BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021N21

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    136   2e-47   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    134   9e-47   Nicotiana sylvestris
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               133   2e-46   
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    128   9e-45   Solanum tuberosum [potatoes]
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    124   1e-43   Solanum lycopersicum
ref|XP_003593130.1|  Histidine decarboxylase                            124   1e-43   
gb|ACJ85197.1|  unknown                                                 123   2e-43   Medicago truncatula
ref|XP_003593129.1|  Histidine decarboxylase                            123   2e-43   Medicago truncatula
ref|XP_010108654.1|  Histidine decarboxylase                            121   7e-43   Morus notabilis
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    120   2e-42   Cucumis sativus [cucumbers]
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    120   2e-42   
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    119   2e-42   Fragaria vesca subsp. vesca
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      119   4e-42   Cucumis melo [Oriental melon]
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      119   5e-42   
ref|XP_002306690.1|  serine decarboxylase family protein                119   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               118   2e-41   Populus euphratica
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 116   3e-41   Malus domestica [apple tree]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               119   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               116   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               116   3e-41   
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               120   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    119   4e-41   Brassica rapa
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               115   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 115   7e-41   Glycine max [soybeans]
emb|CDX80723.1|  BnaC08g05570D                                          118   8e-41   
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               118   1e-40   Camelina sativa [gold-of-pleasure]
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         115   1e-40   Jatropha curcas
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            114   1e-40   Malus domestica [apple tree]
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               114   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002893962.1|  EMB1075                                            117   2e-40   
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             114   2e-40   Prunus persica
gb|KHG24953.1|  Histidine decarboxylase                                 114   2e-40   Gossypium arboreum [tree cotton]
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             117   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            114   2e-40   Prunus mume [ume]
ref|XP_002302186.1|  serine decarboxylase family protein                115   2e-40   Populus trichocarpa [western balsam poplar]
emb|CDY30753.1|  BnaC05g51500D                                          116   3e-40   Brassica napus [oilseed rape]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    113   3e-40   Cicer arietinum [garbanzo]
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               114   4e-40   Populus euphratica
gb|KHN26720.1|  Histidine decarboxylase                                 113   4e-40   Glycine soja [wild soybean]
ref|XP_002533017.1|  group II plp decarboxylase, putative               113   4e-40   Ricinus communis
ref|NP_001241244.1|  uncharacterized protein LOC100795577               112   5e-40   Glycine max [soybeans]
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    115   8e-40   Tarenaya hassleriana [spider flower]
emb|CDY59264.1|  BnaC09g51700D                                          115   9e-40   Brassica napus [oilseed rape]
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    112   1e-39   Theobroma cacao [chocolate]
dbj|BAA78331.1|  serine decarboxylase                                   115   1e-39   Brassica napus [oilseed rape]
gb|KJB16470.1|  hypothetical protein B456_002G231300                    111   1e-39   Gossypium raimondii
gb|KJB16469.1|  hypothetical protein B456_002G231300                    111   1e-39   Gossypium raimondii
gb|KJB16468.1|  hypothetical protein B456_002G231300                    111   1e-39   Gossypium raimondii
emb|CDY41717.1|  BnaA09g15450D                                          114   1e-39   Brassica napus [oilseed rape]
ref|NP_175036.1|  serine decarboxylase 1                                114   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             113   1e-39   Phaseolus vulgaris [French bean]
dbj|BAE07183.1|  putative serine decarboxylase                          111   2e-39   Beta vulgaris [beet]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    111   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    114   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             113   3e-39   Phaseolus vulgaris [French bean]
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               112   4e-39   Arabis alpina [alpine rockcress]
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               112   4e-39   Brassica rapa
emb|CDY48944.1|  BnaA08g04700D                                          112   4e-39   Brassica napus [oilseed rape]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               109   5e-39   Nelumbo nucifera [Indian lotus]
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                109   6e-39   Erythranthe guttata [common monkey flower]
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          106   4e-38   Amborella trichopoda
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     105   5e-38   Eucalyptus grandis [rose gum]
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               105   6e-38   
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               113   1e-37   Brassica rapa
gb|EPS66281.1|  serine decarboxylase                                    108   2e-37   Genlisea aurea
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    102   3e-37   Vitis vinifera
gb|KHN39188.1|  Histidine decarboxylase                                 108   3e-37   Glycine soja [wild soybean]
emb|CBI18554.3|  unnamed protein product                                102   3e-37   Vitis vinifera
emb|CAN70523.1|  hypothetical protein VITISV_034634                     102   3e-37   Vitis vinifera
ref|NP_001242861.1|  uncharacterized protein LOC100792053               106   1e-36   
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    105   1e-36   
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    105   1e-36   Glycine max [soybeans]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             100   1e-36   Phaseolus vulgaris [French bean]
gb|KHG04394.1|  Histidine decarboxylase                                 100   1e-36   Gossypium arboreum [tree cotton]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  101   2e-36   Elaeis guineensis
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             104   2e-36   
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             100   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB59411.1|  hypothetical protein B456_009G253400                    100   2e-36   Gossypium raimondii
gb|KJB59410.1|  hypothetical protein B456_009G253400                    100   2e-36   Gossypium raimondii
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             101   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                99.4    3e-36   Phoenix dactylifera
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg           99.4    4e-36   
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    103   6e-36   Glycine max [soybeans]
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                 99.0    6e-36   Citrus sinensis [apfelsine]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg           99.0    6e-36   Citrus clementina [clementine]
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...  99.0    6e-36   Citrus sinensis [apfelsine]
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502           97.8    8e-36   
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539           97.4    1e-35   
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                95.5    8e-35   Brachypodium distachyon [annual false brome]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like          95.1    9e-35   
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like           95.5    1e-34   
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like          94.7    1e-34   Zea mays [maize]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like          94.7    2e-34   Setaria italica
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like          94.7    2e-34   Prunus mume [ume]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg           94.7    2e-34   Prunus persica
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                92.4    5e-34   Brachypodium distachyon [annual false brome]
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140        90.5    2e-33   Sorghum bicolor [broomcorn]
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like          90.5    4e-33   
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1          89.4    7e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like           88.6    1e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY86197.1|  hypothetical protein OsI_07573                        88.6    2e-32   Oryza sativa Indica Group [Indian rice]
gb|KEH26770.1|  histidine decarboxylase-like protein                    121   3e-31   Medicago truncatula
ref|XP_003619923.1|  L-tyrosine decarboxylase                           127   5e-31   
gb|KJB59412.1|  hypothetical protein B456_009G253400                  92.4    8e-30   Gossypium raimondii
ref|XP_001761266.1|  predicted protein                                80.1    7e-29   
ref|XP_001754291.1|  predicted protein                                80.1    3e-25   
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like             69.7    2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like             67.0    2e-22   
emb|CDP11372.1|  unnamed protein product                              79.3    3e-21   Coffea canephora [robusta coffee]
gb|EMS65243.1|  Histidine decarboxylase                               78.2    5e-20   Triticum urartu
gb|AFW71721.1|  hypothetical protein ZEAMMB73_965103                  90.5    3e-19   
gb|AFW62561.1|  hypothetical protein ZEAMMB73_005785                  89.7    6e-19   
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like           70.1    9e-16   Brachypodium distachyon [annual false brome]
ref|XP_006851377.1|  hypothetical protein AMTR_s00040p00010950        77.8    6e-15   
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                  79.0    1e-13   
ref|XP_001689659.1|  serine decarboxylase                             67.8    1e-13   Chlamydomonas reinhardtii
ref|XP_011401256.1|  Histidine decarboxylase                          70.5    4e-13   Auxenochlorella protothecoides
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840        57.8    7e-13   Sorghum bicolor [broomcorn]
ref|XP_002454879.1|  hypothetical protein SORBIDRAFT_03g000687        57.0    1e-12   
gb|KIZ00141.1|  histidine decarboxylase                               67.0    2e-12   Monoraphidium neglectum
gb|EMT14427.1|  Histidine decarboxylase                               68.9    2e-12   
gb|KDD76585.1|  hypothetical protein H632_c172p0                      70.9    3e-12   Helicosporidium sp. ATCC 50920
ref|XP_002444261.1|  hypothetical protein SORBIDRAFT_07g019126        57.0    5e-12   
gb|EMT14426.1|  hypothetical protein F775_23387                       66.2    5e-12   
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like          58.9    5e-12   Oryza brachyantha
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969            68.9    6e-12   Chlorella variabilis
gb|AGT16577.1|  histidine decarboxylase-like protein                  56.6    7e-12   Saccharum hybrid cultivar R570
ref|XP_002953989.1|  serine decarboxylase                             68.2    9e-12   Volvox carteri f. nagariensis
gb|ABA93664.1|  retrotransposon protein, putative, unclassified       60.8    9e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49846.1|  Histidine decarboxylase                               68.9    2e-10   Triticum urartu
gb|EAY77466.1|  hypothetical protein OsI_32510                        50.8    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like          51.2    2e-10   Oryza brachyantha
gb|EAZ18332.1|  hypothetical protein OsJ_33863                        60.8    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14424.1|  Histidine decarboxylase                               68.2    5e-10   
ref|XP_005646136.1|  serine decarboxylase                             67.4    7e-10   Coccomyxa subellipsoidea C-169
ref|XP_006826559.1|  hypothetical protein AMTR_s04872p00009330        63.2    7e-10   
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2          48.5    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002178784.1|  predicted protein                                63.9    1e-08   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002679079.1|  predicted protein                                54.7    9e-08   Naegleria gruberi strain NEG-M
ref|XP_004364837.2|  serine decarboxylase                             47.4    6e-07   Capsaspora owczarzaki ATCC 30864
gb|KJE90702.1|  serine decarboxylase                                  47.4    6e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_006591667.1|  PREDICTED: histidine decarboxylase-like          55.1    5e-06   Glycine max [soybeans]
gb|KHN16991.1|  Histidine decarboxylase                               47.8    8e-06   Glycine soja [wild soybean]
ref|XP_003592126.1|  Histidine decarboxylase                          49.7    1e-05   
ref|XP_002292250.1|  histidine decarboxylase                          54.7    1e-05   Thalassiosira pseudonana CCMP1335
gb|KEH43660.1|  serine decarboxylase                                  42.4    2e-05   Medicago truncatula
gb|EJK75470.1|  hypothetical protein THAOC_02802                      53.9    3e-05   Thalassiosira oceanica
ref|XP_003592132.1|  FAR1-related protein                             42.0    3e-05   
ref|NP_001176002.1|  Os10g0105700                                     41.6    4e-05   
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like          42.0    7e-05   Glycine max [soybeans]
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...  39.3    9e-05   
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like          39.3    1e-04   Nicotiana tomentosiformis
ref|XP_001757041.1|  predicted protein                                52.4    1e-04   
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like          38.1    1e-04   Solanum tuberosum [potatoes]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...  44.7    1e-04   Sesamum indicum [beniseed]
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3          52.0    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...  44.7    1e-04   Sesamum indicum [beniseed]
gb|EEC76705.1|  hypothetical protein OsI_14710                        52.0    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like          37.4    1e-04   Nicotiana sylvestris
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like          47.4    2e-04   
ref|WP_041764715.1|  hypothetical protein                             51.2    2e-04   
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like             45.4    2e-04   
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like          37.7    3e-04   Nicotiana sylvestris
gb|AHG12639.1|  histidine decarboxylase                               37.7    3e-04   Nicotiana tabacum [American tobacco]
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...  38.1    3e-04   Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...  38.1    3e-04   
gb|AFY36874.1|  Histidine decarboxylase                               50.8    4e-04   Leptolyngbya sp. PCC 7376



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   136 bits (343),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+ AD R + T  V EPVPP V+SD +D   A N G+   REIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSRLDLTT-VAEPVPPVVKSDDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYP
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYP  110


 Score = 79.7 bits (195),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   134 bits (338),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+ AD +F+ TA V EPVP  V+S+ +D   A N G+   REIVLGRN+HTTCL VTEPD
Sbjct  19   EVAADSQFDLTA-VAEPVPAVVKSEDVDG--AVNDGEEQKREIVLGRNIHTTCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD+ESTGDKEAYMASVLARYRKTL +RTKYHLGYP
Sbjct  76   ADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYP  110


 Score = 79.7 bits (195),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   133 bits (335),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 8/88 (9%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+P A+VTEPVPP   S+  D+           REIVLG+NVHTTCLEVTEPDAD+ESTG
Sbjct  35   FDPMAVVTEPVPPVADSNGHDAEKG--------REIVLGKNVHTTCLEVTEPDADDESTG  86

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  87   DKEAYMASVLARYRKTLVERTKYHLGYP  114


 Score = 79.3 bits (194),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  116  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  153



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   128 bits (322),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +2

Query  248  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADN  427
            AD RF+PTA+V E VP  V+S+ +D+     GG+   REIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSEGVDAA-VNGGGEEQEREIVLGRNIHTSSFSVTEPDADD  79

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +STGDKEAYMASVLARYRKTL +RTKYHLGYP
Sbjct  80   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYP  111


 Score = 79.3 bits (194),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  113  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  150



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   124 bits (312),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +2

Query  248  ADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADN  427
            AD RF+PTA+V E VP  V+S+         GG+   REIVLGRN+HT+   VTEPDAD+
Sbjct  21   ADVRFDPTAVVPELVPAVVKSEV--DAAVNGGGQEQKREIVLGRNIHTSSFSVTEPDADD  78

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +STGDKEAYMASVLARYRKTL +RTKYHLGYP
Sbjct  79   DSTGDKEAYMASVLARYRKTLTDRTKYHLGYP  110


 Score = 79.3 bits (194),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>ref|XP_003593130.1| Histidine decarboxylase [Medicago truncatula]
Length=311

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 3/90 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            F+ +AI+ +PVPP V +D       A  NGGK + REIVLGRN+HTTCLEVTEP+AD+E 
Sbjct  25   FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTEPEADDEI  83

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGD++A+MASVLARYRK+L ERTKYHLGYP
Sbjct  84   TGDRDAHMASVLARYRKSLTERTKYHLGYP  113


 Score = 79.7 bits (195),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  115  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  152



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 3/90 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            F+ +AI+ +PVPP V +D       A  NGGK + REIVLGRN+HTTCLEVTEP+AD+E 
Sbjct  25   FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTEPEADDEI  83

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGD++A+MASVLARYRK+L ERTKYHLGYP
Sbjct  84   TGDRDAHMASVLARYRKSLTERTKYHLGYP  113


 Score = 79.7 bits (195),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  115  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  152



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 3/90 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAA--NGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            F+ +AI+ +PVPP V +D       A  NGGK + REIVLGRN+HTTCLEVTEP+AD+E 
Sbjct  25   FDVSAIIKDPVPPVVAADNGIGKEEAKINGGK-EKREIVLGRNIHTTCLEVTEPEADDEI  83

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGD++A+MASVLARYRK+L ERTKYHLGYP
Sbjct  84   TGDRDAHMASVLARYRKSLTERTKYHLGYP  113


 Score = 79.7 bits (195),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  115  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  152



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   121 bits (304),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+     F+P A+V EP+PP V S+ +       G +   REIVLGRNVHTTCL VTEP+
Sbjct  25   EILLTEDFDPAAVVAEPLPPVVMSNGV-------GKEIKKREIVLGRNVHTTCLAVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            A++E TGDK+AYMASVLARYRKTL+ERTK+HLGYP
Sbjct  78   ANDELTGDKDAYMASVLARYRKTLMERTKHHLGYP  112


 Score = 79.7 bits (195),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   120 bits (300),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +   REIVLGRNVHTTCL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  74

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYP
Sbjct  75   DESTGDKEAYMASVLARYRKNLLERTKYHLGYP  107


 Score = 79.7 bits (195),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   120 bits (300),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +   REIVLGRNVHTTCL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTTCLSITEPDAN  79

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +ESTGDKEAYMASVLARYRK L+ERTKYHLGYP
Sbjct  80   DESTGDKEAYMASVLARYRKNLLERTKYHLGYP  112


 Score = 79.7 bits (195),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   119 bits (299),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 4/89 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
            F+PTA+V EP+PP V ++  L    A +  K   REIVLGRNVHTTCL VTEPDA++E T
Sbjct  18   FDPTAVVAEPLPPVVTTNGNLIGKVAEDPNK---REIVLGRNVHTTCLAVTEPDANDEFT  74

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            GDK+AYMASVLARYRKTL+ERTK+HLGYP
Sbjct  75   GDKDAYMASVLARYRKTLMERTKHHLGYP  103


 Score = 80.1 bits (196),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  105  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  142



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   119 bits (299),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +   REIVLGRNVHT+CL +TEPDA+
Sbjct  20   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  79

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYP
Sbjct  80   DESTGDKEAYMASVLARYRKSLLERTKYHLGYP  112


 Score = 79.0 bits (193),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   119 bits (299),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDK---LDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDAD  424
            G+F+   + ++P+PP   S+    L+     +  +   REIVLGRNVHT+CL +TEPDA+
Sbjct  15   GKFDTNLVFSDPLPPLAVSNNGLDLNGQQHVDSNQKGKREIVLGRNVHTSCLSITEPDAN  74

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +ESTGDKEAYMASVLARYRK+L+ERTKYHLGYP
Sbjct  75   DESTGDKEAYMASVLARYRKSLLERTKYHLGYP  107


 Score = 79.0 bits (193),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   119 bits (298),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 9/89 (10%)
 Frame = +2

Query  260  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ +A+V  EP+PP V         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIV--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            GDKEAYMASVLARYRK L+ERTKYHLGYP
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYP  100


 Score = 78.2 bits (191),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  102  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  139



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   118 bits (295),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 9/89 (10%)
 Frame = +2

Query  260  FNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ +A+V  EP+PP +         A NG K + REIVLG+NVHTTCLEVTEP+A++E T
Sbjct  20   FDISAVVQPEPLPPIL--------AAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFT  71

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            GDKEAYMASVLARYRK L+ERTKYHLGYP
Sbjct  72   GDKEAYMASVLARYRKNLMERTKYHLGYP  100


 Score = 78.2 bits (191),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  102  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  139



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   116 bits (291),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADXREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   +  +++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDRKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   119 bits (299),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 13/98 (13%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----------DKLDSPPAANGGKADXREIVLGRNVHTTCLEVT  409
            F+PTA+V EP+PP  ++          D        NGG+   +EIVLGRNVHT+CL VT
Sbjct  23   FDPTAVVVEPLPPLAETANGIGYSGEDDVFQVKEMLNGGE---KEIVLGRNVHTSCLAVT  79

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            EP+A++E TGDKEAYMASVLARYRKTLVERTK+HLGYP
Sbjct  80   EPEANDEFTGDKEAYMASVLARYRKTLVERTKHHLGYP  117


 Score = 76.3 bits (186),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  119  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  156



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   116 bits (291),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADXREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   +  +++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   116 bits (291),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQS-DKLD--SPPAANGGKADXREIVLGRNVHTTCLEVT  409
            E+ +D  F+PTA+V EP+PP V S D  D     A +   +  +++VLGRNVHTTCL VT
Sbjct  11   EMLSDD-FDPTAVVAEPLPPVVTSTDDCDLLGKLAEDHKGSREKQMVLGRNVHTTCLAVT  69

Query  410  EPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            EP+++++ TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  70   EPESNDDFTGDKEAYMASVLARYRKTLIERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   120 bits (300),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+P PV +++ ++    NG   D RE+VLGRN+HTT L VTEP+ +++ TG
Sbjct  24   FDPTAVVTEPLPSPVTTNE-ENLKKTNGVGGD-REMVLGRNIHTTSLAVTEPEVNDDFTG  81

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  82   DKEAYMASVLARYRKTLVERTKYHLGYP  109


 Score = 75.9 bits (185),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  111  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  148



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   119 bits (299),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 13/95 (14%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+ +D  F+PTA+VTEP+P PV           NGG    RE+VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGGGE--REMVLGRNVHTTSLAVTEPE  65

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  100


 Score = 76.3 bits (186),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  102  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  139



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   115 bits (289),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+VTEP+PP V S     L    A +      +++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVVTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TGDK+AYMASVLARYRKTLVERTK+HLGYP
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   115 bits (288),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      + REIVLGRNVHTTCLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPSAVVDNGILKEEAQINKGKEKREIVLGRNVHTTCLEVTEPEADDEITG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            D+EA+MASVLARY++ L ERTK+HLGYP
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYP  112


 Score = 79.0 bits (193),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   118 bits (296),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 11/103 (11%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADXREIVLGRNVHTT  394
            ++ +DG F+PTA+  EP+P PV        + + L      NGG    RE+VLGRNVHTT
Sbjct  18   DILSDG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVNGGGE--REMVLGRNVHTT  74

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  117


 Score = 75.9 bits (185),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  119  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  156



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   118 bits (295),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 4/91 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSP---PAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+VTEP+P PV ++  +        NG   D RE+VLGRN+HTT L VTEP+ +++
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGD-REMVLGRNIHTTSLAVTEPEVNDD  82

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  83   FTGDKEAYMASVLARYRKTLVERTKYHLGYP  113


 Score = 75.9 bits (185),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  115  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  152



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   115 bits (289),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 3/95 (3%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+ A+  F+  A++ EP+PP V +++  +       K + REIVLGRN+HT CLEVTEPD
Sbjct  20   EILAED-FDLRAVIKEPLPPVVTAEEEVAGEEET--KQNGREIVLGRNLHTECLEVTEPD  76

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            A++E TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  77   ANDEHTGDKEAYMASVLARYRKTLMERTKHHLGYP  111


 Score = 78.6 bits (192),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  113  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  150



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   114 bits (286),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+VTEP+PP + S     L    A +      +++VLGRNVHTTCL VTEP+ ++E
Sbjct  17   FDPTAVVTEPLPPVLTSTADCDLIGKLAEDHKGTREKQMVLGRNVHTTCLAVTEPEPNDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TGDK+AYMASVLARYRKTLVERTK+HLGYP
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   114 bits (286),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 16/95 (17%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKAD-------XREIVLGRNVHTTCLEVTEPD  418
            F+P A++++P+PP V           NGG  D        REIVLG+NVHT CL VTEPD
Sbjct  25   FDPIAMISDPLPPQV---------VENGGIVDDEAEDKQNREIVLGKNVHTMCLAVTEPD  75

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD+E TG++EAYMASVLARYR++L+ERTK+HLGYP
Sbjct  76   ADDEVTGEREAYMASVLARYRRSLIERTKHHLGYP  110


 Score = 79.0 bits (193),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   117 bits (294),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 10/88 (11%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+P         SP   NGG  + RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLP---------SPTELNGGGGE-REMVLGRNIHTTSLAVTEPEVNDEFTG  76

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTK+HLGYP
Sbjct  77   DKEAYMASVLARYRKTLVERTKFHLGYP  104


 Score = 75.9 bits (185),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  106  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  143



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   114 bits (284),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+V EP+P  V SD    L    A +   +  + +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKLAEDLKGSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TGDK+AYMASVLARYRKTLVERTK+HLGYP
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   114 bits (284),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTAI  EP+PP V  + +D P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAIEVEPLPPVVPENGVDKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGDKEA MA VLARYRK L+ERTKYHLGYP
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYP  106


 Score = 79.3 bits (194),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   117 bits (293),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 11/103 (11%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQ----SDKLDSPP----AANGGKADXREIVLGRNVHTT  394
            E+ +D  F+PTA+VTEP+PP +     +D  +  P      NGG    RE+VLGRNVHTT
Sbjct  18   EILSDD-FDPTAVVTEPLPPSLTNGTGADHGEENPRKTVVTNGGG--DREMVLGRNVHTT  74

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  75   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  117


 Score = 75.9 bits (185),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  119  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  156



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   114 bits (284),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD---KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            F+PTA+V EP+P  V SD    L    A +   +  + +VLGRNVHTTCL VTEP+A++E
Sbjct  17   FDPTAVVAEPLPTVVTSDVNCDLIGKFAEDLKSSLEKPMVLGRNVHTTCLAVTEPEANDE  76

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TGDK+AYMASVLARYRKTLVERTK+HLGYP
Sbjct  77   FTGDKDAYMASVLARYRKTLVERTKHHLGYP  107


 Score = 79.3 bits (194),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  109  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  146



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   115 bits (287),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            A NG K + REIVLGRNVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNGREIVLGRNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  512  LGYP  523
            LGYP
Sbjct  87   LGYP  90


 Score = 78.2 bits (191),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  92   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  129



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   116 bits (291),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 13/95 (14%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            E+ +D  F+PTA+VTEP+P PV           NGG    R +VLGRNVHTT L VTEP+
Sbjct  19   EILSDD-FDPTAVVTEPLPSPV----------TNGGGE--RVMVLGRNVHTTSLAVTEPE  65

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  66   SNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  100


 Score = 76.3 bits (186),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  102  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  139



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   113 bits (282),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+  AI+ +P+P  V  + +    A      + R+IVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDVAAIIKDPLPSLVAENGIVKEEAQINEGNEKRKIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            D+EA+MASVLARYR++L ERTKYHLGYP
Sbjct  85   DREAHMASVLARYRRSLTERTKYHLGYP  112


 Score = 79.7 bits (195),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   114 bits (284),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            A NG K + REIVLG+NVHTTCLEVTEP+A++ESTGDKEAYMASVLARYRK L+ERTK+H
Sbjct  27   AENGDKQNEREIVLGKNVHTTCLEVTEPEANDESTGDKEAYMASVLARYRKNLMERTKHH  86

Query  512  LGYP  523
            LGYP
Sbjct  87   LGYP  90


 Score = 78.2 bits (191),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  92   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  129



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   113 bits (282),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      + REIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  25   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            D+EA+MASVLARY++ L ERTK+HLGYP
Sbjct  85   DREAHMASVLARYKRALTERTKHHLGYP  112


 Score = 79.0 bits (193),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   113 bits (283),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 16/95 (17%)
 Frame = +2

Query  242  LFADGRFNPTAIVT-EPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            L  D   + TAIV  EP+P  V+++               REIVLG+NVHT+CLEVTEPD
Sbjct  19   LREDIDLDLTAIVAAEPLPEVVENE---------------REIVLGKNVHTSCLEVTEPD  63

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD+E TGDK+AYMASVLARYRKTL+ERTKYHLGYP
Sbjct  64   ADDELTGDKDAYMASVLARYRKTLIERTKYHLGYP  98


 Score = 78.6 bits (192),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  100  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  137



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   112 bits (281),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ TA++ +PVP  V  + +    A      + REIVLGRN+HT+CLEVTEP+AD+E TG
Sbjct  23   FDATAVIIDPVPLAVVDNGIVKEEAQIIKGKEKREIVLGRNIHTSCLEVTEPEADDEVTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            D+EA+MASVLARY++ L ERTK+HLGYP
Sbjct  83   DREAHMASVLARYKRALTERTKHHLGYP  110


 Score = 79.3 bits (194),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   115 bits (287),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 21/106 (20%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS-------DKLDSPPA-----------ANGGKADXREIVLGRNV  385
            F+PTA+V EP+PP  ++       ++ D  P             NGG+   +EIVLGRNV
Sbjct  24   FDPTAVVAEPLPPLAETVNGVGDFEEDDVCPVKEKVKNTTTTEMNGGE---KEIVLGRNV  80

Query  386  HTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            HTTCL VTEP+A+++ TGDKEAYMASVLARYRKTLVERTK+HLGYP
Sbjct  81   HTTCLAVTEPEANDDFTGDKEAYMASVLARYRKTLVERTKHHLGYP  126


 Score = 76.3 bits (186),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  128  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  165



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   115 bits (287),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F PTA++ EP+P P   + L      NG     RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPCP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYP  95


 Score = 76.3 bits (186),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  97   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  134



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   112 bits (281),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 70/102 (69%), Gaps = 22/102 (22%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGG--------------KADXREIVLGRNVHTTC  397
            F+PTA+V EP+PP V         AA+GG                  REIVLGRNVHT+C
Sbjct  25   FDPTAVVAEPLPPVVT--------AADGGPSESEEEEEGVGKPVKKSREIVLGRNVHTSC  76

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L VTEP+A++E TGDK+AYMA VLARYRKTL+ERTK+HLGYP
Sbjct  77   LAVTEPEANDEFTGDKDAYMAGVLARYRKTLMERTKHHLGYP  118


 Score = 78.2 bits (191),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDF+YG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  120  NLDFEYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  157



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   115 bits (287),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 10/103 (10%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADXREIVLGRNVHTT  394
            ++ ++G F+PTA+  EP+P PV        + D L        G  + RE+VLGRNVHTT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEDNLKKTKVVTNGGGE-REMVLGRNVHTT  75

Query  395  CLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  76   SLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  118


 Score = 75.9 bits (185),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  120  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  157



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   111 bits (277),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGDKEA MA VLARYRK L+ERTKYHLGYP
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYP  106


 Score = 79.3 bits (194),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   111 bits (277),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGDKEA MA VLARYRK L+ERTKYHLGYP
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYP  106


 Score = 79.3 bits (194),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   111 bits (277),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  254  GRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNES  433
            G F PTA+  EP+PP V  + ++ P   +      R IVLGRNVH+TCL +TEP+ ++E 
Sbjct  23   GNFEPTAMKVEPLPPVVPENGVEKPSEKS------RNIVLGRNVHSTCLTITEPEVNDEV  76

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            TGDKEA MA VLARYRK L+ERTKYHLGYP
Sbjct  77   TGDKEAQMAGVLARYRKNLMERTKYHLGYP  106


 Score = 79.3 bits (194),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   114 bits (286),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F PTA++ EP+P P   + L      NG     RE+VLGRNVHTT L VTEP++++E TG
Sbjct  12   FVPTAVINEPLPWP--EENLKKTKVING--RGEREMVLGRNVHTTSLAVTEPESNDEFTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  68   DKEAYMASVLARYRKTLVERTKYHLGYP  95


 Score = 75.9 bits (185),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  97   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  134



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   114 bits (285),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 4/88 (5%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+PTA+VTEP+PPPV     +   A  GG    RE+VLGRN+HTT L VTEP+ ++E TG
Sbjct  27   FDPTAVVTEPLPPPVT----NGIGADKGGGGGEREMVLGRNIHTTSLAVTEPEVNDEFTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            DKEAYMASVLARYRKTLVERTK HLGYP
Sbjct  83   DKEAYMASVLARYRKTLVERTKNHLGYP  110


 Score = 76.3 bits (186),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  112  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  149



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   113 bits (283),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            FN TA +T+ V  P+ +++ D      A NG +   R IVLGRN+HT CLEV+EPD D+E
Sbjct  65   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  124

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TG++EAYMASVLA+Y+K+L ERTKYHLGYP
Sbjct  125  VTGEREAYMASVLAKYKKSLTERTKYHLGYP  155


 Score = 76.6 bits (187),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  157  NLDFDYEALSQLQHFSINNLGDPFIESNYGVHSRQFEV  194



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   111 bits (278),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
             +PTA+V EP+PP    D ++         +   REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            GDKEAYMASVLARYR++L+ERTKYHLGYP
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYP  114


 Score = 78.6 bits (192),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  116  NLDFDYGALNQLQHFSINNLGDPFIESNYGVHSRQFEV  153



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   111 bits (278),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSD-KLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
             +PTA+V EP+PP    D ++         +   REIVLGRN+H++CL++TEP+ ++E T
Sbjct  26   LDPTAVVLEPLPPVANGDVEVGVMKKMKTTENGEREIVLGRNIHSSCLDITEPEDNDELT  85

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            GDKEAYMASVLARYR++L+ERTKYHLGYP
Sbjct  86   GDKEAYMASVLARYRQSLLERTKYHLGYP  114


 Score = 78.2 bits (191),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  116  NLDFDYGALNQLQHFSINNLGDPFIESNYGVHSRQFEV  153



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   114 bits (284),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 70/95 (74%), Gaps = 7/95 (7%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPP-------AANGGKADXREIVLGRNVHTTCLEVTEPD  418
            F+PTA+VTEP+P PV ++  +             GG    RE+VLGRN+HTT L VTEP+
Sbjct  24   FDPTAVVTEPLPSPVTTNGTEGEENLKKTNGVGGGGGGGDREMVLGRNIHTTSLAVTEPE  83

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             ++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  84   VNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  118


 Score = 75.9 bits (185),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  120  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  157



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   113 bits (282),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD---SPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNE  430
            FN TA +T+ V  P+ +++ D      A NG +   R IVLGRN+HT CLEV+EPD D+E
Sbjct  25   FNSTAFITDHVHVPLMAEEDDIAGKGEAQNGTENGERNIVLGRNIHTMCLEVSEPDIDDE  84

Query  431  STGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             TG++EAYMASVLA+Y+K+L ERTKYHLGYP
Sbjct  85   VTGEREAYMASVLAKYKKSLTERTKYHLGYP  115


 Score = 76.6 bits (187),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  117  NLDFDYEALSQLQHFSINNLGDPFIESNYGVHSRQFEV  154



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   112 bits (281),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 12/102 (12%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV-------QSDKLDSPPAANGGKADXREIVLGRNVHTTC  397
            E+  D  F+PTA+V EP+P P+       + +K+      NGG+   RE+VLGRNVHTT 
Sbjct  21   EILGDD-FDPTAVVAEPLPSPLTNGHVADEEEKV-KKTKVNGGE---REMVLGRNVHTTS  75

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L VTEP+ ++E TGDKEAYMASVLARYRKTLVERTK HLGYP
Sbjct  76   LAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYP  117


 Score = 75.9 bits (185),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  119  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  156



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   112 bits (281),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 12/104 (12%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADXREIVLGRNVHT  391
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG    RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  392  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  118


 Score = 75.9 bits (185),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  120  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  157



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   112 bits (281),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 75/104 (72%), Gaps = 12/104 (12%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPV---------QSDKLDSPPAANGGKADXREIVLGRNVHT  391
            ++ ++G F+PTA+  EP+P PV         + +   +    NGG    RE+VLGRNVHT
Sbjct  18   DILSEG-FDPTAVAPEPLPLPVTNGTGADQEEENLKKTKVVINGG--GEREMVLGRNVHT  74

Query  392  TCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            T L VTEP++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  75   TSLAVTEPESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  118


 Score = 75.9 bits (185),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  120  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  157



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   109 bits (272),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
             + T +++EP+ P   ++++ S           REIVLGRNVHT CL VTEPDAD+E TG
Sbjct  25   IDATTVISEPLSPV--NEEIVSDETKKSDVEQKREIVLGRNVHTMCLAVTEPDADDEVTG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++EAYMASVLARYRK+L+ERTK+HLGYP
Sbjct  83   EREAYMASVLARYRKSLIERTKHHLGYP  110


 Score = 79.3 bits (194),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   109 bits (273),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIVLG+NVHTTCLEVTEPDAD+ESTGDK+AYMASVLARYRKTL+ERT++HLGYP
Sbjct  60   REIVLGKNVHTTCLEVTEPDADDESTGDKDAYMASVLARYRKTLLERTQHHLGYP  114


 Score = 78.6 bits (192),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  116  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  153



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   106 bits (264),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 11/92 (12%)
 Frame = +2

Query  281  TEPVPPPVQSDKLDSP------PAANGGK-----ADXREIVLGRNVHTTCLEVTEPDADN  427
             EP+P  +   K+  P        A+ G+     +  REIVLGRNVHT+CLEVTEPDAD+
Sbjct  24   VEPLPEELNPKKIKVPLHLKNEDGADNGENSTLVSGKREIVLGRNVHTSCLEVTEPDADD  83

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            E TGD+EA MAS+LARYRK+L+ERT++HLGYP
Sbjct  84   EVTGDREACMASILARYRKSLIERTRHHLGYP  115


 Score = 79.3 bits (194),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  117  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  154



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   105 bits (262),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADN  427
            F+P A+  EP+P  V             AA  G    REIVLGRNVHTTCL + EPDA++
Sbjct  53   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  112

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            E TGDK+AYMA VLARYRKTLVERTK HLGYP
Sbjct  113  ELTGDKDAYMAGVLARYRKTLVERTKQHLGYP  144


 Score = 79.7 bits (195),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  146  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  183



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   105 bits (261),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 63/92 (68%), Gaps = 4/92 (4%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQS----DKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADN  427
            F+P A+  EP+P  V             AA  G    REIVLGRNVHTTCL + EPDA++
Sbjct  13   FDPAAVAPEPLPAAVAELNGNGVGGGKAAAAAGDGGKREIVLGRNVHTTCLAIEEPDAND  72

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            E TGDK+AYMA VLARYRKTLVERTK HLGYP
Sbjct  73   ELTGDKDAYMAGVLARYRKTLVERTKQHLGYP  104


 Score = 79.7 bits (195),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  106  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  143



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   113 bits (282),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 10/96 (10%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPV--------QSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEP  415
            F PTA+  EP+P PV        + + L      NG     RE+VLGRNVHTT L VTEP
Sbjct  12   FVPTAVFNEPLPWPVINGNKADHEGENLKKTKVMNG--RGEREMVLGRNVHTTSLAVTEP  69

Query  416  DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++++E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  70   ESNDEFTGDKEAYMASVLARYRKTLVERTKYHLGYP  105


 Score = 70.9 bits (172),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQ FSINNLGDP IESNYGVHSR FEV
Sbjct  107  NLDFDYGALGQLQQFSINNLGDPVIESNYGVHSRPFEV  144



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   108 bits (269),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  362  EIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            EIVLGRNVHT+CLEVTEPDAD+ESTGDKEAYMASVLARYRK+L+ERT++HLGYP
Sbjct  1    EIVLGRNVHTSCLEVTEPDADDESTGDKEAYMASVLARYRKSLIERTQHHLGYP  54


 Score = 74.7 bits (182),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQ FSINNLGDPFIESNYGVHSRQFEV
Sbjct  56   NLDFDYGALGQLQPFSINNLGDPFIESNYGVHSRQFEV  93



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   102 bits (255),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  57   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYP  109


 Score = 80.1 bits (196),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  111  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  148



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   108 bits (269),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            FN   I+ + V   +  + + +    NG +   R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FNSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++EAYMA VLA+Y+K+L ERT YHLGYP
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYP  112


 Score = 74.7 bits (182),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   102 bits (255),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  13   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYP  65


 Score = 80.1 bits (196),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  67   NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  104



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   102 bits (255),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  IVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            IVLGRNVHTTCL VTEPDA++E TGDKEAYMASVLARYRKTL+ERTK+HLGYP
Sbjct  48   IVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYP  100


 Score = 80.1 bits (196),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  102  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  139



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   106 bits (264),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +   R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++EAYMA VLA+Y+K+L ERT YHLGYP
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYP  112


 Score = 74.7 bits (182),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   105 bits (263),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +   R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  25   FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++EAYMA VLA+Y+K+L ERT YHLGYP
Sbjct  85   EREAYMAGVLAKYKKSLTERTNYHLGYP  112


 Score = 74.7 bits (182),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  114  NLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQFEV  151



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   105 bits (263),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+   I+ + V   +  + + +    NG +   R+IVLGRN+HTTCLEVTEPD D+E TG
Sbjct  8    FSSMTIMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTG  67

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            ++EAYMA VLA+Y+K+L ERT YHLGYP
Sbjct  68   EREAYMAGVLAKYKKSLTERTNYHLGYP  95


 Score = 74.7 bits (182),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  97   NLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQFEV  134



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   100 bits (250),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 65/88 (74%), Gaps = 2/88 (2%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F+ T++V +PVPP V  +  +        + + R IVLGRN+HT  LEVTEPDAD++ TG
Sbjct  25   FDATSLVMDPVPPAVVDNGNEEVQVYK--EKEKRLIVLGRNIHTMSLEVTEPDADDDITG  82

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            D+EA++ASVLARY++ L ERTK+HLGYP
Sbjct  83   DREAHIASVLARYKRALTERTKHHLGYP  110


 Score = 79.7 bits (195),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  149



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   100 bits (250),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 7/71 (10%)
 Frame = +2

Query  332  AANGGKA-------DXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG  A       + REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKESREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYP  523
            +ERTK+HLGYP
Sbjct  95   MERTKHHLGYP  105


 Score = 79.3 bits (194),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  107  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  144



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   101 bits (252),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +2

Query  281  TEPVPPPVQSDKLDSPP--AANG----GKADXREIVLGRNVHTTCLEVTEPDADNESTGD  442
             EP+P      ++  P   A NG    G    REIVLGRNVH  C  + EP+AD+E TG+
Sbjct  16   VEPLPEEFDPKEISGPADSAPNGILGSGDGKNREIVLGRNVHKMCFAINEPEADDEVTGE  75

Query  443  KEAYMASVLARYRKTLVERTKYHLGYP  523
            +EAYMASVLARYRK+LVERTK+HLGYP
Sbjct  76   REAYMASVLARYRKSLVERTKHHLGYP  102


 Score = 78.2 bits (191),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  104  NLDFDYGALNQLQHFSINNLGDPFIESNYGVHSRQFEV  141



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   104 bits (259),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 65/92 (71%), Gaps = 7/92 (8%)
 Frame = +2

Query  269  TAIVTEPVPPPV-----QSDKLDSP--PAANGGKADXREIVLGRNVHTTCLEVTEPDADN  427
            + ++ EP+P PV       + L  P      GG    RE+VLGRN+HTT L VTEP+ ++
Sbjct  79   STVIAEPLPSPVTNGTGDEENLKKPNGAGGRGGGGGDREMVLGRNIHTTSLAVTEPEVND  138

Query  428  ESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            E TGDKEAYMASVLARYRKTLVERTKYHLGYP
Sbjct  139  EFTGDKEAYMASVLARYRKTLVERTKYHLGYP  170


 Score = 75.5 bits (184),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSR FEV
Sbjct  172  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEV  209



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   100 bits (250),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 8/89 (9%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLD-SPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNEST  436
            F+ T IV EPVP       LD        G A  REIVLGRNVHT C  + EP+ D+E T
Sbjct  25   FDTTDIV-EPVPT------LDLEGVGGEEGSAKTREIVLGRNVHTMCFTIKEPEVDDEVT  77

Query  437  GDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G++EAYMASVLARYR++L+ERTK+HLGYP
Sbjct  78   GEREAYMASVLARYRRSLIERTKHHLGYP  106


 Score = 79.0 bits (193),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   100 bits (248),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 7/71 (10%)
 Frame = +2

Query  332  AANGGKA-------DXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG  A         REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYP  523
            +ERTK+HLGYP
Sbjct  95   MERTKHHLGYP  105


 Score = 79.7 bits (195),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  107  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  144



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   100 bits (248),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 7/71 (10%)
 Frame = +2

Query  332  AANGGKA-------DXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG  A         REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHLGYP  523
            +ERTK+HLGYP
Sbjct  95   MERTKHHLGYP  105


 Score = 79.7 bits (195),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  107  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  144



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   101 bits (252),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  FNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTG  439
            F  T I+    P  V++    S  A  G +   REIVLGRNVH   L VTEPD D E TG
Sbjct  25   FGGTVIIPNSFPTMVETRASISGEARRGEEKQRREIVLGRNVHKMSLPVTEPDVDEEMTG  84

Query  440  DKEAYMASVLARYRKTLVERTKYHLGYP  523
            +KEAYMAS+LA+YRK+LVERT++HLGYP
Sbjct  85   EKEAYMASILAKYRKSLVERTEHHLGYP  112


 Score = 77.4 bits (189),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIES YGVHSRQFEV
Sbjct  114  NLDFDYGALAQLQHFSINNLGDPFIESKYGVHSRQFEV  151



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score = 99.4 bits (246),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +2

Query  275  IVTEPVPPPVQSDKLDSPP--AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKE  448
            ++ E   P   S  +DS P     G     REIVLGRNVH  C  + EP+AD+E TG++E
Sbjct  18   LLPEEFDPKEISAPVDSQPNGVLEGRDGKSREIVLGRNVHKLCFAINEPEADDEVTGERE  77

Query  449  AYMASVLARYRKTLVERTKYHLGYP  523
            AYMASVLARYRK+L+ERTK+HLGYP
Sbjct  78   AYMASVLARYRKSLIERTKHHLGYP  102


 Score = 79.7 bits (195),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  104  NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  141



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score = 99.4 bits (246),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  KADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            K   +EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYP
Sbjct  113  KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYP  171


 Score = 79.3 bits (194),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  173  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  210



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   103 bits (257),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  275  IVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  454
            I+ + V   +  + + +    NG +   R+IVLGRN+HTTCLEVTEPD D+E TG++EAY
Sbjct  3    IMRDHVTLTIGENGIGNGVVQNGTENGERKIVLGRNIHTTCLEVTEPDIDDEVTGEREAY  62

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            MA VLA+Y+K+L ERT YHLGYP
Sbjct  63   MAGVLAKYKKSLTERTNYHLGYP  85


 Score = 74.7 bits (182),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+FDY  LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  87   NLNFDYDALSQLQHFSINNLGDPFIESNYGVHSRQFEV  124



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score = 99.0 bits (245),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  KADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            K   +EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYP
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYP  103


 Score = 79.0 bits (193),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  142



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score = 99.0 bits (245),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  KADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            K   +EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYP
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYP  103


 Score = 79.0 bits (193),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  142



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score = 99.0 bits (245),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  347  KADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            K   +EIVLG+NVH +C  VTEP+AD+E TGDKEAYMA VLARYRKTL+ERTK+HLGYP
Sbjct  45   KTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYP  103


 Score = 79.3 bits (194),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  105  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  142



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score = 97.8 bits (242),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIVLGRN+H  C  +TEP+ D+E TGDK+ YMA VLARYRKTLVERTKYHLGYP
Sbjct  42   REIVLGRNLHDQCFSITEPEHDDEETGDKDVYMAGVLARYRKTLVERTKYHLGYP  96


 Score = 80.1 bits (196),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  98   NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  135



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score = 97.4 bits (241),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +2

Query  290  VPPPVQSDKLDSPPAANGGKA-----DXREIVLGRNVHTTCLEVTEPDADNESTGDKEAY  454
            +P  +  D     P   G  A       REIVLGRN+H  C  +TEP+ D+E TG+K+ Y
Sbjct  14   LPEEISIDSCGIEPDLEGADAIGKLRGEREIVLGRNLHDQCFSITEPEHDDEETGEKDVY  73

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            MA VLARYRKTLVERTKYHLGYP
Sbjct  74   MAGVLARYRKTLVERTKYHLGYP  96


 Score = 80.1 bits (196),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  98   NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  135



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score = 95.5 bits (236),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            RE+VLGRNVH TC EV EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYP
Sbjct  43   REVVLGRNVHMTCFEVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYP  97


 Score = 79.0 bits (193),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  99   NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  136



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score = 95.1 bits (235),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG     REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+H
Sbjct  63   AANG----RREIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHH  118

Query  512  LGYP  523
            LGYP
Sbjct  119  LGYP  122


 Score = 79.3 bits (194),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  124  NLDFDYGALTQLQHFSINNLGDPFIESNYGVHSRQFEV  161



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score = 95.5 bits (236),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIVLGRNVHT C  + EP+AD+E TG++EAYMASVLARYR++L++RTK+HLGYP
Sbjct  52   REIVLGRNVHTMCFAIKEPEADDEVTGEREAYMASVLARYRRSLIDRTKHHLGYP  106


 Score = 78.2 bits (191),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  108  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  145



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score = 94.7 bits (234),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG     REIV+GRNVHT+C  V EPDAD+E TG++EA MAS+LA YR++LVERTK+H
Sbjct  58   AANG----KREIVMGRNVHTSCFAVKEPDADDEETGEREATMASILALYRRSLVERTKHH  113

Query  512  LGYP  523
            LGYP
Sbjct  114  LGYP  117


 Score = 79.3 bits (194),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  119  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  156



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score = 94.7 bits (234),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 6/67 (9%)
 Frame = +2

Query  341  GGKAD------XREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERT  502
            GGKA+       REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERT
Sbjct  51   GGKAEGPTSNGRREIVMGRNVHTSCFAVKEPDADDEVTGEREATMASVLALYRRSLVERT  110

Query  503  KYHLGYP  523
            K+HLGYP
Sbjct  111  KHHLGYP  117


 Score = 78.6 bits (192),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  119  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  156



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score = 94.7 bits (234),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYP
Sbjct  30   REISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYP  84


 Score = 78.2 bits (191),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  86   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  123



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score = 94.7 bits (234),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REI LGRNVHTTC EV+EPD D++STGD+EAYMASVLARYRK+L+ERTK+HLGYP
Sbjct  30   REISLGRNVHTTCHEVSEPDDDDDSTGDREAYMASVLARYRKSLIERTKHHLGYP  84


 Score = 78.2 bits (191),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  86   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  123



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score = 92.4 bits (228),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIV+GRNVH +C  V EPDAD+E TG++EA MA VLARYR+ L+ERTK+HLGYP
Sbjct  42   REIVMGRNVHASCFAVKEPDADDEVTGEREATMAGVLARYRRCLIERTKHHLGYP  96


 Score = 79.3 bits (194),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  98   NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  135



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score = 90.5 bits (223),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            R IV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+HLGYP
Sbjct  68   RVIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHHLGYP  122


 Score = 79.3 bits (194),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  124  NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  161



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score = 90.5 bits (223),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YRK+LVERTK+HLGYP
Sbjct  39   REIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRKSLVERTKHHLGYP  93


 Score = 78.6 bits (192),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  95   NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  132



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score = 89.4 bits (220),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +2

Query  269  TAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKE  448
             A+  E  P P + +   SP          REIVLGRNVHT    V EPDAD+E TG++E
Sbjct  33   VAMEVESPPRPAEEEGEGSPT--------RREIVLGRNVHTASFAVKEPDADDEETGERE  84

Query  449  AYMASVLARYRKTLVERTKYHLGYP  523
            A MASVLA YR+ LVERTK+HLGYP
Sbjct  85   AAMASVLALYRRNLVERTKHHLGYP  109


 Score = 78.6 bits (192),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  111  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  148



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score = 88.6 bits (218),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  GKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G  + R IVLGRN+HT    + EP++D+E TG++E YMASVLA+YRK+LVERTK+HLGYP
Sbjct  41   GAGEDRAIVLGRNMHTVSFAIKEPESDDELTGEREGYMASVLAKYRKSLVERTKHHLGYP  100


 Score = 78.2 bits (191),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLD DYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  102  NLDLDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  139



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score = 88.6 bits (218),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            REIVLGRNVHT    V EPDAD+E TG++EA MASVLA YR+ LVERTK+HLGYP
Sbjct  57   REIVLGRNVHTASFAVKEPDADDEETGEREAAMASVLALYRRNLVERTKHHLGYP  111


 Score = 78.2 bits (191),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  113  NLDFDYGALGQLQHFSINNLGDPFIESNYGVHSRQFEV  150



>gb|KEH26770.1| histidine decarboxylase-like protein [Medicago truncatula]
Length=122

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  + REIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLG  517
            AD+E TGD++A+MASVLARYRK+L ERTKYHLG
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLG  110



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query  239  ELFADGRFNPTAIVTEPVPPPVQSDKLDSPPAANGGKADXREIVLGRNVHTTCLEVTEPD  418
            EL  D  F+ +AI+ +PVPP V  + +D   A   G  + REIVLGRN+HTTCLEVTEP+
Sbjct  19   ELLPDD-FDVSAIIKDPVPPVVADNGIDKEEAKINGGKEKREIVLGRNIHTTCLEVTEPE  77

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD+E TGD++A+MASVLARYRK+L ERTKYHLGYP
Sbjct  78   ADDEITGDRDAHMASVLARYRKSLTERTKYHLGYP  112



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score = 92.4 bits (228),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 7/68 (10%)
 Frame = +2

Query  332  AANGGKA-------DXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTL  490
            AANG  A         REIVLG+NVHTTC  VTEP+A++E TGDKEAYMA VLARYRK+L
Sbjct  35   AANGEDAGVDKLDKKSREIVLGKNVHTTCFAVTEPEANDEFTGDKEAYMAGVLARYRKSL  94

Query  491  VERTKYHL  514
            +ERTK+HL
Sbjct  95   MERTKHHL  102


 Score = 65.1 bits (157),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  550  LSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  102  LAQLQHFSINNLGDPFIESNYGVHSRQFEV  131



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score = 80.1 bits (196),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  49   NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  86


 Score = 74.3 bits (181),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  383  VHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +H +  ++TEPD D+E TG+K+AYMASVLARYRK+L E++KYHLGYP
Sbjct  1    MHGSSFKITEPDHDDEVTGEKDAYMASVLARYRKSLTEKSKYHLGYP  47



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 80.1 bits (196),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  37   NLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  74


 Score = 62.4 bits (150),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  422  DNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            D++ TGD++AYMA +LARYRKTLVE+TK+HLGYP
Sbjct  2    DDDVTGDRDAYMAGILARYRKTLVEKTKFHLGYP  35



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score = 69.7 bits (169),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  ADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            A  +EIVLGR +  +CL++ E DA+NE++G  +AYM +VLARY    +ERTK+ +GYP
Sbjct  18   ACRKEIVLGRQIQPSCLDIREFDANNEASGATDAYMTAVLARYTHKFLERTKHFIGYP  75


 Score = 66.2 bits (160),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            INLDFDY  L QL  FSINN+GDPFIESNYGVHS+ FEV
Sbjct  76   INLDFDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEV  114



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score = 67.0 bits (162),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +EIVLGR +  +CL++ E DA+NES+   +AYM +VLARY    +ERTK+ +GYP
Sbjct  21   KEIVLGRQIQPSCLDIRELDANNESSEATDAYMTAVLARYTHKFLERTKHVIGYP  75


 Score = 66.2 bits (160),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            INLDFDY  L QL  FSINN+GDPFIESNYGVHS+ FEV
Sbjct  76   INLDFDYRALDQLLQFSINNVGDPFIESNYGVHSKDFEV  114



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 79.3 bits (194),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  25   NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  62


 Score = 49.7 bits (117),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            MASVLARYRKTL+ERTK+HLGYP
Sbjct  1    MASVLARYRKTLIERTKHHLGYP  23



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score = 78.2 bits (191),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDF+YG LSQLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  25   NLDFEYGALSQLQHFSINNLGDPFIESNYGVHSRQFEV  62


 Score = 46.2 bits (108),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            MA VLARYR++LVERTK+HLGYP
Sbjct  1    MAGVLARYRRSLVERTKHHLGYP  23



>gb|AFW71721.1| hypothetical protein ZEAMMB73_965103, partial [Zea mays]
Length=137

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG     REIV+GRNVHT+C  V EPDAD+E TG++EA MASVLA YR++LVERTK+H
Sbjct  63   AANG----RREIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLALYRRSLVERTKHH  118

Query  512  LGY  520
            LG 
Sbjct  119  LGM  121



>gb|AFW62561.1| hypothetical protein ZEAMMB73_005785 [Zea mays]
Length=128

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 4/62 (6%)
 Frame = +2

Query  332  AANGGKADXREIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYH  511
            AANG     REIV+GRNVHT+C  V EPDAD+E TG++EA MAS+LA YR++LVERTK+H
Sbjct  58   AANG----KREIVMGRNVHTSCFAVKEPDADDEETGEREATMASILALYRRSLVERTKHH  113

Query  512  LG  517
            LG
Sbjct  114  LG  115



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score = 70.1 bits (170),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  L+Q Q FSINNLGDPFIESNYGVHSRQFEV
Sbjct  105  NLDFDFSPLTQFQSFSINNLGDPFIESNYGVHSRQFEV  142


 Score = 40.4 bits (93),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP +D E+  ++ A +A++LA +   L ERT +HLGYP
Sbjct  64   VLEPPSDEEAAAERRAQVAALLASFGHHLRERTAHHLGYP  103



>ref|XP_006851377.1| hypothetical protein AMTR_s00040p00010950, partial [Amborella 
trichopoda]
 gb|ERN12958.1| hypothetical protein AMTR_s00040p00010950, partial [Amborella 
trichopoda]
Length=100

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHL  514
            REIVL  NVH +CLEVT+PDAD+E T +K+AYMAS+LARY+K L+ER K+ L
Sbjct  49   REIVLESNVHLSCLEVTDPDADDEVTREKDAYMASILARYQKLLIERAKHLL  100



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L+QLQHFSINNLGDPFIESNYGVHSRQFEV
Sbjct  36   NLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEV  73



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score = 67.8 bits (164),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L  L  +SINNLGDPFIESNYGVHSR+FEV
Sbjct  32   NLDFDYGLLEGLTKYSINNLGDPFIESNYGVHSREFEV  69


 Score = 35.8 bits (81),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +2

Query  434  TGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            T ++EA +A ++  Y K L ERT +H+GYP
Sbjct  1    TQEREAQIAEMIGSYMKKLAERTHHHMGYP  30



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score = 70.5 bits (171),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L  LQ F INNLGDPFIESNYGVHSR+FE+
Sbjct  114  NLDFDYGPLEGLQKFCINNLGDPFIESNYGVHSREFEI  151


 Score = 30.8 bits (68),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +2

Query  446  EAYMASVLARYRKTLVERTKYHLGYP  523
            EA +  V+  YR+ L +RT +H+GYP
Sbjct  87   EARVRQVIEDYRQKLEDRTDHHMGYP  112



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score = 57.8 bits (138),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  NLDFDYGDLSQ-LQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  L+  LQ   INNLGDPF+ESNYGVHSR  EV
Sbjct  99   NLDFDFASLAPFLQGLCINNLGDPFVESNYGVHSRPLEV  137


 Score = 42.7 bits (99),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYP
Sbjct  58   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYP  97



>ref|XP_002454879.1| hypothetical protein SORBIDRAFT_03g000687 [Sorghum bicolor]
 gb|EER99998.1| hypothetical protein SORBIDRAFT_03g000687 [Sorghum bicolor]
Length=156

 Score = 57.0 bits (136),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  NLDFDYGDLSQ-LQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  L+  LQ   INNLGDPF+ESNYGVHSR  EV
Sbjct  101  NLDFDFASLAPFLQGLCINNLGDPFVESNYGVHSRPLEV  139


 Score = 42.7 bits (99),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP AD E+  +++A +A +LA +R+ L +R+ +HLGYP
Sbjct  60   VQEPPADEEALAERQAEVARLLAGFRRHLEDRSAHHLGYP  99



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score = 67.0 bits (162),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+G L  L  +SINNLGDPFIESNYGVHSR+FEV
Sbjct  109  NLDFDFGALEGLTRYSINNLGDPFIESNYGVHSREFEV  146


 Score = 32.0 bits (71),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 3/26 (12%)
 Frame = +2

Query  455  MASV---LARYRKTLVERTKYHLGYP  523
            MA++   + +Y K L ERTK+H+GYP
Sbjct  82   MAAINETIQKYEKKLAERTKHHMGYP  107



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score = 68.9 bits (167),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  ++Q Q+FSINNLGDPFIESNYGVHSRQFEV
Sbjct  112  NLDFDFSVMAQFQNFSINNLGDPFIESNYGVHSRQFEV  149


 Score = 29.6 bits (65),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            +A++LA + + L ERT +HLGYP
Sbjct  88   VAALLAGFARHLQERTTHHLGYP  110



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score = 70.9 bits (172),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L  LQ F INNLGDPFIESNYGVHSR+FE+
Sbjct  114  NLDFDYGPLECLQRFCINNLGDPFIESNYGVHSREFEI  151


 Score = 27.7 bits (60),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  446  EAYMASVLARYRKTLVERTKYHLGYP  523
            E+ ++ V+  Y+  L  RT +H+GYP
Sbjct  87   ESRLSEVIQSYKNKLEHRTHHHMGYP  112



>ref|XP_002444261.1| hypothetical protein SORBIDRAFT_07g019126 [Sorghum bicolor]
 gb|EES13756.1| hypothetical protein SORBIDRAFT_07g019126 [Sorghum bicolor]
Length=156

 Score = 57.0 bits (136),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  NLDFDYGDLSQ-LQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  L+  LQ   INNLGDPF+ESNYGVHSR  EV
Sbjct  101  NLDFDFASLAPFLQGLCINNLGDPFVESNYGVHSRPLEV  139


 Score = 40.8 bits (94),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP A+ E+  +++A +A +LA +R+ L +R+ +HLGYP
Sbjct  60   VQEPPANEEALAERQAEVARLLAGFRRHLEDRSAHHLGYP  99



>gb|EMT14426.1| hypothetical protein F775_23387 [Aegilops tauschii]
Length=66

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+G L+Q Q F INN+GDPFIESNYGVHSRQFEV
Sbjct  25   NLDFDFGALNQFQSFFINNVGDPFIESNYGVHSRQFEV  62


 Score = 31.6 bits (70),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  455  MASVLARYRKTLVERTKYHLGYP  523
            MA++LA +   L ERT +HLGYP
Sbjct  1    MAALLAGFAHHLEERTDHHLGYP  23



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score = 58.9 bits (141),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL+ D G + Q Q+F +NN+GDPF+ESNYG+HSR+FEV
Sbjct  69   NLELDVGPVIQFQNFHVNNIGDPFMESNYGIHSRKFEV  106


 Score = 38.5 bits (88),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = +2

Query  389  TTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            T   ++ EP  D ++   +   + ++L  +RK L ER+ YHLGYP
Sbjct  23   TDTYDIDEPPKDEQAATQRRLRIDNLLVNFRKQLQERSAYHLGYP  67



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score = 68.9 bits (167),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L  LQ + INNLGDPFIESNYGVHSR+FE+
Sbjct  109  NLDFDYGPLEGLQKYCINNLGDPFIESNYGVHSREFEI  146


 Score = 28.5 bits (62),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (57%), Gaps = 4/46 (9%)
 Frame = +2

Query  389  TTCLEVTEP-DADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            T  L V EP + D E   + EA +  V+  Y++ L  RT +H+GYP
Sbjct  65   TPALPVLEPGELDKE---ELEARINKVIDDYKEKLQLRTDHHMGYP  107



>gb|AGT16577.1| histidine decarboxylase-like protein [Saccharum hybrid cultivar 
R570]
Length=375

 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  526  NLDFDYGDLSQ-LQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLD D+  L+  LQ   INNLGDPF+ESNYGVHSR  EV
Sbjct  97   NLDLDFAPLAPFLQGLCINNLGDPFVESNYGVHSRPMEV  135


 Score = 40.8 bits (94),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP AD ++  +++A +A +LA +R+ L +R+ +HLGYP
Sbjct  56   VEEPPADEDALAERQAEVALLLAGFRRHLEDRSAHHLGYP  95



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score = 68.2 bits (165),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFDYG L  L  +SINNLGDPFIESNYGVHSR+FEV
Sbjct  106  NLDFDYGLLEGLTKYSINNLGDPFIESNYGVHSREFEV  143


 Score = 28.9 bits (63),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYP  523
            ++  Y K L ERT +H+GYP
Sbjct  85   MIGNYMKKLAERTHHHMGYP  104



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score = 60.8 bits (146),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  535  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  636
             D G L+Q QHF INN+GDPF+ESNYG+HSRQFE
Sbjct  652  LDVGPLAQFQHFHINNIGDPFVESNYGIHSRQFE  685


 Score = 32.3 bits (72),  Expect(2) = 9e-11, Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P
Sbjct  608  IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHP  647



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  ++Q Q FSINNLGDPFIESNYGVHSRQFEV
Sbjct  26   NLDFDFSVMAQFQSFSINNLGDPFIESNYGVHSRQFEV  63



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score = 50.8 bits (120),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N D+D+G L+   +FS+NN GDPF + N  VHSRQFEV
Sbjct  88   LNFDYDFGPLAPFLNFSLNNAGDPFAKVNNSVHSRQFEV  126


 Score = 41.2 bits (95),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYP  87



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score = 51.2 bits (121),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +NLD+D+  L+   +FS+NN GDPF + N  VHSRQFEV
Sbjct  82   LNLDYDFSPLAPFLNFSLNNAGDPFCKVNSSVHSRQFEV  120


 Score = 40.8 bits (94),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  371  LGRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L R V    LE+ EP  D     +K+A +A ++A Y + L  R+ +HLGYP
Sbjct  31   LVRQVILEGLEIEEPPVDETEVAEKKAGIARLMAGYVQHLQHRSAFHLGYP  81



>gb|EAZ18332.1| hypothetical protein OsJ_33863 [Oryza sativa Japonica Group]
Length=446

 Score = 60.8 bits (146),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  535  FDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  636
             D G L+Q QHF INN+GDPF+ESNYG+HSRQFE
Sbjct  75   LDVGPLAQFQHFHINNIGDPFVESNYGIHSRQFE  108


 Score = 30.8 bits (68),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            + EP  D ++   ++  + ++L  +R+ L ER+ +HLG+P
Sbjct  31   IDEPPEDAQAVLKRQHGIDNLLGHFRQHLQERSAHHLGHP  70



>gb|EMT14424.1| Histidine decarboxylase [Aegilops tauschii]
Length=440

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  496  ADQVSSRVSINLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +D   +R   NLDFD+  L Q Q FSINNLG PFIESNYGVHSR+FEV
Sbjct  126  SDLALARYPFNLDFDFSVLDQFQSFSINNLGGPFIESNYGVHSRRFEV  173



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NLDFD+  L  LQ FSINNLGDPFIESNYGVHSR+FE+
Sbjct  11   NLDFDFSALEGLQRFSINNLGDPFIESNYGVHSREFEI  48



>ref|XP_006826559.1| hypothetical protein AMTR_s04872p00009330, partial [Amborella 
trichopoda]
 gb|ERM93796.1| hypothetical protein AMTR_s04872p00009330, partial [Amborella 
trichopoda]
Length=86

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  359  REIVLGRNVHTTCLEVTEPDADNESTGDKEAYMASVLA  472
            REIVL  NVH +CLEVTEPDAD+E T +KEAYMAS+LA
Sbjct  49   REIVLESNVHLSCLEVTEPDADDEVTREKEAYMASILA  86



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N D+D+  L+   +FS+NN GDPF + N  VHSRQFEV
Sbjct  88   LNFDYDFSPLAPFLNFSLNNAGDPFAKVNNSVHSRQFEV  126


 Score = 41.2 bits (95),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYP  87



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL FDY +L+Q   +SINNLGDPF+ SNYGVHSRQFEV
Sbjct  24   NLMFDYTELAQFMKYSINNLGDPFVPSNYGVHSRQFEV  61



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score = 54.7 bits (130),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  636
            NL +++ +LS    +S+NNLGDPF+ESNYGVHSR FE
Sbjct  57   NLSYNHEELSPFLRYSVNNLGDPFVESNYGVHSRAFE  93


 Score = 28.5 bits (62),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +2

Query  464  VLARYRKTLVERTKYHLGYP  523
            +L +Y+K + ERT +H GYP
Sbjct  36   ILDQYKKHIEERTYHHFGYP  55



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score = 47.4 bits (111),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL FD   L    ++S NNLGD F+ SNY VH+R+FE+
Sbjct  316  NLAFDNEHLHSFMNYSCNNLGDCFVASNYEVHTRKFEI  353


 Score = 33.1 bits (74),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (49%), Gaps = 0/35 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD      ++A +      YR  L ERT YH GYP
Sbjct  280  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYP  314



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score = 47.4 bits (111),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL FD   L    ++S NNLGD F+ SNY VH+R+FE+
Sbjct  307  NLAFDNEHLHSFMNYSCNNLGDCFVASNYEVHTRKFEI  344


 Score = 33.1 bits (74),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (49%), Gaps = 0/35 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            AD      ++A +      YR  L ERT YH GYP
Sbjct  271  ADEREYAKRKAAVVQTFDAYRDFLAERTAYHFGYP  305



>ref|XP_006591667.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=220

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  562  QHFSINNLGDPFIESNYGVHSRQFEV  639
            +HFSINN GDPFIESNYGVHSRQFEV
Sbjct  72   KHFSINNPGDPFIESNYGVHSRQFEV  97



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score = 47.8 bits (112),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N DFDY  L+ L HF +NN+GDPF ES++ ++S +FEV
Sbjct  41   NQDFDYDALAPLLHFHLNNVGDPFTESSFSLNSSKFEV  78


 Score = 28.9 bits (63),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            A  + +G+ +A +ASV+ +Y +TL +     LGYP
Sbjct  5    AITKCSGETQANLASVITQYVETLNQHNLRFLGYP  39



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score = 49.7 bits (117),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N  FDY  L+ L HF INN+GDPF+ S+YGV+S  FEV
Sbjct  82   NQSFDYSALAPLLHFHINNVGDPFMGSSYGVNSANFEV  119


 Score = 26.6 bits (57),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 0/35 (0%)
 Frame = +2

Query  419  ADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            A    TG+ +  +A V+  Y  TL +   + LGYP
Sbjct  46   AITNCTGESQGKLAEVINHYAGTLNQEISHLLGYP  80



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL +++ +L +   +SINNLGDPFI SNYGVHSRQFE 
Sbjct  24   NLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFEC  61



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score = 42.4 bits (98),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N DF+Y  L+ L HF +NN GDPF+ S++ ++S  FEV
Sbjct  78   NQDFNYDKLAPLFHFHLNNAGDPFVGSSFSLNSSPFEV  115


 Score = 32.7 bits (73),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            NE  G+K+A + +++ARY +T+ +    +LGYP
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYP  76



>gb|EJK75470.1| hypothetical protein THAOC_02802 [Thalassiosira oceanica]
Length=474

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            NL +++ +L +   +SINNLGDPFI SNYGVHSRQFE 
Sbjct  208  NLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFEC  245



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score = 42.0 bits (97),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N DF+Y  L+ L HF +NN GDPF+ S++ ++S  FEV
Sbjct  78   NQDFNYDKLAPLFHFHLNNAGDPFVGSSFSLNSSPFEV  115


 Score = 32.3 bits (72),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  425  NESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            NE  G+K+A + +++ARY +T+ +    +LGYP
Sbjct  44   NECMGEKDANLDAIIARYAETINKYNLRNLGYP  76



>ref|NP_001176002.1| Os10g0105700 [Oryza sativa Japonica Group]
 dbj|BAH94730.1| Os10g0105700 [Oryza sativa Japonica Group]
Length=219

 Score = 41.6 bits (96),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LE+ EP AD     +K+A ++ ++A Y + L  R+ YHLGYP
Sbjct  46   LEIEEPPADEMEAAEKKAGISRLMAGYVQHLQHRSAYHLGYP  87


 Score = 32.7 bits (73),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIES  606
            +N D+D+  L+   +FS+NN GDPF ++
Sbjct  88   LNFDYDFSPLAPFLNFSLNNAGDPFAKA  115



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score = 42.0 bits (97),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N +F+Y  L+ L HF +NN GDPF+ S++ ++S +FEV
Sbjct  86   NQNFNYDTLASLLHFHLNNAGDPFLGSSFSLNSTRFEV  123


 Score = 31.6 bits (70),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            +++ E  A  + +G+ +A +ASV+  Y +TL + +  +LGYP
Sbjct  43   IDIKENLAITKCSGETQANLASVITHYVETLNQYSLRNLGYP  84



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score = 39.3 bits (90),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 2/42 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L V EPD+ +  T  +E  +  +L +Y +TL  RT+YH+GYP
Sbjct  28   LSVVEPDSKDNKTFSQE--LDRILTQYIETLSHRTEYHIGYP  67


 Score = 33.9 bits (76),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +++   L+ L  F +NN GDPF ++    HS+ FEV
Sbjct  68   VNICYEHHAALAPLLQFHLNNCGDPFTQNTVDFHSKDFEV  107



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 2/42 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L V EPD  +  T  +E  +  +L +Y +TL  RT+YH+GYP
Sbjct  30   LSVVEPDGKDIKTSSQE--LDRILIQYIETLSHRTEYHIGYP  69


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +++   L+ L  F +NN GDPF ++    HS+ FEV
Sbjct  70   VNICYEHHAALAPLLQFHLNNCGDPFTQNTVDFHSKDFEV  109



>ref|XP_001757041.1| predicted protein [Physcomitrella patens]
 gb|EDQ78272.1| predicted protein [Physcomitrella patens]
Length=525

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  520  SINLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            S NLDF+Y  LS +Q+  I+NLG+PFIE N+G+ SRQF+V
Sbjct  425  SFNLDFNYETLSPIQNSFIDNLGNPFIERNFGIPSRQFDV  464



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFD-YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +D Y  L+ L  F +NN GDPF+++    HS+ FEV
Sbjct  93   VNICYDHYATLAPLLQFHLNNCGDPFLQNTVDFHSKDFEV  132


 Score = 34.7 bits (78),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 5/42 (12%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LEV EP   N+     +  + ++L  Y  TL +R  YHLGYP
Sbjct  56   LEVMEPGLKND-----DPSLDTILVNYLDTLKQRVNYHLGYP  92



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score = 44.7 bits (104),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  541  YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            Y  LS L  F+INN GDPF ES++G+HS++FEV
Sbjct  96   YLALSTLLQFNINNAGDPFKESDHGLHSKKFEV  128


 Score = 28.1 bits (61),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/39 (26%), Positives = 20/39 (51%), Gaps = 0/39 (0%)
 Frame = +2

Query  407  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             EP  +     ++  ++  ++ +++  L ER   HLGYP
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYP  88



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            IN +FD+G + +  +  +NN GDPF+E NYG+HS++FE+
Sbjct  72   INFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEI  110



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score = 44.7 bits (104),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  541  YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            Y  LS L  F+INN GDPF ES++G+HS++FEV
Sbjct  96   YLALSTLLQFNINNAGDPFKESDHGLHSKKFEV  128


 Score = 28.1 bits (61),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/39 (26%), Positives = 20/39 (51%), Gaps = 0/39 (0%)
 Frame = +2

Query  407  TEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
             EP  +     ++  ++  ++ +++  L ER   HLGYP
Sbjct  50   VEPKDEESCAAERLHHLTKIVTQFQDHLRERASNHLGYP  88



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            IN +FD+G + +  +  +NN GDPF+E NYG+HS++FE+
Sbjct  59   INFEFDFGPVIEFLNMRLNNAGDPFMECNYGIHSKKFEI  97



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score = 37.4 bits (85),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EPD  N     +E  +  +L +Y +TL  RT+YH+GYP
Sbjct  32   VVEPDEKNIKMSSQE--LDKILTQYIETLSHRTEYHIGYP  69


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFDYGD-LSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +++ D L+ L  F +NN GDPF ++    HS+ FEV
Sbjct  70   VNICYEHHDALAPLLQFHLNNCGDPFTQNTVDFHSKDFEV  109



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score = 47.4 bits (111),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  526  NLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            N DFDY  L+ L HF +NN+GDPF ES++ ++S +FEV
Sbjct  51   NQDFDYDALAPLLHFHLNNVGDPFTESSFSLNSSKFEV  88


 Score = 24.6 bits (52),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 10/50 (20%)
 Frame = +2

Query  374  GRNVHTTCLEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            G   H+ C         N +  D+ + +ASV+ +Y +TL +     LGYP
Sbjct  10   GNGFHSCC---------NGAVADR-SNLASVITQYVETLNQHNLRFLGYP  49



>ref|WP_041764715.1| hypothetical protein, partial [Leptolyngbya sp. PCC 7376]
Length=386

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  636
            +N DFDY  LS    F INN+GDPF+   YG+HSR  E
Sbjct  24   VNADFDYSALSDFLEFHINNVGDPFVAGTYGIHSRMME  61



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score = 45.4 bits (106),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  541  YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            Y  LS L  F+INN+GDPF ES++G+HS++FEV
Sbjct  86   YLALSTLLQFNINNVGDPFKESDHGLHSKKFEV  118


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (58%), Gaps = 1/40 (3%)
 Frame = +2

Query  404  VTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            V EP+ + E   ++   ++  +  +++ L ER  Y+LGYP
Sbjct  40   VEEPN-NEECAVERVDRLSKTVTEFQEHLRERVSYYLGYP  78



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score = 37.7 bits (86),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYP  69


 Score = 33.9 bits (76),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +++   L+ L  F +NN GDPF ++    HS+ FEV
Sbjct  70   VNICYEHHAALAPLLQFHLNNCGDPFTQNTVDFHSKDFEV  109



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score = 37.7 bits (86),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            L V EPD  +     +E  +  +L +Y +TL  RT+YH+GYP
Sbjct  30   LSVVEPDEKDNKMSSQE--LDRILTQYIETLSHRTEYHIGYP  69


 Score = 33.9 bits (76),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFDY-GDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +++   L+ L  F +NN GDPF ++    HS+ FEV
Sbjct  70   VNICYEHHAALAPLLQFHLNNCGDPFTQNTVDFHSKDFEV  109



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score = 38.1 bits (87),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFD-YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +D Y  L+ L  F +NN GDPF+++    HS+ FEV
Sbjct  93   VNICYDHYATLAPLLQFHLNNCGDPFLQNTVDFHSKDFEV  132


 Score = 32.7 bits (73),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (12%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYP  92



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score = 38.1 bits (87),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +1

Query  523  INLDFD-YGDLSQLQHFSINNLGDPFIESNYGVHSRQFEV  639
            +N+ +D Y  L+ L  F +NN GDPF+++    HS+ FEV
Sbjct  93   VNICYDHYATLAPLLQFHLNNCGDPFLQNTVDFHSKDFEV  132


 Score = 32.7 bits (73),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (12%)
 Frame = +2

Query  398  LEVTEPDADNESTGDKEAYMASVLARYRKTLVERTKYHLGYP  523
            LEV EP   N+        + ++L  Y  TL +R  +HLGYP
Sbjct  56   LEVMEPGLKNDGPS-----LDTILVNYLDTLKQRVNFHLGYP  92



>gb|AFY36874.1| Histidine decarboxylase [Leptolyngbya sp. PCC 7376]
Length=669

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  523  INLDFDYGDLSQLQHFSINNLGDPFIESNYGVHSRQFE  636
            +N DFDY  LS    F INN+GDPF+   YG+HSR  E
Sbjct  56   VNADFDYSALSDFLEFHINNVGDPFVAGTYGIHSRMME  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750