/212 (60%), Gaps = 13/212 (6%)
 Frame = +1

Query  70   IAQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKNAS-----WAPLEANPRIA  225
              Q+  TDP+EV A+N I + W+ ++   + N+S  EPC  +A      ++P   NP I 
Sbjct  177  FTQNVTTDPSEVRALNSIFEQWDTQAVPGQWNISG-EPCSGSAINGTDIYSP-NFNPAIV  234

Query  226  CDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTK  396
            C+C+   GT CHI +L++Y LD  G  P+E   L+ +    + +N   G +P  IG ++ 
Sbjct  235  CNCTYDNGTACHITKLRVYALDKRGVFPEEFVALRYLTFFEIDENYFTGPLPAFIGNMSA  294

Query  397  MKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLT  576
            +  LS G N+ +GPIP E+GNL  L  L   +NN +G LPPELGNL  L+ +Y+DS  L 
Sbjct  295  LTGLSIGGNSFSGPIPKELGNLKELTYLDIGSNNFSGTLPPELGNLVKLKNLYMDSCGLG  354

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            G IP   + L N+++ WAS + F+GK+P+F+G
Sbjct  355  GEIPSTFANLTNMQIPWASDSPFSGKIPDFIG  386


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 26/151 (17%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG-----------------  417
            G+IP  +    ++ DL    N   G +P    QLT +K L  G                 
Sbjct  379  GKIPDFIGNWTQLTDLQFQGNSFEGPIPTSFSQLTSLKSLRIGDIYNGSSSLDFIKNLKN  438

Query  418  ------TNNL-TGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLT  576
                   N L TG IP +IG    L  L  + NN+ G LP  L  L++L  +++ +N L+
Sbjct  439  LTDLKLRNTLITGTIPSDIGEYQSLQILDLSFNNLTGQLPSYLFILSSLTSLFLGNNSLS  498

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            GP+P +  K   L+ +  S N  +G  P+++
Sbjct  499  GPLPSQ--KSYELQTIDLSYNFLSGSFPQWV  527



>ref|XP_002526908.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35480.1| ATP binding protein, putative, partial [Ricinus communis]
Length=1040

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 129/212 (61%), Gaps = 8/212 (4%)
 Frame = +1

Query  61   NTVIAQSNITDPNEVVAINKIIDHWNLRSKVNLS-SFEPCDKNA-SWAPLEA---NPRIA  225
            +T    +  TDP EV A+N+I+  W+ +S  + + S +PC   A   + +EA   +P I 
Sbjct  29   STAQNATTATDPAEVRALNEILQGWSTQSTDSWNISGDPCTGTAIDESDIEAPGNSPSIK  88

Query  226  CDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTK  396
            CDCS    + CHI RL ++ L+  G IP+ L VLK ++ L L +N   G +P  +G LT 
Sbjct  89   CDCSFDNNSTCHITRLLVFNLNRRGMIPETLLVLKHLIFLKLDKNYFTGPLPAFLGNLTA  148

Query  397  MKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLT  576
            ++ L+   N L+GPIP EIGNL  L  LS   NN +G LPPELGNL  LE++YI+S  L 
Sbjct  149  LRTLAVAHNMLSGPIPKEIGNLKDLTLLSLGVNNFSGTLPPELGNLVKLEQLYINSCGLN  208

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            G IP   +KL  +R+LWA  N FTG +P+F+G
Sbjct  209  GEIPPTFAKLTRIRILWAFDNPFTGNIPDFIG  240


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 24/151 (16%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G +P EL  L ++  L +    LNG +PP   +LT+++ L    N  TG IP  IG  + 
Sbjct  185  GTLPPELGNLVKLEQLYINSCGLNGEIPPTFAKLTRIRILWAFDNPFTGNIPDFIGTWTE  244

Query  469  LITLSFATNNMNGPLPPELGNLTTLEEMYIDSNR------------------------LT  576
            L TL    N+  GP+P    NL +++ + +   R                        +T
Sbjct  245  LTTLRLQGNSFKGPIPSSFSNLVSMKSLRLSDLRNVSSTLDFIKNLKNLTDLNLRNALIT  304

Query  577  GPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
              IP ++ + +NL  L  S NN  G++P  L
Sbjct  305  DTIPLDIGEFQNLEALDLSFNNLRGQIPNAL  335


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 71/147 (48%), Gaps = 2/147 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  GT+  +  L++ G    G IP     L  M  L L+      S    I  L  +  L
Sbjct  237  DFIGTWTELTTLRLQGNSFKGPIPSSFSNLVSMKSLRLSDLRNVSSTLDFIKNLKNLTDL  296

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            +     +T  IP +IG    L  L  + NN+ G +P  L +L++LE +++ +N L+G +P
Sbjct  297  NLRNALITDTIPLDIGEFQNLEALDLSFNNLRGQIPNALFSLSSLEFLFLGNNSLSGALP  356

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             E S L  L+ +  S NN +G+ P ++
Sbjct  357  NEKSGL--LQTIDLSYNNLSGRFPAWV  381



>ref|XP_009341189.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Pyrus x bretschneideri]
Length=979

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 130/229 (57%), Gaps = 11/229 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRS---KVNLSSFEPCDKN  186
            +M IL   F          AQ+  TDP+EV A+N I + W+ ++   + N+S  EPC  +
Sbjct  49   MMRILLLCFLSCFWFQLSFAQNATTDPSEVSALNSIFEQWDTQAVPGQWNISG-EPCSGS  107

Query  187  A----SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLA  345
            A           NP I C+CS   GT CHI +L++Y L+  G   KE   L+ +  L++ 
Sbjct  108  AIDGTDIYGDNNNPGIVCNCSYDNGTTCHITKLQVYALNKRGVFLKEFVALRYLTSLSIG  167

Query  346  QNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
            +N   G +P  IG +  +  L    N+ +GPIP E+GNL  L  LS  +NN +G LPPEL
Sbjct  168  KNYFTGPLPAFIGNMYALTELYIPFNSFSGPIPKELGNLKELTQLSIKSNNFSGTLPPEL  227

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            GNL  LE +YIDS  L   IP   +KL N++VLWAS N F+GK+P+F+G
Sbjct  228  GNLVKLEFLYIDSCGLGDEIPSTFAKLTNMQVLWASDNPFSGKIPDFIG  276


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L+  G    G IP     L  +  L ++ ++ NGS   + I  +  +  
Sbjct  273  DFIGNWTQLTSLRFQGNSFEGPIPTSFSQLTSLNYLRIS-DIYNGSSSLDFIKSMKNLTE  331

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L      +TG IP +IG    L TL  + NN+ G LP  L NL+ LE + + +N L+G +
Sbjct  332  LKLRNALITGTIPSDIGEYQSLRTLDLSFNNLTGRLPSSLFNLSFLESLLLGNNSLSGTL  391

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P +  K   L  +  S N  +G+LP+++
Sbjct  392  PSQ--KNNQLETIDLSYNFLSGRLPQWV  417



>ref|XP_006392561.1| hypothetical protein EUTSA_v10012006mg, partial [Eutrema salsugineum]
 gb|ESQ29847.1| hypothetical protein EUTSA_v10012006mg, partial [Eutrema salsugineum]
Length=1009

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 122/204 (60%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            TDP+E  A+NKI + W + +         L S    D + S   L  NP I CDCS    
Sbjct  34   TDPDEARALNKIFELWKITATEAWNISGELCSGAAIDDSVSIDNLAFNPLIKCDCSFVDS  93

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  L+  G+D+ G IP++L+ L  + +LNL QN L GS+ P IG LT+M+W++FG 
Sbjct  94   TICRIVALRARGMDVAGPIPQDLWTLVYISNLNLNQNFLTGSLSPGIGNLTRMQWMTFGA  153

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N L+G +P EIG L+ L +L+   NN +G LPPE+GN T L +MYI S+ LTG +P   +
Sbjct  154  NALSGQVPKEIGLLTDLRSLAIDMNNFSGSLPPEIGNCTRLVKMYIGSSGLTGELPSSFA  213

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L +L   W +    TG++P+F+G
Sbjct  214  NLVDLEEAWINDVQLTGQIPDFIG  237


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +   + S    I  +  +  L
Sbjct  234  DFIGNWTKLTTLRILGTSLSGPIPSTFTNLISLTELRLGEISNSSSSLQFIRNMKSLSVL  293

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG+   L  L  + NN+ G +P  L N + L  +++ +N+L+G +P
Sbjct  294  VLRNNNLTGTIPSDIGDYFQLRQLDLSFNNLTGQIPASLFNSSQLTHLFLGNNKLSGSLP  353

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L NL V   S N+  G LP ++
Sbjct  354  IQKSPSLSNLDV---SYNDLAGNLPSWV  378



>gb|AAG50909.1|AC069159_10 receptor protein kinase, putative [Arabidopsis thaliana]
Length=2062

 Score =   164 bits (414),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 126/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  52   GLLNTVIAQ---SNITDPNEVVAINKIIDHWNLRSKV------NLSSFEPCDKNASWAPL  204
            GL + V +Q   +  TDP+E  A+NKI   W + +         L S    D + S   L
Sbjct  3    GLFHVVRSQNRTTATTDPDEARALNKIFRTWKITATKAWNISGELCSGAAIDDSVSIDNL  62

Query  205  EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDCS    T C I  L+  G+D+ G IP +L+ L  + +LNL QN L G + P
Sbjct  63   AFNPLIKCDCSFVDSTICRIVALRARGMDVAGPIPDDLWTLVYISNLNLNQNFLTGPLSP  122

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPPE+GN T L +MY
Sbjct  123  GIGNLTRMQWMTFGANALSGPVPKEIGLLTDLRSLAIDMNNFSGSLPPEIGNCTRLVKMY  182

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            I S+ L+G IP   +   NL   W +    TG++P+F+G
Sbjct  183  IGSSGLSGEIPSSFANFVNLEEAWINDIRLTGQIPDFIG  221


 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  211   NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEI  381
             NP I CDCS    T C I  +K+Y +++VG IP++L+ L+ + +LNL QNVL GS+PP +
Sbjct  1112  NPLIKCDCSFENSTICRITNIKVYAMEVVGSIPQQLWTLEYLTNLNLGQNVLTGSLPPAL  1171

Query  382   GQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYID  561
             G LT+M+W++FG N L+GPIP EIG L+ L  LS ++NN +G +P E+G  T L+++YID
Sbjct  1172  GNLTRMRWMTFGINALSGPIPKEIGLLTDLRLLSISSNNFSGSIPDEIGRCTKLQQIYID  1231

Query  562   SNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             S+ L+G +P   + L  L   W +    TG++P+F+G
Sbjct  1232  SSGLSGGLPVSFANLVELEQAWIADMELTGQIPDFIG  1268


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 94/198 (47%), Gaps = 10/198 (5%)
 Frame = +1

Query  94    PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
             P+E+    K+    ID   L   + +S     +   +W A +E   +I  D  G +  + 
Sbjct  1216  PDEIGRCTKLQQIYIDSSGLSGGLPVSFANLVELEQAWIADMELTGQIP-DFIGDWTKLT  1274

Query  259   RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
              L+I G  + G IP     L  + +L L  ++ NG+   E I  +  +  L    NNLTG
Sbjct  1275  TLRILGTGLSGPIPASFSNLTSLTELRLG-DISNGNSSLEFIKDMKSLSILVLRNNNLTG  1333

Query  436   PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
              IP  IG  S L  L  + N ++G +P  L NL  L  +++ +N L G +P +  K ++L
Sbjct  1334  TIPSNIGEYSSLRQLDLSFNKLHGTIPASLFNLRQLTHLFLGNNTLNGSLPTQ--KGQSL  1391

Query  616   RVLWASSNNFTGKLPEFL  669
               +  S N+ +G LP ++
Sbjct  1392  SNVDVSYNDLSGSLPSWV  1409


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +     S    I ++  +  L
Sbjct  218  DFIGNWTKLTTLRILGTSLSGPIPSTFANLISLTELRLGEISNISSSLQFIREMKSISVL  277

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP  IG+   L  L  + N + G +P  L N   L  +++ +NRL G +P
Sbjct  278  VLRNNNLTGTIPSNIGDYLGLRQLDLSFNKLTGQIPAPLFNSRQLTHLFLGNNRLNGSLP  337

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+ TG LP ++
Sbjct  338  TQKSPSLSNIDV---SYNDLTGDLPSWV  362



>ref|XP_009101796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Brassica rapa]
Length=1015

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 133/228 (58%), Gaps = 12/228 (5%)
 Frame = +1

Query  25   ILGFSFFVLGLLNTVIAQS---NITDPNEVVAINKIIDHWN-LRSKVNLSSFEPCDKNAS  192
            I+ F   + G L+ V AQ+    ITDP+E  A+N I   W  LR +   +S E C  NA 
Sbjct  9    IVWFLLCIPGSLHLVRAQNLTRAITDPDEAEALNSIFAAWKILRLREWNTSSELCSGNAI  68

Query  193  WAPLE-----ANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
               ++      NP I CDC   S T C I  LK++G D VG IP +L+ L  + +LNLAQ
Sbjct  69   DDNIKIDDPAYNPFIKCDCTFNSSTICRITALKVFGKDAVGPIPPQLWTLIYLENLNLAQ  128

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N L GS+ P IG LT+M+WL+FG N L+GP P EIG L+ L +L F  N  +G +PPE+G
Sbjct  129  NYLTGSISPAIGNLTRMEWLTFGINALSGPFPKEIGLLTNLKSLGFGVNKFSGSIPPEIG  188

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            N T L ++Y+ +  L G +P   + L  L  LW    + TG++P+F+G
Sbjct  189  NCTKLMKIYLGNFELKGGLPSSFANLVKLEDLWIVDLDVTGRIPDFIG  236


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
 Frame = +1

Query  202  LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-  378
            L+   RI  D  G++  +  ++I+G    G IP     L  + +L L  ++ NGS   + 
Sbjct  225  LDVTGRIP-DFIGSWTKLLTMRIHGTGWSGPIPSSFSNLTSLNELRLG-DISNGSSSLDF  282

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I  +  ++ L    NNLTG IP +IG  S L  +  + N ++GP+P  L NL  L  +++
Sbjct  283  IKDMKSLRILVLRNNNLTGTIPSDIGEFSNLEQVDLSFNQLHGPIPASLFNLNQLTYLFL  342

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +N L G +P +  K + L  +  S N+ +G LP
Sbjct  343  GNNTLNGSLPTQ--KSQGLSDIDVSYNDLSGSLP  374


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 67/159 (42%), Gaps = 26/159 (16%)
 Frame = +1

Query  262  LKIY--GLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTG  435
            +KIY    ++ G +P     L ++ DL +    + G +P  IG  TK+  +       +G
Sbjct  194  MKIYLGNFELKGGLPSSFANLVKLEDLWIVDLDVTGRIPDFIGSWTKLLTMRIHGTGWSG  253

Query  436  PIPPEIGNLSILITLSFA------------------------TNNMNGPLPPELGNLTTL  543
            PIP    NL+ L  L                            NN+ G +P ++G  + L
Sbjct  254  PIPSSFSNLTSLNELRLGDISNGSSSLDFIKDMKSLRILVLRNNNLTGTIPSDIGEFSNL  313

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            E++ +  N+L GPIP  L  L  L  L+  +N   G LP
Sbjct  314  EQVDLSFNQLHGPIPASLFNLNQLTYLFLGNNTLNGSLP  352



>ref|XP_011465668.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Fragaria vesca subsp. 
vesca]
Length=1080

 Score =   162 bits (411),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 129/209 (62%), Gaps = 9/209 (4%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNA----SWAPLEANPRIACDC  234
            A +  TDP++  A+N + + W + +  K   ++ +PC   A     +   + NP I CDC
Sbjct  33   ATNATTDPSQARALNSVFEKWKILADPKQWNTTGDPCTGAAIDSTKFDDTDYNPFIICDC  92

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            S   GT CHI +LK+Y  ++VG IP EL+ L  + +LNLA N L G +   I  LT +++
Sbjct  93   SYQSGTICHITQLKVYDREVVGVIPDELWSLTSLTNLNLALNYLTGPLSAAIANLTGLQY  152

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
             + G NNL+G +P E+G L+ L +L+F  NN +G LP ELGNL+ L+++YIDS+ ++G I
Sbjct  153  FTVGINNLSGKLPKELGQLTELKSLAFGGNNFSGSLPSELGNLSKLQQLYIDSSGVSGEI  212

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   + L+NL   WA +   +G++P+F+G
Sbjct  213  PPTFANLQNLEFFWARNVELSGRIPDFIG  241



>emb|CDY22357.1| BnaA06g36790D [Brassica napus]
Length=1015

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 131/228 (57%), Gaps = 12/228 (5%)
 Frame = +1

Query  25   ILGFSFFVLGLLNTVIAQS---NITDPNEVVAINKIIDHWN-LRSKVNLSSFEPC-----  177
            I+ F   + G L+ V AQ+    ITDP+E  A+N I   W  LR +   +S E C     
Sbjct  9    IVWFLLCIPGSLHLVRAQNLTRAITDPDEAEALNSIFAAWKILRLREWNTSSELCSGPAI  68

Query  178  DKNASWAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
            D N        NP I CDC   S T C I  LK++G D VG IP +L+ L  + +LNLAQ
Sbjct  69   DDNIKIDDPAYNPFIKCDCTFNSSTICRITALKVFGKDAVGPIPPQLWTLIYLENLNLAQ  128

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N L GS+ P IG LT+M+WL+FG N L+GP P EIG L+ L +L F  N  +G +PPE+G
Sbjct  129  NYLTGSISPAIGNLTRMEWLTFGINALSGPFPKEIGLLTNLKSLGFGVNKFSGSIPPEIG  188

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            N T L ++Y+ +  L G +P   + L  L  LW    + TG++P+F+G
Sbjct  189  NCTKLMKIYLGNFELKGGLPSSFANLVELEDLWIVDLDVTGRIPDFIG  236


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (51%), Gaps = 5/154 (3%)
 Frame = +1

Query  202  LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-  378
            L+   RI  D  G++  +  ++I+G    G IP     L  + +L L  ++ NGS   + 
Sbjct  225  LDVTGRIP-DFIGSWTKLLTMRIHGTGWSGPIPSSFSNLTSLNELRLG-DISNGSSSLDF  282

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I  +  ++ L    NNLTG IP  IG  S L  +  + N ++GP+P  L NL  L  +++
Sbjct  283  IKDMKSLRILVLRNNNLTGTIPSNIGEFSNLEQVDLSFNQLHGPIPASLFNLNQLTYLFL  342

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +N L G +P +  K + L  +  S N+ +G LP
Sbjct  343  GNNTLNGSLPTQ--KSQGLSDIDVSYNDLSGSLP  374


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 66/159 (42%), Gaps = 26/159 (16%)
 Frame = +1

Query  262  LKIY--GLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTG  435
            +KIY    ++ G +P     L E+ DL +    + G +P  IG  TK+  +       +G
Sbjct  194  MKIYLGNFELKGGLPSSFANLVELEDLWIVDLDVTGRIPDFIGSWTKLLTMRIHGTGWSG  253

Query  436  PIPPEIGNLSILITLSFA------------------------TNNMNGPLPPELGNLTTL  543
            PIP    NL+ L  L                            NN+ G +P  +G  + L
Sbjct  254  PIPSSFSNLTSLNELRLGDISNGSSSLDFIKDMKSLRILVLRNNNLTGTIPSNIGEFSNL  313

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            E++ +  N+L GPIP  L  L  L  L+  +N   G LP
Sbjct  314  EQVDLSFNQLHGPIPASLFNLNQLTYLFLGNNTLNGSLP  352



>ref|XP_010480195.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Camelina sativa]
Length=1017

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 133/230 (58%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   MGILGFSFFVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVN------LSSFE  171
            + +L +  F+ GL + V  Q+     TDP+E  A+N I   W + +  +      L S  
Sbjct  10   LSLLVWFVFLSGLFHVVRPQNRTRATTDPDEARALNNIFRTWKITATKDWNISGELCSGA  69

Query  172  PCDKNASWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNL  342
              D + S   L  NP I CDC+    T C I  L+  G+D+ G IP +L+ L  + +LNL
Sbjct  70   AIDDSVSIDNLAFNPLIKCDCTFVDSTICRIVALRANGMDVAGRIPDDLWTLVFISNLNL  129

Query  343  AQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPE  522
             QN L+G + P IG LT+M+W++FG N LTGP+P EIG L+ L +L+   NN +G LPPE
Sbjct  130  HQNFLSGPLSPGIGNLTQMQWMTFGANALTGPVPKEIGLLTDLRSLAIDMNNFSGSLPPE  189

Query  523  LGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +GN T L ++YI S+ L+G IP   + L NL   W +    TG++P+F+G
Sbjct  190  IGNCTRLVKIYIGSSGLSGEIPSSFANLVNLEEAWINDIQLTGQIPDFIG  239


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 74/148 (50%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  ++ L+I G  + G IP     L  + +L L +   + S    I ++  +  L
Sbjct  236  DFIGNWTKLSTLRILGTSLTGPIPSTFANLISLTELRLGEISNSNSSLQFIREMKSISVL  295

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG+ S L  L  + N + G +P  L N   L  +++ +N+L G +P
Sbjct  296  VLRNNNLTGTIPSDIGDYSWLRQLDLSFNKLTGQIPASLFNSRQLTHLFLGNNKLNGSLP  355

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+  G+LP ++
Sbjct  356  AQKSPSLSNIDV---SYNDLAGELPSWV  380


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 67/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + GEIP     L  + +  +    L G +P  IG  TK+  L   
Sbjct  191  GNCTRLVKIYIGSSGLSGEIPSSFANLVNLEEAWINDIQLTGQIPDFIGNWTKLSTLRIL  250

Query  418  TNNLTGPIPPEIGNLSILITLSFA------------------------TNNMNGPLPPEL  525
              +LTGPIP    NL  L  L                            NN+ G +P ++
Sbjct  251  GTSLTGPIPSTFANLISLTELRLGEISNSNSSLQFIREMKSISVLVLRNNNLTGTIPSDI  310

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G+ + L ++ +  N+LTG IP  L   + L  L+  +N   G LP
Sbjct  311  GDYSWLRQLDLSFNKLTGQIPASLFNSRQLTHLFLGNNKLNGSLP  355



>ref|XP_006392563.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum]
 gb|ESQ29849.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum]
Length=986

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 130/219 (59%), Gaps = 12/219 (5%)
 Frame = +1

Query  46   VLGLLNTVIAQSNITDPNEVVAINKIIDHWNLR--SKVNLSSFEPC-----DKNASWAPL  204
            + G ++ V AQ   TDP+E  A+N I   W ++   + N+S  E C     ++  +    
Sbjct  15   ISGSVHLVRAQKR-TDPDEARALNSIFATWKIQVTKEWNISG-ELCSGVAIEEGITIDSK  72

Query  205  EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I C C     T C I  LK+Y +D+VG IP +L+ LK + +LNL QN L GS+ P
Sbjct  73   AYNPLIKCGCDFSNSTICRITALKVYAMDVVGPIPPQLWTLKFLTNLNLGQNYLTGSLSP  132

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG LT+M+W++FG N L+GP+P EIG L+ L  L   +NN +G +P E+GN   L++MY
Sbjct  133  AIGNLTQMEWMTFGINALSGPLPKEIGLLTELKLLGIGSNNFSGSIPTEIGNCKKLQQMY  192

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ LTG IP   +    L+V W +    TG++P+F+G
Sbjct  193  IDSSGLTGGIPLSFANFVELQVAWITDLEVTGRIPDFIG  231


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 63/139 (45%), Gaps = 0/139 (0%)
 Frame = +1

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
            F  +    I  L++ G IP  +    ++  L +    L+G +P     LT +  L  G  
Sbjct  209  FVELQVAWITDLEVTGRIPDFIGKWTKLTSLRILGTGLSGPIPSSFSNLTSLTELGLGDI  268

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
            +        I ++  L TL     N+ G +P  +G  ++L+++ +  N+L GP+P  L  
Sbjct  269  SNVSSSLEFIKDMKSLSTLVLRNINLTGAIPSNIGEYSSLQQVDLSFNKLQGPVPASLFN  328

Query  604  LKNLRVLWASSNNFTGKLP  660
            L +L  L   +N F G LP
Sbjct  329  LPSLTHLLLGNNTFNGSLP  347


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 7/139 (5%)
 Frame = +1

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLN--LAQNV-LNGSVPPEIGQLTKMKWLS  411
            +F ++  L   GL  +  +   L  +K+M  L+  + +N+ L G++P  IG+ + ++ + 
Sbjct  253  SFSNLTSLTELGLGDISNVSSSLEFIKDMKSLSTLVLRNINLTGAIPSNIGEYSSLQQVD  312

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
               N L GP+P  + NL  L  L    N  NG LP +     +L  + +  N L+G +P 
Sbjct  313  LSFNKLQGPVPASLFNLPSLTHLLLGNNTFNGSLPTQ--KRQSLSNIDMSYNDLSGSLPP  370

Query  592  ELSKLKNLRVLWASSNNFT  648
             + +L NL+ L   +NNFT
Sbjct  371  WV-RLPNLK-LNLVANNFT  387



>ref|XP_010501250.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
Length=1017

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 128/222 (58%), Gaps = 12/222 (5%)
 Frame = +1

Query  43   FVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVN------LSSFEPCDKNASW  195
            F+ GL + V  Q+     TDP+E  A+N I   W + +  +      L S    D + S 
Sbjct  18   FMSGLFHVVRPQNRTRATTDPDEARALNNIFRTWKITATKDWNISGELCSGAAIDDSVSI  77

Query  196  APLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
              L  NP I CDC+    T C I  L+  G+D+ G IP +L+ L  + +LNL QN L G 
Sbjct  78   DNLAFNPLIKCDCTFVDSTICRIVSLRANGMDVAGRIPDDLWTLVFISNLNLHQNFLTGP  137

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            + P IG LT+M+W++FG N LTGP+P EIG L+ L +L+   NN +G LPPE+GN T L 
Sbjct  138  LSPGIGNLTQMQWMTFGANALTGPVPKEIGLLTDLRSLAIDMNNFSGSLPPEIGNCTRLV  197

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YI S+ L+G IP   + L NL   W +    TG++P+F+G
Sbjct  198  KIYIGSSGLSGEIPSSFANLVNLEEAWINDIQLTGQIPDFIG  239


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G++  +  L+I G  + G IP     L  + +L L +   + S    I ++  +  L
Sbjct  236  DFIGSWTKLTTLRILGTSLAGPIPSTFANLVSLTELRLGEISNSNSSLQFIREMKSISVL  295

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG+   L  L  + N + G +P  L N   L  +++ +N+L G +P
Sbjct  296  VLRNNNLTGTIPSDIGDYLWLRQLDLSFNKLTGQIPASLFNSRQLTHLFLGNNKLNGSLP  355

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+  G LP ++
Sbjct  356  AQKSPSLSNIDV---SYNDLAGDLPSWV  380



>emb|CDY47811.1| BnaC07g17020D [Brassica napus]
Length=1015

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 124/225 (55%), Gaps = 12/225 (5%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQ---SNITDPNEVVAINKIIDHWNL------RSKVNLSSFEPCDKN  186
            F   + G L  V AQ     ITDP+E  A+N I   W +       +   L S    D N
Sbjct  12   FLLCITGSLRLVRAQNLTGAITDPDEAEALNSIFAAWKILKLREWNTSSELCSGPAIDDN  71

Query  187  ASWAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVL  357
                    NP I CDC   S T C I  LK++G D VG IP +L+ L  + +LNLAQN L
Sbjct  72   IKIDDQAYNPFIKCDCTFNSSTICRITALKVFGKDAVGPIPPQLWTLIYLENLNLAQNYL  131

Query  358  NGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLT  537
             GS+ P IG LT+M+WL+FG N L+GP P EIG L+ L +L F  N  +G +PPE+GN T
Sbjct  132  TGSISPAIGNLTRMEWLTFGINALSGPFPKEIGLLTNLKSLGFGVNKFSGSIPPEIGNCT  191

Query  538  TLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L ++Y+ +  L G +P   + L  L  LW    + TG++P+F+G
Sbjct  192  KLMKIYLGNFELKGGLPSSFANLVELEDLWIVDLDVTGRIPDFIG  236


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 80/154 (52%), Gaps = 5/154 (3%)
 Frame = +1

Query  202  LEANPRIACDCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-  378
            L+   RI  D  G++  +  ++I+G    G IP     L  + +L L  ++ NGS   + 
Sbjct  225  LDVTGRIP-DFIGSWTKLLTMRIHGTGWSGPIPSSFSNLTSLKELRLG-DISNGSSSLDF  282

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            I  +  ++ L    NNLTG IP +IG  S L  +  + N ++GP+P  L NL  L  +++
Sbjct  283  IKDMKSLRILVLRNNNLTGTIPSDIGEFSNLEQVDLSFNQLHGPIPASLFNLKQLTHLFL  342

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
             +N L G +P +  K ++L  +  S N+ +G LP
Sbjct  343  GNNTLNGSLPTQ--KSQSLSDIDVSYNDLSGSLP  374


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 68/159 (43%), Gaps = 26/159 (16%)
 Frame = +1

Query  262  LKIY--GLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTG  435
            +KIY    ++ G +P     L E+ DL +    + G +P  IG  TK+  +       +G
Sbjct  194  MKIYLGNFELKGGLPSSFANLVELEDLWIVDLDVTGRIPDFIGSWTKLLTMRIHGTGWSG  253

Query  436  PIPPEIGNLSILITLSFA------------------------TNNMNGPLPPELGNLTTL  543
            PIP    NL+ L  L                            NN+ G +P ++G  + L
Sbjct  254  PIPSSFSNLTSLKELRLGDISNGSSSLDFIKDMKSLRILVLRNNNLTGTIPSDIGEFSNL  313

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            E++ +  N+L GPIP  L  LK L  L+  +N   G LP
Sbjct  314  EQVDLSFNQLHGPIPASLFNLKQLTHLFLGNNTLNGSLP  352



>gb|AAG50912.1|AC069159_13 hypothetical protein, 3' partial [Arabidopsis thaliana]
Length=580

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 125/206 (61%), Gaps = 12/206 (6%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E  A+N I   W +++  + N+S  E C   A  A +       NP I CDCS   
Sbjct  37   THPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFQN  95

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW-LSF  414
             T C I  +K+Y +D+VG IP EL+ L  + +LNL QNVL GS+PP IG LT+M+W ++F
Sbjct  96   STICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWIMTF  155

Query  415  GTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEE  594
            G N L+GP+P EIG L+ L  L  ++NN +G +P E+G  T L++MYIDS+ L+G IP  
Sbjct  156  GINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLS  215

Query  595  LSKLKNLRVLWASSNNFTGKLPEFLG  672
             + L  L   W +    T ++P+F+G
Sbjct  216  FANLVQLEQAWIADLEVTDQIPDFIG  241


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 8/197 (4%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS         +W A LE   +I  D  G +  + 
Sbjct  189  PDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIP-DFIGDWTKLT  247

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             L+I G  + G IP     L  + +L L       S    I  +  +  L    NNLTG 
Sbjct  248  TLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGT  307

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            IP  IG  S L  +  + N ++GP+P  L NL+ L  +++ +N L G  P +  K ++LR
Sbjct  308  IPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQ--KTQSLR  365

Query  619  VLWASSNNFTGKLPEFL  669
             +  S N+ +G LP ++
Sbjct  366  NVDVSYNDLSGSLPSWV  382



>ref|XP_010234449.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Brachypodium distachyon]
Length=1030

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 118/207 (57%), Gaps = 34/207 (16%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVN---------LSSFEPCDKNASWAPLEANPRIACDCS-  237
            TDP+EV A+N I   W LR+ ++         L S    D       ++ NP I CDCS 
Sbjct  37   TDPSEVAALNAIFRRWGLRAPLSPPLWNISGELCSGAAVDDTELDTAVDFNPGIKCDCSY  96

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI RLK+                      NL QN L GS+P  IG+LT++K+L+
Sbjct  97   NVSTVCHITRLKV----------------------NLVQNYLTGSLPAFIGKLTRLKYLA  134

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
             G N LTG +P E+GNL  LI L  +TN   GPLP  + NLT LE++YIDS  L+G +P 
Sbjct  135  LGINALTGVVPRELGNLKNLIALGISTNKFVGPLPEVVENLTQLEQLYIDSCGLSGELPP  194

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKLKNL++LWAS N FTGK+P+++G
Sbjct  195  NFSKLKNLKILWASDNEFTGKIPDYIG  221



>ref|XP_008366779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Malus domestica]
Length=582

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 132/228 (58%), Gaps = 9/228 (4%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA  189
            +M IL   F          A++  TDP+EV A+N I + W+ ++   L  +S EPC  +A
Sbjct  34   MMRILLLCFLSRFWFQLSFAKNATTDPSEVRALNSIFEQWDTQAVSGLWNTSGEPCSGSA  93

Query  190  ----SWAPLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQ  348
                 +   + NP IACDC+    T CHI +L+++ L   G  P+E   L+ +  L +  
Sbjct  94   INGTEFEIPDNNPAIACDCTYDNDTTCHITKLRVHALYKRGVFPEEFLDLRYLAVLKIDM  153

Query  349  NVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELG  528
            N   G +P  IG ++ +  LS G N+ +GPIP E+GNL+ L  L+  +NN +G LPPELG
Sbjct  154  NYFKGPLPXFIGNMSALIILSIGHNSFSGPIPKELGNLTELNMLAIGSNNFSGTLPPELG  213

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            NL  L+++Y+DS  L G IP   +KL + ++ WA  + F+GK+P+F+G
Sbjct  214  NLVKLQQIYMDSCGLXGEIPSTFAKLTSXQIFWAXDSLFSGKIPDFIG  261


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKW  405
            D  G +  +  L   G  + G IP     L  +  L+++ ++ +GS   + I ++  +  
Sbjct  258  DFIGNWTQLTSLXFQGNSLEGPIPTSFSQLTSLNSLHIS-DIYDGSSSLDFIKKMKNLTE  316

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            L      +TG  P +IG    L  L  + NN+ G LP  L  L +L  +++ +N L+GP+
Sbjct  317  LKLRNALITGTXPSDIGEYQXLQILDLSFNNLXGQLPSSLFXLXSLTXLFLGNNSLSGPL  376

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFL  669
            P + S L  L+ +  S N  +G  P+++
Sbjct  377  PSQKSNL--LQTIDLSYNFLSGSFPQWV  402



>emb|CDY59119.1| BnaCnng34350D [Brassica napus]
Length=1004

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 127/218 (58%), Gaps = 12/218 (6%)
 Frame = +1

Query  55   LLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLE  207
            L N V AQ+     TDP+E  A+NKI + W + +         L S    D + S   L 
Sbjct  18   LFNAVRAQNGTKATTDPDEARALNKIFETWKITATDAWNISGELCSGAAIDDSVSIDNLF  77

Query  208  ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
             NP I CDCS    T C I  L+  G+++ G IP+EL+ L  + +LNL QN L+GS+ P 
Sbjct  78   FNPLIKCDCSFVDSTICRIIALRARGMNVTGPIPQELWSLVYISNLNLNQNFLSGSLSPG  137

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPPE+GN T L ++YI
Sbjct  138  IGNLTRMQWMTFGANALSGPLPKEIGLLTDLRSLAVDMNNFSGSLPPEIGNCTRLVKIYI  197

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             S+ LTG +P     L NL   W +    TG +P FLG
Sbjct  198  GSSGLTGELPSSFVNLVNLEEAWINDIQLTGPIPAFLG  235


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 74/145 (51%), Gaps = 4/145 (3%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G +  +  L+I G ++ G IP     L  + +L L +   + S    I  +  +  L   
Sbjct  235  GNWTSLTTLRILGTNLSGPIPSTFANLASLTELRLGEISNSRSSLQFIRNMKSLSVLVLR  294

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP-EE  594
             NNLTG IP  I +   L  L  + NN+ G +PP L N + L  +++ +N+L+G +P ++
Sbjct  295  NNNLTGTIPSNIADYLQLRQLDLSFNNLTGQIPPSLFNSSQLTHLFLGNNKLSGSLPIKK  354

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
             S L NL V   S N+ TG LP ++
Sbjct  355  SSSLSNLDV---SYNDLTGNLPSWV  376



>ref|XP_009127785.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brassica rapa]
Length=1014

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 125/203 (62%), Gaps = 9/203 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCD----KNASWAPLEANPRIACDC--SGT  243
            T P+E  A+N I   W +R+  + N+S  E C      N S      NP I C C  + +
Sbjct  32   THPDEARALNSIFATWKIRASNEWNISG-ELCSGAAIDNVSIDDGAYNPMIKCTCTFANS  90

Query  244  FCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTN  423
             C I  LK+Y +D+VG IP EL+ L+ + +LNLAQN L G + P IG LT+M+W++FG N
Sbjct  91   TCRITALKVYAIDVVGTIPDELWTLEYLTNLNLAQNFLTGPLSPAIGNLTRMEWMTFGIN  150

Query  424  NLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK  603
             L+GP+P EIG L+ L  LS ++NN +G +P E+G+ T L+++YIDS+ L G IP   + 
Sbjct  151  ALSGPVPKEIGLLTNLKLLSISSNNFSGSMPAEIGSCTKLQQIYIDSSGLGGEIPLSFAN  210

Query  604  LKNLRVLWASSNNFTGKLPEFLG  672
            L  ++  W     FTG++P+F+G
Sbjct  211  LVEMQQAWMMDLEFTGRIPDFIG  233


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 99/199 (50%), Gaps = 12/199 (6%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L  ++ LS     +   +W   LE   RI  D  G +  + 
Sbjct  181  PAEIGSCTKLQQIYIDSSGLGGEIPLSFANLVEMQQAWMMDLEFTGRIP-DFIGNWTKLT  239

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  240  TLRIVGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSTLEFIKNMKSLSTLVLRNNNLTG  298

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
             IP +IG+ S L  +  + N ++GP+P  L NLT L  +++ +N L G +P + S+ L N
Sbjct  299  EIPSDIGDYSSLQQVDLSFNKLHGPIPSSLFNLTRLTHLFLGNNTLNGSLPTQKSQSLSN  358

Query  613  LRVLWASSNNFTGKLPEFL  669
            + V   S NN +G LP ++
Sbjct  359  IDV---SYNNLSGILPSWV  374



>emb|CAN73893.1| hypothetical protein VITISV_028202 [Vitis vinifera]
Length=361

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 126/209 (60%), Gaps = 10/209 (5%)
 Frame = +1

Query  73   AQSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNA-SWAPLEA---NPRIACDC  234
            AQ+   D +E  A+N I   W+ +S    N+S  EPC  +A S +  E    NP I CDC
Sbjct  40   AQNATLDASEAEALNSIFQQWDTQSAALWNISG-EPCTGSAISGSGFEETANNPAITCDC  98

Query  235  S---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKW  405
            +    T CHI +L++Y L+  G IP+EL  L  +  L + QN   G +P  IG L+K++ 
Sbjct  99   TYNNSTTCHITQLRVYALNRRGVIPEELTALTYLTFLKIDQNYFTGPLPSFIGNLSKLQL  158

Query  406  LSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPI  585
            LS   N L+G IP E+GNL  L  LS ++NN +G LPPELGNL  L E+YI+S  + G I
Sbjct  159  LSLAHNALSGTIPMELGNLQELTVLSLSSNNFSGTLPPELGNLVNLRELYINSLGVGGEI  218

Query  586  PEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            P   + L+N++V+ AS   F+GK+P+F+G
Sbjct  219  PSTFANLENMQVMRASDCPFSGKIPDFIG  247



>ref|XP_010501246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
 ref|XP_010501247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Camelina sativa]
Length=1027

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 127/205 (62%), Gaps = 11/205 (5%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---  237
            T P+E  A+N I   W +R+  + N+S  E C   A    +       NP I CDCS   
Sbjct  36   THPDEARALNSIFAAWRIRAPREWNISG-ELCSGAAIDDTVLDNNPAYNPLIKCDCSFEN  94

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
               C I  +K++  ++VG IP+EL+ LK + +LNL QNVL GS+PP IG LT+M+W++FG
Sbjct  95   SRICRITNIKVFAREVVGPIPEELWTLKYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG  154

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEEL  597
             N L+GP+P EIG L+ L  LS ++NN +G +P E+GN   L++++IDS+ L+G IP   
Sbjct  155  INALSGPVPKEIGLLTDLRLLSISSNNFSGSIPDEIGNCAKLQQIFIDSSGLSGRIPLSF  214

Query  598  SKLKNLRVLWASSNNFTGKLPEFLG  672
            + L +L   W +    TG++P+F+G
Sbjct  215  ANLVDLEQAWLADLEVTGQIPDFIG  239


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 91/185 (49%), Gaps = 6/185 (3%)
 Frame = +1

Query  121  IIDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHINRLKIYGLDIVGEI  297
             ID   L  ++ LS     D   +W A LE   +I  D  G +  +  L+I G  + G I
Sbjct  200  FIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIP-DFIGKWTKLTTLRILGTGLSGPI  258

Query  298  PKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILI  474
            P     L  + +L L  ++ NGS   E I  +  +  L    NNLTG IP  IG  S L 
Sbjct  259  PSSFSNLTYLTELRLG-DISNGSSSLEFIKDMKSLSILVLRNNNLTGTIPSTIGGYSSLQ  317

Query  475  TLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGK  654
             +  + N ++GP+P  L NL+ L  +++ +N L G +P +  K ++L  +  S N+ +G 
Sbjct  318  QVDLSFNKLHGPIPASLFNLSGLTHLFLGNNTLNGSLPTQ--KSQSLSYIDVSYNDLSGI  375

Query  655  LPEFL  669
            LP ++
Sbjct  376  LPSWV  380


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 68/165 (41%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + G IP     L ++    LA   + G +P  IG+ TK+  L   
Sbjct  191  GNCAKLQQIFIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIPDFIGKWTKLTTLRIL  250

Query  418  TNNLTGPIPPEIGNLSILITLSFA------------------------TNNMNGPLPPEL  525
               L+GPIP    NL+ L  L                            NN+ G +P  +
Sbjct  251  GTGLSGPIPSSFSNLTYLTELRLGDISNGSSSLEFIKDMKSLSILVLRNNNLTGTIPSTI  310

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G  ++L+++ +  N+L GPIP  L  L  L  L+  +N   G LP
Sbjct  311  GGYSSLQQVDLSFNKLHGPIPASLFNLSGLTHLFLGNNTLNGSLP  355



>ref|XP_010557130.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Tarenaya hassleriana]
Length=1047

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 120/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T P+E  A+N I   W +++         L S    D + +      NP I CDCS    
Sbjct  42   THPDEARALNSIFGAWKIKATNAWNISGELCSGAAVDDSVAIDISAFNPFIKCDCSFLNS  101

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  LK+ G+D+ G IP+EL+ L  + +LNL QN L GS+ P IG LT+M+WL+FG 
Sbjct  102  TLCRITALKVRGMDVAGPIPEELWTLVYISNLNLFQNRLTGSLSPGIGNLTRMQWLTFGA  161

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N ++GP+P EIG LS L +L+   NN +G LPPE+G  T L+++Y+ S+ L+G IP   +
Sbjct  162  NAMSGPVPKEIGLLSDLRSLALDMNNFSGSLPPEIGQCTRLQKIYLASSGLSGEIPSTFA  221

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L  L   W +    TG+LP+F+G
Sbjct  222  NLVELEEAWMTDIQLTGRLPDFIG  245


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +   + S    I  +  +  L
Sbjct  242  DFIGNWTKLTTLRILGSGLNGPIPSSFANLTSLTELRLGEISNSNSSLEFIRNMKSLSVL  301

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG    L  L  + N++ GP+P  L +L+ L  +++ +N+L+G +P
Sbjct  302  VLRNNNLTGVIPSDIGEYLTLQQLDLSFNSLTGPIPASLFSLSQLTHLFLGNNKLSGTLP  361

Query  589  EELSK-LKNLRVLWASSNNFTGKLPEFL  669
             + S+ L N+ V   S N+  G LP ++
Sbjct  362  NQKSQSLINIDV---SYNDLEGSLPSWV  386



>ref|XP_010234448.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Brachypodium distachyon]
Length=1034

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 118/207 (57%), Gaps = 34/207 (16%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRSKVN---------LSSFEPCDKNASWAPLEANPRIACDCS-  237
            TDP+EV A+N I   W LR+ ++         L S    D       ++ NP I CDCS 
Sbjct  37   TDPSEVAALNAIFRRWGLRAPLSPPLWNISGELCSGAAVDDTELDTAVDFNPGIKCDCSY  96

Query  238  --GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
               T CHI RLK+                      NL QN L GS+P  IG+LT++K+L+
Sbjct  97   NVSTVCHITRLKV----------------------NLVQNYLTGSLPAFIGKLTRLKYLA  134

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
             G N LTG +P E+GNL  LI L  +TN   GPLP  + NLT LE++YIDS  L+G +P 
Sbjct  135  LGINALTGVVPRELGNLKNLIALGISTNKFVGPLPEVVENLTQLEQLYIDSCGLSGELPP  194

Query  592  ELSKLKNLRVLWASSNNFTGKLPEFLG  672
              SKLKNL++LWAS N FTGK+P+++G
Sbjct  195  NFSKLKNLKILWASDNEFTGKIPDYIG  221



>ref|XP_010557141.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Tarenaya hassleriana]
Length=1000

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 120/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T P+E  A+N I   W +++         L S    D + +      NP I CDCS    
Sbjct  42   THPDEARALNSIFGAWKIKATNAWNISGELCSGAAVDDSVAIDISAFNPFIKCDCSFLNS  101

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  LK+ G+D+ G IP+EL+ L  + +LNL QN L GS+ P IG LT+M+WL+FG 
Sbjct  102  TLCRITALKVRGMDVAGPIPEELWTLVYISNLNLFQNRLTGSLSPGIGNLTRMQWLTFGA  161

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N ++GP+P EIG LS L +L+   NN +G LPPE+G  T L+++Y+ S+ L+G IP   +
Sbjct  162  NAMSGPVPKEIGLLSDLRSLALDMNNFSGSLPPEIGQCTRLQKIYLASSGLSGEIPSTFA  221

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L  L   W +    TG+LP+F+G
Sbjct  222  NLVELEEAWMTDIQLTGRLPDFIG  245


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +   + S    I  +  +  L
Sbjct  242  DFIGNWTKLTTLRILGSGLNGPIPSSFANLTSLTELRLGEISNSNSSLEFIRNMKSLSVL  301

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG    L  L  + N++ GP+P  L +L+ L  +++ +N+L+G +P
Sbjct  302  VLRNNNLTGVIPSDIGEYLTLQQLDLSFNSLTGPIPASLFSLSQLTHLFLGNNKLSGTLP  361

Query  589  EELSK-LKNLRVLWASSNNFTGKLPEFL  669
             + S+ L N+ V   S N+  G LP ++
Sbjct  362  NQKSQSLINIDV---SYNDLEGSLPSWV  386



>ref|XP_006468414.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
Length=1045

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 130/219 (59%), Gaps = 12/219 (5%)
 Frame = +1

Query  49   LGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDK---NASWAPLEA-  210
            +GL       ++ TDP EV A+N I+  W+  +    N+S  EPC     NA+ +  E+ 
Sbjct  26   IGLSEAQNNTTSTTDPAEVRALNSILQQWDAPAVPLWNISG-EPCSGSALNATDSEFESP  84

Query  211  --NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
              NP I CDC+   G  CHI +L++Y L+  G IP+EL  L+ +  L + QN   G +P 
Sbjct  85   NNNPAIVCDCTFDNGATCHITKLRVYALNKKGVIPEELVTLQYLTFLKIDQNFFTGPLPS  144

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             IG L+++  LS   N  +G +P E+GNL  L  LSF  NN +G LPPE+GNL  LE++Y
Sbjct  145  FIGNLSRLMLLSVAHNVFSGSVPRELGNLKELTVLSFGNNNFSGTLPPEIGNLAKLEQLY  204

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++S    G IP   +KL+N++ LWAS   FTGK+P+F+G
Sbjct  205  LNSWGAGGEIPSTYAKLRNMQTLWASDAPFTGKIPDFIG  243


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 70/147 (48%), Gaps = 2/147 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP  L  L  +  L ++      S    +  L  +  L
Sbjct  240  DFIGNWTKLKSLRFQGNSFQGPIPSSLSKLASLDSLRISDIYNVSSSLDFVMSLKNLTDL  299

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
            S     +TG IP  IG L  L TL  + NN+ G +P  L N+ +L  +++ +N L+G +P
Sbjct  300  SLRNALITGSIPSGIGELQNLQTLDLSFNNLTGQIPRTLFNIGSLNYLFLGNNSLSGTLP  359

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             +  K +NL+ +  S N+ +G  P ++
Sbjct  360  TQ--KSENLQNIDLSYNHLSGPFPSWV  384



>ref|XP_010557133.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Tarenaya hassleriana]
Length=1015

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 120/204 (59%), Gaps = 9/204 (4%)
 Frame = +1

Query  88   TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLEANPRIACDCS---G  240
            T P+E  A+N I   W +++         L S    D + +      NP I CDCS    
Sbjct  42   THPDEARALNSIFGAWKIKATNAWNISGELCSGAAVDDSVAIDISAFNPFIKCDCSFLNS  101

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGT  420
            T C I  LK+ G+D+ G IP+EL+ L  + +LNL QN L GS+ P IG LT+M+WL+FG 
Sbjct  102  TLCRITALKVRGMDVAGPIPEELWTLVYISNLNLFQNRLTGSLSPGIGNLTRMQWLTFGA  161

Query  421  NNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
            N ++GP+P EIG LS L +L+   NN +G LPPE+G  T L+++Y+ S+ L+G IP   +
Sbjct  162  NAMSGPVPKEIGLLSDLRSLALDMNNFSGSLPPEIGQCTRLQKIYLASSGLSGEIPSTFA  221

Query  601  KLKNLRVLWASSNNFTGKLPEFLG  672
             L  L   W +    TG+LP+F+G
Sbjct  222  NLVELEEAWMTDIQLTGRLPDFIG  245


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+I G  + G IP     L  + +L L +   + S    I  +  +  L
Sbjct  242  DFIGNWTKLTTLRILGSGLNGPIPSSFANLTSLTELRLGEISNSNSSLEFIRNMKSLSVL  301

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG    L  L  + N++ GP+P  L +L+ L  +++ +N+L+G +P
Sbjct  302  VLRNNNLTGVIPSDIGEYLTLQQLDLSFNSLTGPIPASLFSLSQLTHLFLGNNKLSGTLP  361

Query  589  EELSK-LKNLRVLWASSNNFTGKLPEFL  669
             + S+ L N+ V   S N+  G LP ++
Sbjct  362  NQKSQSLINIDV---SYNDLEGSLPSWV  386



>gb|EEC83075.1| hypothetical protein OsI_28198 [Oryza sativa Indica Group]
Length=891

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 130/210 (62%), Gaps = 12/210 (6%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHW-NLRSKVNLSSFEPCDK---NASWAPLEANPR----IACD  231
            Q+  TDP EV A+  I+  W    S +   S EPC     + S   L+ NP+    I CD
Sbjct  28   QAATTDPIEVAALEAILGRWGKTTSPLWRMSGEPCRGVPVDGS-TDLDGNPKNNPGIKCD  86

Query  232  CS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMK  402
            CS   GT CHI +L++Y L++VG+IP EL  L  +  LNL QN L+G +P  IGQLT + 
Sbjct  87   CSYNSGTVCHITQLRVYALNVVGQIPAELQNLTYLTYLNLDQNYLSGPIPSFIGQLTALT  146

Query  403  WLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGP  582
             L  G N L+G +P E+GNL+ L  L  +  N +G LP ELGNLT L ++Y DS  L+GP
Sbjct  147  ELHVGFNPLSGSLPKELGNLTNLNLLGISLTNFSGQLPEELGNLTKLRQLYTDSAGLSGP  206

Query  583  IPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             P  LS+LKNL++L AS NNFTG +P+F+G
Sbjct  207  FPSTLSRLKNLKLLRASDNNFTGTIPDFIG  236


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G++P+EL  L ++  L      L+G  P  + +L  +K L    NN TG IP  IG+LSI
Sbjct  181  GQLPEELGNLTKLRQLYTDSAGLSGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIGSLSI  240

Query  469  LITLSF----------ATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELS  600
              +  F          + NN++G +P  + NL  L  +++ +N LTG +P+ +S
Sbjct  241  GRSCLFKYAVFWRRDLSFNNISGNVPKSILNLQKLIFLFLGNNSLTGELPDGIS  294



>gb|EEE68221.1| hypothetical protein OsJ_26393 [Oryza sativa Japonica Group]
Length=890

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 18/213 (8%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHW-NLRSKVNLSSFEPCDKNASWAPLEA----------NPRI  222
            Q+  TDP EV A+  I+  W    S +   S EPC       P++           NP I
Sbjct  28   QAATTDPIEVAALEAILGRWGKTTSPLWRMSGEPCRG----VPVDGSTDLDGNPKNNPGI  83

Query  223  ACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLT  393
             CDCS   GT CHI +L++Y L++VG+IP EL  L  +  LNL QN L+G +P  IGQLT
Sbjct  84   KCDCSYNSGTVCHITQLRVYALNVVGQIPAELQNLTYLTYLNLDQNYLSGPIPSFIGQLT  143

Query  394  KMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRL  573
             +  L  G N L+G +P E+GNL+ L  L  +  N +G LP ELGNLT L ++Y DS  L
Sbjct  144  ALTELHVGFNPLSGSLPKELGNLTNLNLLGISLTNFSGQLPEELGNLTKLRQLYTDSAGL  203

Query  574  TGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +GP P  LS+LKNL++L AS NNFTG +P+F+G
Sbjct  204  SGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIG  236



>ref|XP_010462494.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
 ref|XP_010462495.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Camelina sativa]
Length=1017

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 129/222 (58%), Gaps = 12/222 (5%)
 Frame = +1

Query  43   FVLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSKVN------LSSFEPCDKNASW  195
            F+ GL + V  Q+     TDP+E  A+N I   W + +  +      L S    D + S 
Sbjct  18   FMSGLFHVVRPQNRTRATTDPDEARALNNIFRTWKITATKDWNISGELCSGAAIDDSVSI  77

Query  196  APLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGS  366
              L  NP I CDC+    T C I  L+  G+D+ G IP +L+ L  + +LNL QN L+G 
Sbjct  78   DNLAFNPLIKCDCTFVDSTICRIVALRANGMDVAGRIPDDLWTLVFISNLNLHQNFLSGP  137

Query  367  VPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLE  546
            + P IG LT+M+W++FG N LTGP+P EIG L+ L +L+   NN +G LPPE+GN T L 
Sbjct  138  LSPGIGNLTQMQWMTFGANALTGPVPKEIGLLTDLRSLAIDMNNFSGFLPPEIGNCTRLV  197

Query  547  EMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            ++YI S+ L+G IP   + L NL   W +    TG++P+F+G
Sbjct  198  KIYIGSSGLSGEIPSSFANLVNLEEAWINDIQLTGQIPDFIG  239


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 72/148 (49%), Gaps = 4/148 (3%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G++  +  L+I G  + G IP     L  + +L L +   + S    I ++  +  L
Sbjct  236  DFIGSWTKLTTLRILGTSLTGPIPSTFANLISLTELRLGEISNSSSSLQFIREMKSISVL  295

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NNLTG IP +IG+   L  L  + N + G +P  L N   L  +++ +N+L G +P
Sbjct  296  VLRNNNLTGTIPSDIGDYLWLRQLDLSFNKLIGQIPASLFNSKQLTHLFLGNNKLNGSLP  355

Query  589  EELS-KLKNLRVLWASSNNFTGKLPEFL  669
             + S  L N+ V   S N+  G LP ++
Sbjct  356  AQKSPSLSNIDV---SYNDLAGDLPSWV  380


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 65/165 (39%), Gaps = 24/165 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    + ++ I    + GEIP     L  + +  +    L G +P  IG  TK+  L   
Sbjct  191  GNCTRLVKIYIGSSGLSGEIPSSFANLVNLEEAWINDIQLTGQIPDFIGSWTKLTTLRIL  250

Query  418  TNNLTGPIPPEIGNLSILITLSFA------------------------TNNMNGPLPPEL  525
              +LTGPIP    NL  L  L                            NN+ G +P ++
Sbjct  251  GTSLTGPIPSTFANLISLTELRLGEISNSSSSLQFIREMKSISVLVLRNNNLTGTIPSDI  310

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLP  660
            G+   L ++ +  N+L G IP  L   K L  L+  +N   G LP
Sbjct  311  GDYLWLRQLDLSFNKLIGQIPASLFNSKQLTHLFLGNNKLNGSLP  355



>ref|XP_008368372.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Malus domestica]
Length=246

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 119/200 (60%), Gaps = 11/200 (6%)
 Frame = +1

Query  103  VVAINKIIDHWNLR---SKVNLSSFEPCDKNA----SWAPLEANPRIACDCS---GTFCH  252
            V A+N I + W+ +    + N+S  EPC   A    +   L+ NP + C+CS      CH
Sbjct  16   VRALNSIFEQWDTQPVAEQWNISG-EPCSGFAINFTNIESLDINPALVCNCSYDNNATCH  74

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
            I +L++Y L+  G  P+E   L+ +  L++ QN   G +P  IG ++ +  LS G N+ +
Sbjct  75   ITQLRVYALNKRGVFPEEFVALRYLTYLSIYQNYFTGPLPAFIGNMSALTHLSIGVNSFS  134

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
             PIP E+GNL  L  L   +NN +G LPPELGNL  LE++Y+DS  L G IP   + L N
Sbjct  135  EPIPKELGNLKELTYLDIGSNNFSGTLPPELGNLVKLEQLYMDSCGLGGEIPSTFANLTN  194

Query  613  LRVLWASSNNFTGKLPEFLG  672
            ++V+WAS N F+GK+P+F+G
Sbjct  195  MQVVWASDNPFSGKIPDFIG  214



>ref|XP_008447120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Cucumis melo]
Length=1034

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 137/241 (57%), Gaps = 31/241 (13%)
 Frame = +1

Query  28   LGFSFFVLGLLNTVI-------AQSN---ITDPNEVVAINKIIDHW-------------N  138
            LGF F +  +++ V        AQ++   ITDP++  A+N I   W             N
Sbjct  6    LGFIFVLCAIVSIVSHLIISSQAQNSTQPITDPDQARALNSIFRQWRISAPSGAWNISGN  65

Query  139  LRSKVNLSSFEPCDKNASWAPLEANPRIACDC---SGTFCHINRLKIYGLDIVGEIPKEL  309
            L S   + S    D N +      NP I CDC    G  C I +L +Y +++VG +P EL
Sbjct  66   LCSGRAVDSTTRIDSNGNL-----NPLIKCDCPANGGATCLITQLHVYAINVVGVLPPEL  120

Query  310  FVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFA  489
            + L  +  L L QN L G++   +G L++++ LS G N L+G +P E+G+LS L  L+  
Sbjct  121  WTLTSLTYLKLDQNFLTGTLSASVGNLSELRTLSLGINGLSGELPKELGSLSKLELLALG  180

Query  490  TNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFL  669
            +NN +GPLP ELGNL+ L E+YIDS+ ++G IP   S L+NL  +WAS N FTG++P+F+
Sbjct  181  SNNFSGPLPSELGNLSMLRELYIDSSGVSGGIPPSFSSLRNLEKVWASDNEFTGRIPDFI  240

Query  670  G  672
            G
Sbjct  241  G  241


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 70/147 (48%), Gaps = 2/147 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L+  G    G IP     L  + +L +       S    I ++T +  L
Sbjct  238  DFIGNWTRLTVLRFQGNSFTGPIPSTFSNLTSLTELRIGDLSNGSSSLAFISKMTSLTIL  297

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NN+TG IP  IG    L  L  + NN+ G +P  L +L++L  + + +N+LTG +P
Sbjct  298  VLRNNNITGSIPSNIGEFRRLAQLDLSFNNLTGEIPSSLFSLSSLSHLILGNNKLTGTLP  357

Query  589  EELSKLKNLRVLWASSNNFTGKLPEFL  669
             +  K ++L  +  S N+ +G  P ++
Sbjct  358  TQ--KSESLLNIDLSYNDLSGSFPAWI  382



>emb|CDX67736.1| BnaA07g17760D [Brassica napus]
Length=1004

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 127/218 (58%), Gaps = 12/218 (6%)
 Frame = +1

Query  55   LLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLE  207
            L N V AQ+     TDP+E  A+NKI + W + +         L S    D + S   L 
Sbjct  18   LFNAVRAQNGTRATTDPDEARALNKIFETWKITATEAWNMSGELCSGAAIDDSISIDNLF  77

Query  208  ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
             NP I CDCS    T C I  L+  G+++ G IP+EL+ L  + +LNL QN L+GS+ P 
Sbjct  78   YNPLIKCDCSFVGSTICRIIALRARGMNVTGPIPQELWSLVYISNLNLNQNFLSGSLSPG  137

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPPE+GN T L ++YI
Sbjct  138  IGNLTRMQWMTFGANALSGPLPKEIGLLTDLRSLAIDMNNFSGSLPPEIGNCTRLVKIYI  197

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             S+ LTG +P     L NL   W +    TG +P F+G
Sbjct  198  GSSGLTGELPSSFVNLVNLEEAWINDIQLTGPIPAFIG  235


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 74/145 (51%), Gaps = 4/145 (3%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G +  +  L+I G ++ G IP     L  + +L L +   + S    I  +  +  L   
Sbjct  235  GNWTSLTTLRILGTNLSGPIPSTFANLVSLTELRLGEISNSRSSLHFIRNMKSLSVLVLR  294

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP-EE  594
             NNLTG IP  I +   L  L  + NN+ G +PP L N + L  +++ +N+L+G +P ++
Sbjct  295  NNNLTGTIPSNIADYLQLRQLDLSFNNLTGQIPPSLFNSSQLTHLFLGNNKLSGSLPIQK  354

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
             S L NL V   S N+ TG LP ++
Sbjct  355  SSSLSNLDV---SYNDLTGNLPSWV  376



>ref|XP_009104133.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Brassica rapa]
Length=1004

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 127/218 (58%), Gaps = 12/218 (6%)
 Frame = +1

Query  55   LLNTVIAQSNI---TDPNEVVAINKIIDHWNLRS------KVNLSSFEPCDKNASWAPLE  207
            L N V AQ+     TDP+E  A+NKI + W + +         L S    D + S   L 
Sbjct  18   LFNAVRAQNGTRATTDPDEARALNKIFETWKITATEAWNKSGELCSGAAIDDSISIDNLF  77

Query  208  ANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE  378
             NP I CDCS    T C I  L+  G+++ G IP+EL+ L  + +LNL QN L+GS+ P 
Sbjct  78   YNPLIKCDCSFVGSTICRIIALRARGMNVTGPIPQELWSLVYISNLNLNQNFLSGSLSPG  137

Query  379  IGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYI  558
            IG LT+M+W++FG N L+GP+P EIG L+ L +L+   NN +G LPPE+GN T L ++YI
Sbjct  138  IGNLTRMQWMTFGANALSGPLPKEIGLLTDLRSLAVDMNNFSGSLPPEIGNCTRLVKIYI  197

Query  559  DSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             S+ LTG +P     L NL   W +    TG +P F+G
Sbjct  198  GSSGLTGELPSSFVNLVNLEEAWINDIQLTGPIPAFIG  235


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 74/145 (51%), Gaps = 4/145 (3%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G +  +  L+I G ++ G IP     L  + +L L +   + S    I  +  +  L   
Sbjct  235  GNWTSLTTLRILGTNLSGPIPSTFANLVSLTELRLGEISNSRSSLHFIRNMKSLSVLVLR  294

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP-EE  594
             NNLTG IP  I +   L  L  + NN+ G +PP L N + L  +++ +N+L+G +P ++
Sbjct  295  NNNLTGTIPSNIADYLQLRQLDLSFNNLTGQIPPSLFNSSQLTHLFLGNNKLSGSLPIQK  354

Query  595  LSKLKNLRVLWASSNNFTGKLPEFL  669
             S L NL V   S N+ TG LP ++
Sbjct  355  SSSLSNLDV---SYNDLTGNLPSWV  376



>emb|CDY43003.1| BnaC02g19770D [Brassica napus]
Length=2098

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 130/220 (59%), Gaps = 11/220 (5%)
 Frame = +1

Query  46   VLGLLNTVIAQSNI---TDPNEVVAINKIIDHWNLRSK------VNLSSFEPCDKNASWA  198
            + GL++ V AQ+     T P+E  A+N I   W +R+         L S    D   S  
Sbjct  19   IHGLVHVVRAQNRTRATTHPDEARALNSIFATWKIRASNEWNISGELCSGAAIDGGVSID  78

Query  199  PLEANPRIACDC--SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVP  372
                NP I C C  + + C I  +K+Y +D+VG +P EL+ L+ + +LNL QN L G + 
Sbjct  79   DGAYNPMIKCTCTFANSTCRITAVKVYAIDVVGTLPDELWTLEYLTNLNLGQNFLTGPLS  138

Query  373  PEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEM  552
            P IG LT+M+W++FG N L+GP+P EIG L+ L  LS ++NN +G +P E+G+ T L+++
Sbjct  139  PAIGNLTRMEWMTFGINALSGPVPKEIGLLTNLKLLSISSNNFSGSMPAEIGSCTKLQQI  198

Query  553  YIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            YIDS+ L+G IP   + L  L+ +W      TG++P+F+G
Sbjct  199  YIDSSGLSGEIPLAFANLVELQRVWMMDLEVTGRIPDFIG  238


 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 123/214 (57%), Gaps = 8/214 (4%)
 Frame = +1

Query  55    LLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVN------LSSFEPCDKNASWAPLEANP  216
             ++ ++I     ++  +  A+N I   W + +  +      L S    D   S      NP
Sbjct  1073  IITSIICYKFNSESQKTRALNSIFATWKINASNDWNISGELCSGAAGDGGVSVDDPAHNP  1132

Query  217   RIACDC--SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQL  390
              I C C  + + C I  LK+Y  DIVG IP EL+ LK + +LNL QN L G + P IG L
Sbjct  1133  IIKCACTFANSTCRITALKVYSKDIVGTIPDELWTLKHLTNLNLGQNFLTGPLSPAIGNL  1192

Query  391   TKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNR  570
             T+M+W++FG N L+GP+P EIG L+ L  LS  +NN +G +P E+G+ T L+E+YIDS+ 
Sbjct  1193  TRMEWMTFGINALSGPVPKEIGLLTNLKMLSIGSNNFSGSMPAEIGSCTKLQEIYIDSSG  1252

Query  571   LTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L+G IP   + L  L+ +W      TG++P+F+G
Sbjct  1253  LSGEIPLAFANLVELQRVWMMDLEVTGRIPDFIG  1286


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 97/199 (49%), Gaps = 12/199 (6%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
            P E+ +  K+    ID   L  ++ L+     +    W   LE   RI  D  G +  + 
Sbjct  186  PAEIGSCTKLQQIYIDSSGLSGEIPLAFANLVELQRVWMMDLEVTGRIP-DFIGNWTKLT  244

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    NNLTG
Sbjct  245  VLRIVGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSTLEFIKDMKSLSTLVLRNNNLTG  303

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
             IP +IG  S L  +  + N ++GP+P  L NLT L  +++ +N L G +P + S+ L N
Sbjct  304  VIPSDIGEYSSLQQVDLSFNKLHGPIPSSLFNLTRLTHLFLGNNTLNGSLPTQKSQSLSN  363

Query  613  LRVLWASSNNFTGKLPEFL  669
            + V   S NN +G LP ++
Sbjct  364  IDV---SYNNVSGILPSWV  379


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 12/199 (6%)
 Frame = +1

Query  94    PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASWA-PLEANPRIACDCSGTFCHIN  258
             P E+ +  K+    ID   L  ++ L+     +    W   LE   RI  D  G +  + 
Sbjct  1234  PAEIGSCTKLQEIYIDSSGLSGEIPLAFANLVELQRVWMMDLEVTGRIP-DFIGNWTKLT  1292

Query  259   RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
              L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    +NLTG
Sbjct  1293  VLRIVGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLEFIKDMKNLSRLVLRNSNLTG  1351

Query  436   PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSK-LKN  612
              IP +IG  S L  +  + N + GP+P  L NLT L  +++ +N L G +P + S+ L N
Sbjct  1352  EIPSDIGEYSSLQEVDLSFNKLRGPIPSSLFNLTGLTHLFLGNNTLNGSLPTQKSQSLSN  1411

Query  613   LRVLWASSNNFTGKLPEFL  669
             + V   S NN +G LP ++
Sbjct  1412  IDV---SYNNLSGSLPSWV  1427



>ref|NP_001061223.1| Os08g0203400 [Oryza sativa Japonica Group]
 dbj|BAD02996.1| putative Receptor-like serine/threonine kinase(RFK1) [Oryza sativa 
Japonica Group]
 dbj|BAF23137.1| Os08g0203400 [Oryza sativa Japonica Group]
 dbj|BAG91108.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1024

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 18/213 (8%)
 Frame = +1

Query  76   QSNITDPNEVVAINKIIDHWN-LRSKVNLSSFEPCDKNASWAPLEA----------NPRI  222
            Q+  TDP EV A+  I+  W    S +   S EPC       P++           NP I
Sbjct  28   QAATTDPIEVAALEAILGRWGKTTSPLWRMSGEPCRG----VPVDGSTDLDGNPKNNPGI  83

Query  223  ACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLT  393
             CDCS   GT CHI +L++Y L++VG+IP EL  L  +  LNL QN L+G +P  IGQLT
Sbjct  84   KCDCSYNSGTVCHITQLRVYALNVVGQIPAELQNLTYLTYLNLDQNYLSGPIPSFIGQLT  143

Query  394  KMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRL  573
             +  L  G N L+G +P E+GNL+ L  L  +  N +G LP ELGNLT L ++Y DS  L
Sbjct  144  ALTELHVGFNPLSGSLPKELGNLTNLNLLGISLTNFSGQLPEELGNLTKLRQLYTDSAGL  203

Query  574  TGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            +GP P  LS+LKNL++L AS NNFTG +P+F+G
Sbjct  204  SGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIG  236


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 71/150 (47%), Gaps = 25/150 (17%)
 Frame = +1

Query  289  GEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSI  468
            G++P+EL  L ++  L      L+G  P  + +L  +K L    NN TG IP  IG+LS 
Sbjct  181  GQLPEELGNLTKLRQLYTDSAGLSGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIGSLSN  240

Query  469  LITLSFATNNMNGPLPPELGN------------------------LTTLEEMYIDSNRLT  576
            L  L+F  N+  GP+P  L N                        LT+L+ + + + +++
Sbjct  241  LEDLAFQGNSFEGPIPASLSNLTKLTTLRIGDIVNGSSSLAFISSLTSLDTLVLRNCKIS  300

Query  577  GPIPE-ELSKLKNLRVLWASSNNFTGKLPE  663
            G +   + SK  NL  L  S NN +G +P+
Sbjct  301  GDLGAVDFSKFANLTFLDLSFNNISGNVPK  330



>ref|XP_006303851.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella]
 gb|EOA36749.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella]
Length=989

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 124/198 (63%), Gaps = 11/198 (6%)
 Frame = +1

Query  109  AINKIIDHWNLRS--KVNLSSFEPCDKNASWAPL-----EANPRIACDCS---GTFCHIN  258
            A+N I   W +R+  + N+S  E C   A    +       NP I CDC+    T C I 
Sbjct  2    ALNSIFAAWRIRAPREWNISG-ELCSGAAIDDSVLDNNPAYNPLIKCDCTFENSTICRIT  60

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGP  438
             +K+Y  ++VG IP+EL+ LK + +LNL QNVL GS+PP IG LT+M+W++FG N L+GP
Sbjct  61   NIKVYAKEVVGTIPEELWTLKYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFGINALSGP  120

Query  439  IPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLR  618
            +P EIG L+ L  LS ++NN +G +P E+GN   L+++YIDS+ L+G IP   + L +L 
Sbjct  121  VPKEIGLLTDLRLLSISSNNFSGSIPDEIGNCAKLQQIYIDSSGLSGRIPLSFANLVDLE  180

Query  619  VLWASSNNFTGKLPEFLG  672
              W +    TG++P+F+G
Sbjct  181  QAWLADLEVTGQIPDFIG  198


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 96/197 (49%), Gaps = 10/197 (5%)
 Frame = +1

Query  94   PNEVVAINKI----IDHWNLRSKVNLSSFEPCDKNASW-APLEANPRIACDCSGTFCHIN  258
            P+E+    K+    ID   L  ++ LS     D   +W A LE   +I  D  G +  + 
Sbjct  146  PDEIGNCAKLQQIYIDSSGLSGRIPLSFANLVDLEQAWLADLEVTGQIP-DFIGKWTKLT  204

Query  259  RLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPE-IGQLTKMKWLSFGTNNLTG  435
             L+I G  + G IP     L  + +L L  ++ NGS   E I  +  +  L    +NLTG
Sbjct  205  TLRILGTGLSGPIPSSFSNLTSLTELRLG-DISNGSSSLEFIKDMKSLSILVLRNSNLTG  263

Query  436  PIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNL  615
             IP +IG  S L  +  + N ++GP+P  L NL+ L  +++ +N   G +P +  K ++L
Sbjct  264  TIPSKIGEYSSLQQVDLSFNKLHGPIPAPLFNLSRLTHLFLGNNTFNGSLPTQ--KTQSL  321

Query  616  RVLWASSNNFTGKLPEF  666
              +  S N+ +G LP +
Sbjct  322  SYIDVSYNDLSGSLPSW  338



>ref|XP_011022401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Populus euphratica]
Length=970

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 119/196 (61%), Gaps = 7/196 (4%)
 Frame = +1

Query  103  VVAINKIIDHWNLRSKV--NLSSFEPCDKNA----SWAPLEANPRIACDCSGTFCHINRL  264
            V A+N + + W+ ++    NLS  EPC  +A     +   + NP I C+C+ T CHI +L
Sbjct  91   VSALNSLFEQWDTQAVGLWNLSG-EPCSGSAIEQTDFEDPDNNPAIKCECTQTTCHITQL  149

Query  265  KIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIP  444
            ++Y L+  G IP+ L   K +  L + QN  +G +P  IG L+ +K LS   N  +G IP
Sbjct  150  RVYALNKRGVIPEVLTAFKYLTFLKIDQNYFSGPLPAFIGNLSALKGLSIAHNAFSGTIP  209

Query  445  PEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVL  624
             E+GNL  L  LSF  NN +G LPPELGNL  LEE+Y +S  L G IP   + L+ LRVL
Sbjct  210  KELGNLKELTLLSFGVNNFSGTLPPELGNLVNLEELYTNSCGLGGEIPSTFANLQRLRVL  269

Query  625  WASSNNFTGKLPEFLG  672
            WAS ++FTG +P+F+G
Sbjct  270  WASDDSFTGNIPDFIG  285



>ref|XP_002270976.3| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Vitis vinifera]
Length=1016

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 128/219 (58%), Gaps = 10/219 (5%)
 Frame = +1

Query  43   FVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSKV--NLSSFEPCDKNA----SWAPL  204
            F+  L     AQ+   DP+EV A+N +   WN++S    N+S  EPC  +A     +   
Sbjct  23   FMSLLFQKSTAQNAALDPSEVEALNSLFKQWNMQSTTFWNMSG-EPCSGSAINEIQFYDE  81

Query  205  EANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPP  375
                 I C+C+    T CHI  LK+  L+  GEIP+EL  L  +M L L +N   G +P 
Sbjct  82   VNKQAIMCNCTYNDNTTCHITHLKVLSLNKTGEIPEELTTLTYLMVLRLDKNYFTGPLPS  141

Query  376  EIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMY  555
             I  L++M++LS G N L+G IP E+GNL  LI LS  +NN +G LPPELGNL  LE +Y
Sbjct  142  FIANLSQMQYLSLGHNGLSGSIPKELGNLKDLIMLSIGSNNFSGFLPPELGNLPKLELIY  201

Query  556  IDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            IDS+ ++G IP   + L+ +R  +AS    TGK+P+F+G
Sbjct  202  IDSSGVSGEIPSTFANLQRVRDFFASDTPITGKIPDFIG  240


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 68/151 (45%), Gaps = 24/151 (16%)
 Frame = +1

Query  283  IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNL  462
            + GEIP     L+ + D   +   + G +P  IG  TK++ L F  N+L GPIP     L
Sbjct  207  VSGEIPSTFANLQRVRDFFASDTPITGKIPDFIGNWTKLQNLRFQGNSLEGPIPSTFSKL  266

Query  463  SILITLSFATNN------------------------MNGPLPPELGNLTTLEEMYIDSNR  570
            + L++L  +  +                        ++G +P  +G   +LE + +  N 
Sbjct  267  TSLVSLRISDLSNVSSSLDFIREMKNLTDLVLRNALISGSIPSSIGEYPSLERLDLSFNN  326

Query  571  LTGPIPEELSKLKNLRVLWASSNNFTGKLPE  663
            LTG IP  L  + NL  L+  +N  +G LP+
Sbjct  327  LTGQIPSPLFNMTNLTSLFLGNNRLSGTLPD  357


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 8/139 (6%)
 Frame = +1

Query  241  TFCHINRLKIYGLDIVGEIPKELFVLKEM---MDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            TF  +  L    +  +  +   L  ++EM    DL L   +++GS+P  IG+   ++ L 
Sbjct  262  TFSKLTSLVSLRISDLSNVSSSLDFIREMKNLTDLVLRNALISGSIPSSIGEYPSLERLD  321

Query  412  FGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPE  591
               NNLTG IP  + N++ L +L    N ++G LP +      L+ + +  N ++G  P 
Sbjct  322  LSFNNLTGQIPSPLFNMTNLTSLFLGNNRLSGTLPDQKSE--KLQIIDLTYNEISGSFPS  379

Query  592  ELSKLKNLRVLWASSNNFT  648
             +     L ++   +NNFT
Sbjct  380  WIKSGLQLNLV---ANNFT  395



>ref|XP_010045978.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1297

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 134/215 (62%), Gaps = 10/215 (5%)
 Frame = +1

Query  55   LLNTVIAQSNITDPNEVVAINKIIDHWNLRSKVNL--SSFEPCDKNA----SWAPLEANP  216
             L+  +AQ+  TDP EV A+N++  HWNL + +N    S EPC   A    S       P
Sbjct  284  FLDMAMAQAT-TDPLEVKALNRVFQHWNLAAPLNEWNISGEPCSGVALSATSIDEAGYKP  342

Query  217  RIACDC---SGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQ  387
             I C+C   + + CHI +L+IY L+IVG IP+EL+ L  +  LNL  N+L GS+P  IG 
Sbjct  343  YIRCNCFYDNDSTCHITQLRIYSLNIVGSIPEELWSLSYLTSLNLGLNLLTGSIPGGIGN  402

Query  388  LTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSN  567
            L +M++LS   N  +G +P EIGNL  L+ +SFA NN +G LP  LGNL+ L+++Y  S+
Sbjct  403  LNRMQYLSLNANAFSGELPNEIGNLHELLAVSFAENNFSGSLPLSLGNLSKLQQLYFSSS  462

Query  568  RLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             ++G IP   + L +L +LWAS NN TG +P+F+G
Sbjct  463  GISGAIPSSFADLTDLNILWASDNNLTGSIPDFIG  497


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (46%), Gaps = 2/144 (1%)
 Frame = +1

Query  229  DCSGTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWL  408
            D  G +  +  L++ G    G IP     L  + +L ++      S    +  +  +  L
Sbjct  494  DFIGNWLKLTVLRLQGNSFAGPIPSTFSKLTSLKELRVSDISSGISTLEFLADMRNLTTL  553

Query  409  SFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIP  588
                NN+ G IPP + N   L  L  + NN+NG +P     L +L  +++ SN+L+G +P
Sbjct  554  VLRNNNIHGTIPPYVSNNKKLEHLDLSFNNLNGSIPDSTFTLDSLSYLFLGSNKLSGALP  613

Query  589  EELSKLKNLRVLWASSNNFTGKLP  660
             +  K  +L  +  S NN +G  P
Sbjct  614  SK--KGTSLVYIDLSYNNLSGNFP  635



>ref|XP_011022400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Populus euphratica]
Length=1088

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 119/196 (61%), Gaps = 7/196 (4%)
 Frame = +1

Query  103  VVAINKIIDHWNLRSKV--NLSSFEPCDKNA----SWAPLEANPRIACDCSGTFCHINRL  264
            V A+N + + W+ ++    NLS  EPC  +A     +   + NP I C+C+ T CHI +L
Sbjct  91   VSALNSLFEQWDTQAVGLWNLSG-EPCSGSAIEQTDFEDPDNNPAIKCECTQTTCHITQL  149

Query  265  KIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIP  444
            ++Y L+  G IP+ L   K +  L + QN  +G +P  IG L+ +K LS   N  +G IP
Sbjct  150  RVYALNKRGVIPEVLTAFKYLTFLKIDQNYFSGPLPAFIGNLSALKGLSIAHNAFSGTIP  209

Query  445  PEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVL  624
             E+GNL  L  LSF  NN +G LPPELGNL  LEE+Y +S  L G IP   + L+ LRVL
Sbjct  210  KELGNLKELTLLSFGVNNFSGTLPPELGNLVNLEELYTNSCGLGGEIPSTFANLQRLRVL  269

Query  625  WASSNNFTGKLPEFLG  672
            WAS ++FTG +P+F+G
Sbjct  270  WASDDSFTGNIPDFIG  285


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 5/132 (4%)
 Frame = +1

Query  253  INRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFGTNNLT  432
            ++ L+I  L  V      +  LK + DLNL   ++NGS+P +IG+L  +  L    NNLT
Sbjct  314  LDSLRISDLSNVSSTLNFIKNLKNLTDLNLRNALINGSIPSDIGELQTLNRLDLSFNNLT  373

Query  433  GPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTLEEMYIDSNRLTGPIPEELSKLKN  612
            G +P  +  +S L  L    N+++G LP +  +  TL+ + +  N L+G  P  ++    
Sbjct  374  GQVPSALFRMSSLEYLFLGNNSLSGTLPEQKSD--TLQTIDLSYNYLSGTFPSWVASNVQ  431

Query  613  LRVLWASSNNFT  648
            L ++   +NNFT
Sbjct  432  LNLV---ANNFT  440


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 72/171 (42%), Gaps = 29/171 (17%)
 Frame = +1

Query  241  TFCHINRLKI-YGLD--IVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLS  411
            TF ++ RL++ +  D    G IP  +     +  L    N   G +P     LT +  L 
Sbjct  259  TFANLQRLRVLWASDDSFTGNIPDFIGNWTGLTSLRFQGNSFEGPIPLSFSNLTSLDSLR  318

Query  412  FGT--------------NNLT----------GPIPPEIGNLSILITLSFATNNMNGPLPP  519
                              NLT          G IP +IG L  L  L  + NN+ G +P 
Sbjct  319  ISDLSNVSSTLNFIKNLKNLTDLNLRNALINGSIPSDIGELQTLNRLDLSFNNLTGQVPS  378

Query  520  ELGNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
             L  +++LE +++ +N L+G +PE+  K   L+ +  S N  +G  P ++ 
Sbjct  379  ALFRMSSLEYLFLGNNSLSGTLPEQ--KSDTLQTIDLSYNYLSGTFPSWVA  427



>ref|XP_010098477.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB75137.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=932

 Score =   159 bits (403),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 136/223 (61%), Gaps = 13/223 (6%)
 Frame = +1

Query  34   FSFFVLGLLNTVIAQSNITDPNEVVAINKIIDHWNLRSK--VNLSSFEPCDKNASWAPLE  207
            FS F++      IAQ+  TDP+EV A+N I   WN+++    N+S  EPC  +A    ++
Sbjct  25   FSIFLVFSPQKCIAQNATTDPSEVRALNTIFRKWNVQANPMWNISG-EPCTGSAVNNTID  83

Query  208  A-----NPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNG  363
                  NP I C+C+    + CHI  L++  LD  GEIP+E+  LK +  ++L  N   G
Sbjct  84   VEQKDNNPSIKCNCTYDNNSTCHITHLRVQSLDAHGEIPEEITSLKYLTKIDL--NYFTG  141

Query  364  SVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPELGNLTTL  543
            ++P  IG L+ ++ LS   N+  G IP EIGNL  LI ++  +NN +G LPPELGNL  L
Sbjct  142  TLPAFIGNLSALQILSVSHNDFYGTIPKEIGNLKNLIMIALGSNNFSGTLPPELGNLPNL  201

Query  544  EEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            E +YIDS  L+G IP   + L+++RVL+ + + F+GK+P+F+G
Sbjct  202  ELIYIDSCGLSGEIPPTFANLRSMRVLYTTDSPFSGKIPDFIG  244



>ref|XP_002969397.1| hypothetical protein SELMODRAFT_170829 [Selaginella moellendorffii]
 gb|EFJ29485.1| hypothetical protein SELMODRAFT_170829 [Selaginella moellendorffii]
Length=334

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 124/229 (54%), Gaps = 11/229 (5%)
 Frame = +1

Query  16   VMGILGFSFFVLGLLNTVIAQ-SNITDPNEVVAINKIIDHWNLRSKVNLSSFEPCDKNAS  192
             M I    F  + L   V AQ +N+TDP EV A+  +     L    + S  +PC   A 
Sbjct  4    AMLIAATGFCSIFLFRCVTAQQTNVTDPREVSALRALGTSIGLSPPWDFS-VDPCSGAAG  62

Query  193  WA------PLEANPRIACDCS---GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLA  345
            W              I CDCS      CH+ R+ I  +++ G+IP E+     M DLN  
Sbjct  63   WGEDTGTNQFRRRSAIQCDCSIGSDGVCHVTRIAIVSMNVRGQIPPEIGNFPYMNDLNFQ  122

Query  346  QNVLNGSVPPEIGQLTKMKWLSFGTNNLTGPIPPEIGNLSILITLSFATNNMNGPLPPEL  525
             N++ G +P EIG L+ M+ L+  +N L+GPIP  +GNL+ L+TLS A NN +G LP E+
Sbjct  123  ANLITGVIPDEIGLLSNMEHLTVASNRLSGPIPGTMGNLTRLLTLSLAVNNFSGTLPQEI  182

Query  526  GNLTTLEEMYIDSNRLTGPIPEELSKLKNLRVLWASSNNFTGKLPEFLG  672
            GNL++L E+Y+DS  L G +P  L  L+ L+ L    NNF G +P+FL 
Sbjct  183  GNLSSLTELYLDSTGLGGELPPALRNLRRLQTLNIFDNNFNGSIPDFLA  231


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 67/152 (44%), Gaps = 23/152 (15%)
 Frame = +1

Query  238  GTFCHINRLKIYGLDIVGEIPKELFVLKEMMDLNLAQNVLNGSVPPEIGQLTKMKWLSFG  417
            G    +  L +    + GE+P  L  L+ +  LN+  N  NGS+P  +  ++ ++ L+  
Sbjct  183  GNLSSLTELYLDSTGLGGELPPALRNLRRLQTLNIFDNNFNGSIPDFLANMSSLQVLAMY  242

Query  418  TNNLTGPIPPEIGNLSILITLSFATNNMNGPLPP-----------------------ELG  528
             N  TGP+P  + NL+ L  L     +  G +PP                       +LG
Sbjct  243  GNKFTGPLPASLANLTNLRELELGEVSAGGSIPPSYNRLTSLTKLSLRNCQLSGFIPDLG  302

Query  529  NLTTLEEMYIDSNRLTGPIPEELSKLKNLRVL  624
            NLT L  + +  N L+G IP  L+ + +L  L
Sbjct  303  NLTQLTHLDLSFNNLSGTIPAYLASIDSLSRL  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600