BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021L24

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006345079.1|  PREDICTED: serine/threonine-protein kinase 1...    395   9e-135   Solanum tuberosum [potatoes]
ref|XP_004236087.1|  PREDICTED: probable serine/threonine-protein...    392   9e-134   Solanum lycopersicum
ref|XP_009766540.1|  PREDICTED: probable serine/threonine-protein...    390   6e-133   Nicotiana sylvestris
ref|XP_004241617.1|  PREDICTED: probable serine/threonine-protein...    388   4e-132   Solanum lycopersicum
ref|XP_009607782.1|  PREDICTED: probable serine/threonine-protein...    387   1e-131   Nicotiana tomentosiformis
ref|XP_011072928.1|  PREDICTED: probable serine/threonine-protein...    381   2e-129   Sesamum indicum [beniseed]
gb|EPS69990.1|  hypothetical protein M569_04770                         380   4e-129   Genlisea aurea
ref|XP_008356645.1|  PREDICTED: serine/threonine-protein kinase 1...    378   3e-128   Malus domestica [apple tree]
ref|XP_008351873.1|  PREDICTED: serine/threonine-protein kinase 1...    374   1e-127   
ref|XP_006354740.1|  PREDICTED: serine/threonine-protein kinase 1...    376   2e-127   Solanum tuberosum [potatoes]
ref|XP_009337751.1|  PREDICTED: serine/threonine-protein kinase 1...    376   3e-127   Pyrus x bretschneideri [bai li]
ref|XP_004299264.1|  PREDICTED: serine/threonine-protein kinase 16      376   3e-127   Fragaria vesca subsp. vesca
gb|EYU19016.1|  hypothetical protein MIMGU_mgv1a009372mg                375   6e-127   Erythranthe guttata [common monkey flower]
ref|XP_010678394.1|  PREDICTED: probable serine/threonine-protein...    373   3e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008453331.1|  PREDICTED: serine/threonine-protein kinase 1...    371   3e-126   Cucumis melo [Oriental melon]
ref|XP_008360890.1|  PREDICTED: serine/threonine-protein kinase 1...    373   4e-126   
ref|XP_007037718.1|  Serine/threonine protein kinase 3 isoform 2        370   4e-126   
ref|XP_008367568.1|  PREDICTED: serine/threonine-protein kinase 1...    373   5e-126   
ref|XP_009346448.1|  PREDICTED: serine/threonine-protein kinase 1...    373   5e-126   Pyrus x bretschneideri [bai li]
gb|KHG15042.1|  Serine/threonine-protein kinase 16                      372   6e-126   Gossypium arboreum [tree cotton]
ref|XP_007037719.1|  Serine/threonine protein kinase 3 isoform 3        370   9e-126   
ref|XP_010031327.1|  PREDICTED: serine/threonine-protein kinase 16      372   1e-125   Eucalyptus grandis [rose gum]
ref|XP_008453330.1|  PREDICTED: serine/threonine-protein kinase 1...    370   1e-125   Cucumis melo [Oriental melon]
ref|XP_007155191.1|  hypothetical protein PHAVU_003G181000g             371   2e-125   Phaseolus vulgaris [French bean]
ref|XP_010099029.1|  Serine/threonine-protein kinase 16                 371   3e-125   Morus notabilis
ref|XP_003609185.1|  Serine/threonine protein kinase                    370   4e-125   Medicago truncatula
gb|KJB06908.1|  hypothetical protein B456_001G066000                    370   5e-125   Gossypium raimondii
gb|ACU19230.1|  unknown                                                 365   7e-125   Glycine max [soybeans]
ref|XP_007037717.1|  Serine/threonine protein kinase 3 isoform 1        370   7e-125   
ref|XP_008453329.1|  PREDICTED: serine/threonine-protein kinase 1...    369   1e-124   Cucumis melo [Oriental melon]
ref|XP_003524500.1|  PREDICTED: probable serine/threonine-protein...    369   2e-124   Glycine max [soybeans]
ref|XP_004138208.1|  PREDICTED: probable serine/threonine-protein...    369   2e-124   Cucumis sativus [cucumbers]
ref|XP_007209310.1|  hypothetical protein PRUPE_ppa008104mg             368   3e-124   Prunus persica
ref|XP_008240053.1|  PREDICTED: serine/threonine-protein kinase 16      368   4e-124   Prunus mume [ume]
ref|XP_002512018.1|  serine/threonine protein kinase, putative          368   4e-124   Ricinus communis
ref|XP_009597332.1|  PREDICTED: serine/threonine-protein kinase 1...    368   5e-124   Nicotiana tomentosiformis
emb|CDY21515.1|  BnaC09g47770D                                          368   5e-124   Brassica napus [oilseed rape]
ref|XP_010522295.1|  PREDICTED: serine/threonine-protein kinase 1...    367   1e-123   Tarenaya hassleriana [spider flower]
emb|CDO98513.1|  unnamed protein product                                367   1e-123   Coffea canephora [robusta coffee]
gb|KJB19472.1|  hypothetical protein B456_003G104700                    362   4e-123   Gossypium raimondii
gb|KFK25181.1|  hypothetical protein AALP_AA8G077200                    365   6e-123   Arabis alpina [alpine rockcress]
dbj|BAJ53163.1|  JHL10I11.9                                             364   1e-122   Jatropha curcas
ref|XP_006600612.1|  PREDICTED: serine/threonine-protein kinase 16      364   1e-122   Glycine max [soybeans]
ref|XP_002269355.1|  PREDICTED: serine/threonine-protein kinase 16      364   1e-122   Vitis vinifera
ref|XP_006399302.1|  hypothetical protein EUTSA_v10013995mg             364   2e-122   Eutrema salsugineum [saltwater cress]
gb|KJB19471.1|  hypothetical protein B456_003G104700                    360   2e-122   Gossypium raimondii
ref|XP_004508637.1|  PREDICTED: serine/threonine-protein kinase 1...    363   2e-122   Cicer arietinum [garbanzo]
emb|CDX69971.1|  BnaA10g23200D                                          363   3e-122   
gb|KJB19474.1|  hypothetical protein B456_003G104700                    360   3e-122   Gossypium raimondii
ref|XP_010423128.1|  PREDICTED: probable serine/threonine-protein...    362   7e-122   Camelina sativa [gold-of-pleasure]
gb|ABK92466.1|  unknown                                                 362   8e-122   Populus trichocarpa [western balsam poplar]
gb|KDO65614.1|  hypothetical protein CISIN_1g024842mg                   359   8e-122   Citrus sinensis [apfelsine]
ref|NP_196433.1|  serine/threonine protein kinase 3                     362   8e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006440851.1|  hypothetical protein CICLE_v10021674mg             359   9e-122   
emb|CAN66918.1|  hypothetical protein VITISV_043041                     362   1e-121   Vitis vinifera
ref|XP_009798655.1|  PREDICTED: serine/threonine-protein kinase 1...    361   2e-121   Nicotiana sylvestris
ref|XP_009131040.1|  PREDICTED: probable serine/threonine-protein...    360   3e-121   Brassica rapa
ref|XP_002873344.1|  hypothetical protein ARALYDRAFT_487651             360   4e-121   
gb|AAM65833.1|  serine/threonine protein kinase                         360   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257846.1|  PREDICTED: serine/threonine-protein kinase 16      360   7e-121   Nelumbo nucifera [Indian lotus]
ref|XP_006374373.1|  hypothetical protein POPTR_0015s06550g             360   7e-121   Populus trichocarpa [western balsam poplar]
gb|KJB19470.1|  hypothetical protein B456_003G104700                    359   1e-120   Gossypium raimondii
emb|CDY67889.1|  BnaAnng25480D                                          359   1e-120   Brassica napus [oilseed rape]
ref|XP_006485732.1|  PREDICTED: serine/threonine-protein kinase 1...    359   2e-120   Citrus sinensis [apfelsine]
ref|XP_010491440.1|  PREDICTED: probable serine/threonine-protein...    358   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006288089.1|  hypothetical protein CARUB_v10001319mg             358   3e-120   Capsella rubella
ref|XP_010452793.1|  PREDICTED: probable serine/threonine-protein...    357   1e-119   Camelina sativa [gold-of-pleasure]
ref|XP_006844169.1|  hypothetical protein AMTR_s00006p00262500          356   1e-119   Amborella trichopoda
ref|XP_010261723.1|  PREDICTED: serine/threonine-protein kinase 1...    356   2e-119   Nelumbo nucifera [Indian lotus]
emb|CDY70989.1|  BnaC03g71390D                                          355   3e-119   Brassica napus [oilseed rape]
ref|XP_002317918.2|  hypothetical protein POPTR_0012s05390g             355   7e-119   
ref|XP_011011304.1|  PREDICTED: serine/threonine-protein kinase 1...    355   8e-119   Populus euphratica
gb|AIZ68208.1|  Serine/threonine-protein kinase 16                      353   1e-118   Ornithogalum longebracteatum [sea-onion]
ref|XP_009125719.1|  PREDICTED: serine/threonine-protein kinase 1...    353   3e-118   Brassica rapa
gb|KJB51100.1|  hypothetical protein B456_008G201200                    352   5e-118   Gossypium raimondii
ref|XP_009415450.1|  PREDICTED: probable serine/threonine-protein...    351   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011005497.1|  PREDICTED: serine/threonine-protein kinase 1...    350   3e-117   Populus euphratica
emb|CDY44759.1|  BnaC02g01280D                                          350   4e-117   Brassica napus [oilseed rape]
ref|XP_008393382.1|  PREDICTED: serine/threonine-protein kinase 16      349   5e-117   
ref|XP_010547731.1|  PREDICTED: serine/threonine-protein kinase 16      350   5e-117   Tarenaya hassleriana [spider flower]
ref|XP_009396202.1|  PREDICTED: probable serine/threonine-protein...    348   3e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267650.1|  serine/threonine-protein kinase 16-like            348   3e-116   Cucumis sativus [cucumbers]
ref|XP_008455005.1|  PREDICTED: serine/threonine-protein kinase 16      348   3e-116   Cucumis melo [Oriental melon]
gb|AAZ39949.1|  serine/threonine protein kinase                         347   7e-116   Gossypium hirsutum [American cotton]
ref|XP_010905763.1|  PREDICTED: probable serine/threonine-protein...    347   8e-116   Elaeis guineensis
ref|XP_008804427.1|  PREDICTED: probable serine/threonine-protein...    345   4e-115   Phoenix dactylifera
gb|EPS73700.1|  hypothetical protein M569_01056                         344   6e-115   Genlisea aurea
ref|XP_010905766.1|  PREDICTED: probable serine/threonine-protein...    343   2e-114   Elaeis guineensis
ref|XP_008804428.1|  PREDICTED: probable serine/threonine-protein...    342   9e-114   Phoenix dactylifera
gb|KHN15181.1|  Serine/threonine-protein kinase 16                      341   2e-113   Glycine soja [wild soybean]
ref|XP_009395860.1|  PREDICTED: probable serine/threonine-protein...    339   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942233.1|  PREDICTED: serine/threonine-protein kinase 1...    338   2e-112   Elaeis guineensis
gb|AFK43523.1|  unknown                                                 332   5e-112   Lotus japonicus
ref|XP_008797567.1|  PREDICTED: probable serine/threonine-protein...    337   9e-112   Phoenix dactylifera
ref|XP_010929080.1|  PREDICTED: probable serine/threonine-protein...    330   2e-109   Elaeis guineensis
ref|XP_004252263.1|  PREDICTED: probable serine/threonine-protein...    327   3e-108   Solanum lycopersicum
ref|XP_006345347.1|  PREDICTED: serine/threonine-protein kinase 1...    324   6e-107   Solanum tuberosum [potatoes]
ref|NP_001132895.1|  LOC100194392                                       322   2e-106   Zea mays [maize]
ref|XP_004956689.1|  PREDICTED: probable serine/threonine-protein...    322   2e-106   Setaria italica
ref|XP_008783057.1|  PREDICTED: probable serine/threonine-protein...    322   4e-106   Phoenix dactylifera
gb|EMS68366.1|  Serine/threonine-protein kinase 16                      319   4e-105   Triticum urartu
ref|NP_001063027.1|  Os09g0372800                                       318   7e-105   
ref|XP_004956690.1|  PREDICTED: probable serine/threonine-protein...    318   1e-104   Setaria italica
ref|XP_010238122.1|  PREDICTED: serine/threonine-protein kinase 1...    318   1e-104   Brachypodium distachyon [annual false brome]
ref|XP_008650962.1|  PREDICTED: LOC100194392 isoform X1                 318   1e-104   Zea mays [maize]
gb|ACG33051.1|  serine/threonine-protein kinase 16                      318   2e-104   Zea mays [maize]
gb|AFK34971.1|  unknown                                                 309   2e-103   Lotus japonicus
ref|XP_010238123.1|  PREDICTED: serine/threonine-protein kinase 1...    313   7e-103   Brachypodium distachyon [annual false brome]
ref|NP_850792.1|  serine/threonine protein kinase 3                     305   4e-100   Arabidopsis thaliana [mouse-ear cress]
gb|ABB72838.1|  serine/threonine kinase                                 305   2e-99    Elaeis guineensis
dbj|BAJ87464.1|  predicted protein                                      283   7e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001062642.1|  Os09g0237600                                       278   7e-89    
gb|EAZ08255.1|  hypothetical protein OsI_30510                          276   7e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_004956402.1|  PREDICTED: probable serine/threonine-protein...    268   7e-85    Setaria italica
ref|XP_010237321.1|  PREDICTED: probable serine/threonine-protein...    263   5e-83    Brachypodium distachyon [annual false brome]
ref|XP_002991218.1|  hypothetical protein SELMODRAFT_133041             262   1e-82    
ref|NP_001149977.1|  serine/threonine-protein kinase 16                 262   1e-82    Zea mays [maize]
ref|XP_002991279.1|  hypothetical protein SELMODRAFT_185952             261   3e-82    
ref|XP_008668044.1|  PREDICTED: serine/threonine-protein kinase 1...    257   1e-80    Zea mays [maize]
ref|XP_001779469.1|  predicted protein                                  254   2e-79    
dbj|BAJ95332.1|  predicted protein                                      244   6e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661175.1|  PREDICTED: serine/threonine-protein kinase 1...    241   4e-75    
ref|XP_006440850.1|  hypothetical protein CICLE_v10021674mg             227   1e-70    
ref|XP_006661044.1|  PREDICTED: serine/threonine-protein kinase 1...    231   3e-69    
ref|XP_008783059.1|  PREDICTED: probable serine/threonine-protein...    226   1e-68    Phoenix dactylifera
ref|XP_008783056.1|  PREDICTED: probable serine/threonine-protein...    226   1e-68    Phoenix dactylifera
gb|EMT14968.1|  Serine/threonine-protein kinase 16                      213   2e-63    
gb|EMS65453.1|  Serine/threonine-protein kinase 16                      207   1e-61    Triticum urartu
gb|ACN26380.1|  unknown                                                 200   1e-58    Zea mays [maize]
tpg|DAA61227.1|  TPA: putative protein kinase superfamily protein       177   1e-52    
ref|XP_008370887.1|  PREDICTED: uncharacterized protein LOC103434325    139   1e-36    
gb|ABB72840.1|  serine/threonine kinase splice variant 1                134   3e-36    Elaeis guineensis
ref|XP_006575874.1|  PREDICTED: uncharacterized protein LOC100811063    136   2e-35    
gb|KHG05751.1|  Serine/threonine-protein kinase 16                      122   2e-30    Gossypium arboreum [tree cotton]
gb|ABB72839.1|  serine/threonine kinase                                 117   1e-29    Elaeis guineensis
ref|XP_005096441.1|  PREDICTED: serine/threonine-protein kinase 1...    122   2e-29    Aplysia californica
ref|XP_005767918.1|  hypothetical protein EMIHUDRAFT_245791             120   2e-29    Emiliania huxleyi CCMP1516
ref|XP_005794443.1|  hypothetical protein EMIHUDRAFT_431902             120   2e-28    Emiliania huxleyi CCMP1516
ref|XP_003060182.1|  predicted protein                                  119   7e-28    Micromonas pusilla CCMP1545
ref|XP_005848000.1|  hypothetical protein CHLNCDRAFT_145529             117   6e-27    Chlorella variabilis
gb|ADE75600.1|  unknown                                                 110   6e-26    Picea sitchensis
ref|XP_009045048.1|  hypothetical protein LOTGIDRAFT_223991             112   7e-26    Lottia gigantea
gb|KIY96099.1|  serine/threonine kinase 16                              110   1e-24    Monoraphidium neglectum
ref|XP_007419860.1|  PREDICTED: serine/threonine-protein kinase 1...    108   4e-24    Python bivittatus
ref|XP_011456099.1|  PREDICTED: serine/threonine-protein kinase 1...    107   7e-24    Crassostrea gigas
ref|XP_008906617.1|  NAK/MPSK protein kinase                            106   2e-23    Phytophthora parasitica INRA-310
gb|AAN60358.1|  unknown                                                 102   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004997989.1|  NAK/MPSK protein kinase                            105   4e-23    Salpingoeca rosetta
ref|XP_003287685.1|  hypothetical protein DICPUDRAFT_78515              105   4e-23    Dictyostelium purpureum
ref|XP_004067141.1|  PREDICTED: serine/threonine-protein kinase 16      104   7e-23    Oryzias latipes [Japanese rice fish]
ref|XP_004342629.1|  serine/threonine protein kinase                    103   1e-22    Capsaspora owczarzaki ATCC 30864
ref|XP_010794760.1|  PREDICTED: serine/threonine-protein kinase 1...    103   2e-22    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010794761.1|  PREDICTED: serine/threonine-protein kinase 1...    103   2e-22    Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001004792.1|  serine/threonine-protein kinase 16                 102   2e-22    Xenopus tropicalis [western clawed frog]
dbj|GAM27617.1|  hypothetical protein SAMD00019534_107930               102   4e-22    Acytostelium subglobosum LB1
ref|XP_004358442.1|  putative protein serine/threonine kinase           102   4e-22    Cavenderia fasciculata
ref|XP_002504178.1|  serine/threonine-protein kinase                    102   6e-22    Micromonas commoda
ref|XP_004262741.1|  PREDICTED: serine/threonine-protein kinase 16      101   6e-22    Orcinus orca [Orca]
ref|XP_003389271.2|  PREDICTED: serine/threonine-protein kinase 1...    101   6e-22    Amphimedon queenslandica
ref|XP_009525867.1|  hypothetical protein PHYSODRAFT_459513             101   9e-22    Phytophthora sojae
ref|XP_007519784.1|  PREDICTED: serine/threonine-protein kinase 16      100   1e-21    Erinaceus europaeus [common hedgehog]
gb|EWM24320.1|  serine threonine protein kinase                         101   1e-21    Nannochloropsis gaditana
ref|XP_010728226.1|  PREDICTED: serine/threonine-protein kinase 16      100   1e-21    Larimichthys crocea [croceine croaker]
ref|NP_001087851.1|  serine/threonine kinase 16                         100   2e-21    Xenopus laevis [clawed frog]
ref|XP_007122499.1|  PREDICTED: serine/threonine-protein kinase 1...    100   2e-21    Physeter catodon
ref|XP_002895305.1|  serine/threonine protein kinase                    100   2e-21    Phytophthora infestans T30-4
ref|XP_007188028.1|  PREDICTED: serine/threonine-protein kinase 1...  99.8    2e-21    Balaenoptera acutorostrata scammoni
ref|XP_006168692.1|  PREDICTED: serine/threonine-protein kinase 1...    100   2e-21    Tupaia chinensis
ref|XP_003215036.1|  PREDICTED: serine/threonine-protein kinase 16      100   2e-21    Anolis carolinensis [Carolina anole]
ref|XP_007122498.1|  PREDICTED: serine/threonine-protein kinase 1...    100   2e-21    Physeter catodon
ref|XP_006168694.1|  PREDICTED: serine/threonine-protein kinase 1...  99.8    2e-21    
ref|XP_426593.1|  PREDICTED: serine/threonine-protein kinase 16 i...    100   2e-21    Gallus gallus [bantam]
ref|XP_004348721.1|  serine/threonine protein kinase                    100   3e-21    Acanthamoeba castellanii str. Neff
ref|XP_004942901.1|  PREDICTED: serine/threonine-protein kinase 1...    100   3e-21    Gallus gallus [bantam]
ref|XP_007188026.1|  PREDICTED: serine/threonine-protein kinase 1...  99.8    3e-21    Balaenoptera acutorostrata scammoni
ref|XP_006763424.1|  PREDICTED: serine/threonine-protein kinase 1...  99.0    4e-21    Myotis davidii
gb|AAV38392.1|  serine/threonine kinase 16                            99.4    5e-21    Homo sapiens [man]
ref|XP_003784978.1|  PREDICTED: serine/threonine-protein kinase 16    99.4    5e-21    
ref|XP_005883518.1|  PREDICTED: serine/threonine-protein kinase 1...  99.0    6e-21    Myotis brandtii
ref|XP_004762884.1|  PREDICTED: serine/threonine-protein kinase 1...  99.0    6e-21    Mustela putorius furo [black ferret]
ref|XP_011231795.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    6e-21    
ref|XP_004674323.1|  PREDICTED: serine/threonine-protein kinase 16    99.0    6e-21    Condylura cristata
ref|XP_006082609.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    6e-21    Myotis lucifugus
ref|XP_006763422.1|  PREDICTED: serine/threonine-protein kinase 1...  99.0    7e-21    Myotis davidii
ref|XP_003445781.1|  PREDICTED: serine/threonine-protein kinase 1...  99.0    7e-21    Oreochromis niloticus
ref|XP_008143361.1|  PREDICTED: serine/threonine-protein kinase 16    99.0    7e-21    Eptesicus fuscus
ref|XP_005395633.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    7e-21    Chinchilla lanigera
ref|XP_007560183.1|  PREDICTED: serine/threonine-protein kinase 16    99.0    7e-21    
ref|XP_545656.1|  PREDICTED: serine/threonine-protein kinase 16 i...  99.0    7e-21    Canis lupus familiaris [dogs]
ref|XP_006082607.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    7e-21    Myotis lucifugus
ref|XP_008057071.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    8e-21    
ref|XP_002913702.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    8e-21    
ref|XP_005395632.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    8e-21    
ref|XP_008688657.1|  PREDICTED: serine/threonine-protein kinase 1...  98.2    8e-21    Ursus maritimus [white bear]
ref|XP_008057070.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    8e-21    
ref|XP_007445878.1|  PREDICTED: serine/threonine-protein kinase 16    98.6    8e-21    Lipotes vexillifer [baiji]
ref|XP_005395628.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    9e-21    Chinchilla lanigera
ref|XP_008057069.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    9e-21    Carlito syrichta
ref|XP_008688654.1|  PREDICTED: serine/threonine-protein kinase 1...  98.6    1e-20    Ursus maritimus [white bear]
ref|XP_003991222.1|  PREDICTED: serine/threonine-protein kinase 16    98.6    1e-20    Felis catus [cat]
ref|XP_005672285.1|  PREDICTED: serine/threonine-protein kinase 1...  98.2    1e-20    
ref|NP_001253902.1|  serine/threonine-protein kinase 16               98.2    1e-20    Macaca mulatta [rhesus macaque]
ref|XP_005574406.1|  PREDICTED: serine/threonine-protein kinase 1...  98.2    1e-20    Macaca fascicularis [crab eating macaque]
ref|XP_635157.1|  hypothetical protein DDB_G0291350                   98.6    1e-20    Dictyostelium discoideum AX4
ref|XP_004576867.1|  PREDICTED: serine/threonine-protein kinase 16    98.2    1e-20    Ochotona princeps [southern American pika]
ref|XP_008585681.1|  PREDICTED: serine/threonine-protein kinase 16    98.2    1e-20    Galeopterus variegatus [Malayan flying lemur]
ref|XP_005330559.1|  PREDICTED: serine/threonine-protein kinase 1...  98.2    1e-20    Ictidomys tridecemlineatus
ref|XP_005001103.1|  PREDICTED: serine/threonine-protein kinase 1...  97.8    1e-20    
ref|XP_005724188.1|  PREDICTED: serine/threonine-protein kinase 1...  97.8    1e-20    
ref|XP_003464049.1|  PREDICTED: serine/threonine-protein kinase 1...  97.8    1e-20    
ref|XP_001928241.1|  PREDICTED: serine/threonine-protein kinase 1...  97.8    2e-20    
ref|XP_008528199.1|  PREDICTED: serine/threonine-protein kinase 1...  97.4    2e-20    Equus przewalskii [Przewalski horse]
ref|XP_008528196.1|  PREDICTED: serine/threonine-protein kinase 1...  97.8    2e-20    Equus przewalskii [Przewalski horse]
ref|XP_006906757.1|  PREDICTED: serine/threonine-protein kinase 16    97.8    2e-20    
ref|XP_005153910.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    Melopsittacus undulatus
ref|XP_004638249.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    Octodon degus
ref|XP_010610139.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    Fukomys damarensis [Damara mole rat]
ref|XP_006780460.1|  PREDICTED: serine/threonine-protein kinase 1...  97.4    2e-20    Neolamprologus brichardi [lyretail cichlid]
ref|XP_011356864.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    
ref|XP_001493234.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    Equus caballus [domestic horse]
ref|XP_008823981.1|  PREDICTED: serine/threonine-protein kinase 1...  97.1    2e-20    Nannospalax galili
ref|XP_008823979.1|  PREDICTED: serine/threonine-protein kinase 1...  97.4    2e-20    Nannospalax galili
ref|XP_004662965.1|  PREDICTED: serine/threonine-protein kinase 16    97.4    2e-20    Jaculus jaculus
gb|EGW11867.1|  Serine/threonine-protein kinase 16                    95.9    2e-20    Cricetulus griseus [Chinese hamsters]
gb|EDL75404.1|  serine/threonine kinase 16, isoform CRA_b             95.9    2e-20    Rattus norvegicus [brown rat]
ref|XP_008402689.1|  PREDICTED: serine/threonine-protein kinase 16    97.1    3e-20    Poecilia reticulata
ref|XP_002749858.1|  PREDICTED: serine/threonine-protein kinase 1...  97.1    3e-20    Callithrix jacchus [common marmoset]
ref|XP_002712533.1|  PREDICTED: serine/threonine-protein kinase 16    97.1    3e-20    
ref|XP_008290775.1|  PREDICTED: serine/threonine-protein kinase 16    97.1    3e-20    Stegastes partitus
ref|XP_004876210.1|  PREDICTED: serine/threonine-protein kinase 1...  97.1    3e-20    
ref|XP_005935306.1|  PREDICTED: serine/threonine-protein kinase 1...  97.1    3e-20    Haplochromis burtoni
gb|AAQ02488.1|  serine/threonine kinase 16                            97.1    3e-20    synthetic construct
ref|XP_003272445.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  97.1    3e-20    Nomascus leucogenys [White-cheeked Gibbon]
emb|CAA06700.1|  PKL12 protein                                        97.1    3e-20    Homo sapiens [man]
gb|ACQ58215.1|  Serine/threonine-protein kinase 16                    96.7    3e-20    Anoplopoma fimbria
ref|XP_010358600.1|  PREDICTED: serine/threonine-protein kinase 16    96.7    3e-20    Rhinopithecus roxellana
gb|AAC28337.1|  myristilated and palmitylated serine-threonine ki...  96.7    3e-20    Homo sapiens [man]
ref|XP_003818698.1|  PREDICTED: serine/threonine-protein kinase 1...  96.7    3e-20    Pan paniscus [bonobo]
gb|AAH02618.1|  Serine/threonine kinase 16                            96.7    4e-20    Homo sapiens [man]
emb|CAA09387.1|  serine/threonine kinase                              96.7    4e-20    Homo sapiens [man]
ref|XP_001162451.1|  PREDICTED: serine/threonine-protein kinase 1...  96.7    4e-20    Pan troglodytes
ref|NP_001008910.1|  serine/threonine-protein kinase 16               96.7    4e-20    Homo sapiens [man]
dbj|BAF85383.1|  unnamed protein product                              96.7    4e-20    Homo sapiens [man]
ref|XP_005519774.1|  PREDICTED: serine/threonine-protein kinase 16    96.7    4e-20    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008467843.1|  PREDICTED: serine/threonine-protein kinase 16    96.7    5e-20    Diaphorina citri
ref|XP_007646375.1|  PREDICTED: serine/threonine-protein kinase 16    96.3    5e-20    Cricetulus griseus [Chinese hamsters]
ref|XP_004402801.1|  PREDICTED: serine/threonine-protein kinase 16    96.3    5e-20    Odobenus rosmarus divergens
ref|XP_003969924.1|  PREDICTED: serine/threonine-protein kinase 1...  96.3    5e-20    Takifugu rubripes [tiger puffer]
ref|XP_010334582.1|  PREDICTED: serine/threonine-protein kinase 1...  96.7    5e-20    Saimiri boliviensis boliviensis
ref|XP_006245222.1|  PREDICTED: serine/threonine-protein kinase 1...  95.9    6e-20    Rattus norvegicus [brown rat]
ref|XP_007956990.1|  PREDICTED: serine/threonine-protein kinase 16    95.9    6e-20    Orycteropus afer afer
ref|NP_775165.1|  serine/threonine-protein kinase 16                  95.9    6e-20    Rattus norvegicus [brown rat]
ref|XP_003925562.1|  PREDICTED: serine/threonine-protein kinase 1...  95.9    7e-20    Saimiri boliviensis boliviensis
ref|XP_005049571.1|  PREDICTED: serine/threonine-protein kinase 16    95.9    8e-20    Ficedula albicollis
ref|XP_006742950.1|  PREDICTED: serine/threonine-protein kinase 1...  95.9    8e-20    Leptonychotes weddellii
ref|XP_010884397.1|  PREDICTED: serine/threonine-protein kinase 16    95.5    8e-20    Esox lucius
ref|XP_004543459.1|  PREDICTED: serine/threonine-protein kinase 1...  95.5    9e-20    Maylandia zebra
ref|XP_006742949.1|  PREDICTED: serine/threonine-protein kinase 1...  95.5    1e-19    Leptonychotes weddellii
ref|XP_008308178.1|  PREDICTED: serine/threonine-protein kinase 16    95.5    1e-19    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005799781.1|  PREDICTED: serine/threonine-protein kinase 1...  95.5    1e-19    Xiphophorus maculatus
ref|XP_005485280.1|  PREDICTED: serine/threonine-protein kinase 1...  95.5    1e-19    Zonotrichia albicollis
ref|XP_004467828.1|  PREDICTED: serine/threonine-protein kinase 1...  95.1    1e-19    Dasypus novemcinctus
ref|XP_004467827.1|  PREDICTED: serine/threonine-protein kinase 1...  95.1    1e-19    Dasypus novemcinctus
ref|XP_009086158.1|  PREDICTED: serine/threonine-protein kinase 16    95.1    1e-19    Serinus canaria [canary]
ref|XP_010986671.1|  PREDICTED: serine/threonine-protein kinase 1...  94.7    1e-19    Camelus dromedarius [camel]
ref|XP_004005479.1|  PREDICTED: serine/threonine-protein kinase 16    95.1    1e-19    
dbj|BAG63548.1|  unnamed protein product                              94.0    1e-19    Homo sapiens [man]
gb|KFM72644.1|  Serine/threonine-protein kinase 16                    95.1    1e-19    Stegodyphus mimosarum
ref|XP_003377990.1|  serine/threonine-protein kinase 16               95.1    1e-19    Trichinella spiralis
ref|XP_004376394.1|  PREDICTED: serine/threonine-protein kinase 16    95.1    1e-19    Trichechus manatus latirostris
ref|XP_010947117.1|  PREDICTED: serine/threonine-protein kinase 1...  94.7    2e-19    Camelus bactrianus [camel]
ref|XP_006972221.1|  PREDICTED: serine/threonine-protein kinase 1...  94.7    2e-19    Peromyscus maniculatus bairdii
ref|XP_010986670.1|  PREDICTED: serine/threonine-protein kinase 1...  94.7    2e-19    Camelus dromedarius [camel]
ref|XP_005070530.1|  PREDICTED: serine/threonine-protein kinase 1...  94.7    2e-19    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006186928.1|  PREDICTED: serine/threonine-protein kinase 16    94.7    2e-19    Camelus ferus
gb|ACE87420.1|  serine/threonine kinase 16 protein                    94.7    2e-19    synthetic construct
ref|XP_006867895.1|  PREDICTED: serine/threonine-protein kinase 16    94.4    2e-19    Chrysochloris asiatica
ref|XP_003406100.1|  PREDICTED: serine/threonine-protein kinase 16    94.4    2e-19    Loxodonta africana [African bush elephant]
ref|XP_004617190.1|  PREDICTED: serine/threonine-protein kinase 16    94.4    3e-19    Sorex araneus [Eurasian shrew]
ref|XP_006207296.1|  PREDICTED: serine/threonine-protein kinase 16    94.0    3e-19    
ref|XP_005985203.1|  PREDICTED: serine/threonine-protein kinase 1...  94.0    3e-19    
ref|NP_001133526.1|  serine/threonine-protein kinase 16               94.0    4e-19    
gb|AAH05703.1|  Stk16 protein                                         92.8    5e-19    
gb|EDL00385.1|  serine/threonine kinase 16, isoform CRA_b             92.8    5e-19    
ref|XP_011397254.1|  Serine/threonine-protein kinase 16               94.0    5e-19    
ref|XP_006008957.1|  PREDICTED: serine/threonine-protein kinase 16    93.2    5e-19    
dbj|BAC27732.1|  unnamed protein product                              93.2    7e-19    
ref|XP_007908286.1|  PREDICTED: serine/threonine-protein kinase 16    93.2    7e-19    
ref|NP_035624.3|  serine/threonine-protein kinase 16                  92.8    7e-19    
ref|XP_006496525.1|  PREDICTED: serine/threonine-protein kinase 1...  92.8    7e-19    
ref|XP_005361649.1|  PREDICTED: serine/threonine-protein kinase 16    92.8    8e-19    
gb|AAD02811.1|  palmitylated serine/threonine kinase                  92.8    8e-19    
ref|XP_005202899.1|  PREDICTED: serine/threonine-protein kinase 1...  92.0    1e-18    
ref|NP_001039720.1|  serine/threonine-protein kinase 16               92.4    1e-18    
ref|XP_005889744.1|  PREDICTED: serine/threonine-protein kinase 16    92.4    1e-18    
ref|XP_010800638.1|  PREDICTED: serine/threonine-protein kinase 1...  92.4    1e-18    
ref|XP_004427642.1|  PREDICTED: serine/threonine-protein kinase 16    92.0    1e-18    
ref|XP_006059054.1|  PREDICTED: serine/threonine-protein kinase 1...  91.7    2e-18    
ref|XP_008868217.1|  NAK protein kinase, variant 1                    92.0    2e-18    
ref|XP_008868216.1|  NAK protein kinase                               92.0    2e-18    
ref|XP_004701680.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  92.0    2e-18    
pdb|2BUJ|A  Chain A, Crystal Structure Of The Human Serine-Threon...  91.7    2e-18    
ref|XP_006059051.1|  PREDICTED: serine/threonine-protein kinase 1...  91.7    2e-18    
ref|XP_008868218.1|  NAK protein kinase, variant 2                    91.7    2e-18    
dbj|BAC26947.1|  unnamed protein product                              91.3    2e-18    
ref|XP_002129344.2|  PREDICTED: serine/threonine-protein kinase 1...  90.9    4e-18    
ref|XP_006890368.1|  PREDICTED: serine/threonine-protein kinase 16    90.5    5e-18    
ref|XP_004942902.1|  PREDICTED: serine/threonine-protein kinase 1...  90.5    5e-18    
emb|CCA19548.1|  serine/threonine protein kinase putative             89.7    6e-18    
gb|ENN77639.1|  hypothetical protein YQE_05933                        90.1    7e-18    
gb|EPB91820.1|  NAK protein kinase                                    89.7    1e-17    
ref|XP_009909459.1|  PREDICTED: serine/threonine-protein kinase 16    89.0    1e-17    
dbj|BAA89499.1|  F5-2                                                 89.4    1e-17    
gb|KFV63390.1|  Serine/threonine-protein kinase 16                    89.0    1e-17    
dbj|BAA89662.1|  F5-2                                                 89.4    1e-17    
ref|XP_011297504.1|  PREDICTED: serine/threonine-protein kinase 16    89.0    2e-17    
ref|XP_003485183.1|  PREDICTED: serine/threonine-protein kinase 1...  88.6    2e-17    
gb|KHJ43806.1|  kinase domain protein                                 88.6    3e-17    
dbj|GAN07621.1|  pkinase-domain-containing protein                    88.6    3e-17    
emb|CCI44431.1|  unnamed protein product                              90.1    3e-17    
ref|XP_796127.2|  PREDICTED: serine/threonine-protein kinase 16-like  87.8    3e-17    
ref|XP_003341897.1|  PREDICTED: serine/threonine-protein kinase 1...  88.2    3e-17    
ref|XP_011175787.1|  PREDICTED: serine/threonine-protein kinase 1...  87.4    4e-17    
ref|XP_009840628.1|  NAK protein kinase                               88.2    4e-17    
gb|ERG84695.1|  cullin-1                                              91.3    5e-17    
ref|XP_010141236.1|  PREDICTED: serine/threonine-protein kinase 16    87.4    5e-17    
ref|XP_009840627.1|  NAK protein kinase, variant                      87.0    7e-17    
ref|XP_011175789.1|  PREDICTED: serine/threonine-protein kinase 1...  85.9    7e-17    
ref|XP_004942900.1|  PREDICTED: serine/threonine-protein kinase 1...  87.4    7e-17    
ref|XP_001880611.1|  predicted protein                                87.0    8e-17    
ref|XP_001231623.1|  PREDICTED: serine/threonine-protein kinase 1...  87.0    8e-17    
gb|KFV07253.1|  Serine/threonine-protein kinase 16                    86.7    8e-17    
ref|XP_009990823.1|  PREDICTED: serine/threonine-protein kinase 16    87.0    8e-17    
ref|XP_010712097.1|  PREDICTED: serine/threonine-protein kinase 16    86.3    9e-17    
gb|KFO09120.1|  Serine/threonine-protein kinase 16                    86.7    1e-16    
ref|XP_003708300.1|  PREDICTED: serine/threonine-protein kinase 1...  86.7    1e-16    
ref|XP_011255230.1|  PREDICTED: serine/threonine-protein kinase 16    86.7    1e-16    
ref|XP_010297114.1|  PREDICTED: serine/threonine-protein kinase 16    86.3    1e-16    
ref|XP_011175788.1|  PREDICTED: serine/threonine-protein kinase 1...  85.1    1e-16    
ref|XP_003400720.1|  PREDICTED: serine/threonine-protein kinase 1...  86.3    1e-16    
ref|XP_008921223.1|  PREDICTED: serine/threonine-protein kinase 16    86.3    2e-16    
gb|AEE60827.1|  serine/threonine kinase                               85.9    2e-16    
ref|XP_974511.1|  PREDICTED: serine/threonine-protein kinase 16       85.5    2e-16    
ref|XP_011496748.1|  PREDICTED: serine/threonine-protein kinase 16    85.5    3e-16    
gb|KFQ21980.1|  Serine/threonine-protein kinase 16                    85.1    3e-16    
ref|XP_010180444.1|  PREDICTED: serine/threonine-protein kinase 16    85.1    3e-16    
ref|NP_001017630.1|  serine/threonine-protein kinase 16               85.1    4e-16    
gb|KFW80140.1|  Serine/threonine-protein kinase 16                    84.7    5e-16    
gb|ETP44637.1|  NAK/MPSK protein kinase                               85.9    5e-16    
gb|ETP16556.1|  NAK/MPSK protein kinase                               85.9    5e-16    
gb|ETL40143.1|  NAK/MPSK protein kinase                               85.9    5e-16    
ref|XP_008905749.1|  NAK/MPSK protein kinase                          85.9    6e-16    
gb|ETI46798.1|  NAK/MPSK protein kinase                               85.9    7e-16    
gb|KHN76405.1|  Glycosyltransferase 25 family member                  87.0    7e-16    
gb|ETO75492.1|  NAK/MPSK protein kinase                               85.5    7e-16    
ref|XP_001605375.1|  PREDICTED: serine/threonine-protein kinase 16    84.3    7e-16    
gb|ETL93288.1|  NAK/MPSK protein kinase                               85.5    7e-16    
dbj|GAM19078.1|  hypothetical protein SAMD00019534_022530             87.0    8e-16    
gb|KFQ18225.1|  Serine/threonine-protein kinase 16                    84.0    8e-16    
ref|XP_008936789.1|  PREDICTED: serine/threonine-protein kinase 16    83.6    9e-16    
ref|XP_005447410.1|  PREDICTED: serine/threonine-protein kinase 1...  83.6    1e-15    
gb|KFU88495.1|  Serine/threonine-protein kinase 16                    83.6    1e-15    
dbj|GAN05866.1|  pkinase-domain-containing protein                    84.0    1e-15    
gb|KFO52754.1|  Serine/threonine-protein kinase 16                    83.2    1e-15    
ref|XP_009994572.1|  PREDICTED: serine/threonine-protein kinase 16    83.2    1e-15    
ref|XP_005234412.1|  PREDICTED: serine/threonine-protein kinase 16    83.6    1e-15    
ref|XP_008626944.1|  PREDICTED: serine/threonine-protein kinase 16    83.2    1e-15    
ref|XP_010405222.1|  PREDICTED: serine/threonine-protein kinase 16    83.2    2e-15    
ref|XP_009080397.1|  PREDICTED: serine/threonine-protein kinase 16    82.8    2e-15    
ref|XP_002195709.1|  PREDICTED: serine/threonine-protein kinase 16    83.2    2e-15    
ref|XP_010207916.1|  PREDICTED: serine/threonine-protein kinase 16    82.8    2e-15    
gb|EPB88470.1|  NAK protein kinase                                    83.2    2e-15    
gb|KFP03300.1|  Serine/threonine-protein kinase 16                    82.4    2e-15    
ref|XP_008543942.1|  PREDICTED: serine/threonine-protein kinase 16    82.8    3e-15    
ref|XP_005416123.1|  PREDICTED: serine/threonine-protein kinase 16    82.4    3e-15    
ref|XP_008495252.1|  PREDICTED: serine/threonine-protein kinase 16    82.4    3e-15    
emb|CCX16347.1|  Similar to Serine/threonine-protein kinase ppk13...  83.2    3e-15    
gb|KFQ05580.1|  Serine/threonine-protein kinase 16                    82.0    3e-15    
ref|XP_007582065.1|  putative serine threonine protein                83.6    3e-15    
ref|XP_011347895.1|  PREDICTED: serine/threonine-protein kinase 1...  82.4    3e-15    
gb|KFP21606.1|  Serine/threonine-protein kinase 16                    82.0    3e-15    
ref|XP_010582413.1|  PREDICTED: serine/threonine-protein kinase 16    82.0    3e-15    
gb|KFM04617.1|  Serine/threonine-protein kinase 16                    82.0    4e-15    
ref|XP_009643993.1|  PREDICTED: serine/threonine-protein kinase 16    82.0    4e-15    
gb|KJE97963.1|  NAK protein kinase                                    82.0    4e-15    
gb|KFP54820.1|  Serine/threonine-protein kinase 16                    81.6    4e-15    
ref|XP_009442628.1|  PREDICTED: serine/threonine-protein kinase 1...  82.0    4e-15    
ref|XP_009273290.1|  PREDICTED: serine/threonine-protein kinase 16    81.6    4e-15    
ref|XP_009460438.1|  PREDICTED: serine/threonine-protein kinase 16    82.4    4e-15    
gb|KFO72172.1|  Serine/threonine-protein kinase 16                    81.6    5e-15    
gb|KFQ94697.1|  Serine/threonine-protein kinase 16                    81.6    5e-15    
ref|XP_009943604.1|  PREDICTED: serine/threonine-protein kinase 1...  81.6    5e-15    
ref|XP_009960261.1|  PREDICTED: serine/threonine-protein kinase 16    82.4    5e-15    
gb|KGL86421.1|  Serine/threonine-protein kinase 16                    81.6    5e-15    
gb|KFR04467.1|  Serine/threonine-protein kinase 16                    81.6    5e-15    
dbj|GAM19899.1|  hypothetical protein SAMD00019534_030740             84.7    5e-15    
gb|KFQ84876.1|  Serine/threonine-protein kinase 16                    81.3    5e-15    
dbj|GAN03135.1|  Ser/Thr protein kinase                               82.0    5e-15    
ref|XP_001836285.1|  other/NAK protein kinase                         82.8    6e-15    
ref|XP_009882411.1|  PREDICTED: serine/threonine-protein kinase 16    81.3    6e-15    
ref|XP_009553933.1|  PREDICTED: serine/threonine-protein kinase 16    81.3    6e-15    
ref|XP_011049587.1|  PREDICTED: serine/threonine-protein kinase 1...  81.3    6e-15    
emb|CDJ81731.1|  Serine threonine protein kinase-related domain c...  81.3    7e-15    
ref|XP_011126760.1|  hypothetical protein AOL_s00188g210              82.4    7e-15    
ref|XP_009442627.1|  PREDICTED: serine/threonine-protein kinase 1...  82.8    7e-15    
gb|KFW67669.1|  Serine/threonine-protein kinase 16                    80.9    7e-15    
ref|XP_008970245.1|  PREDICTED: serine/threonine-protein kinase 1...  82.8    7e-15    
ref|XP_009323148.1|  PREDICTED: serine/threonine-protein kinase 16    81.3    7e-15    
ref|XP_641248.1|  hypothetical protein DDB_G0280111                   84.3    7e-15    
ref|XP_009159379.1|  serine/threonine kinase 16                       82.8    7e-15    
ref|XP_011049588.1|  PREDICTED: serine/threonine-protein kinase 1...  80.9    8e-15    
gb|EMC84229.1|  Serine/threonine-protein kinase 16                    80.9    9e-15    
gb|EPB88047.1|  NAK protein kinase                                    81.3    9e-15    
emb|CDJ96238.1|  Serine threonine protein kinase-related domain c...  80.9    9e-15    
ref|XP_005498658.1|  PREDICTED: serine/threonine-protein kinase 16    80.9    9e-15    
emb|CBN77951.1|  Serine/threonine protein kinase/TGF-beta stimula...  81.6    9e-15    
ref|XP_010022965.1|  PREDICTED: serine/threonine-protein kinase 16    80.5    9e-15    
ref|XP_011140914.1|  PREDICTED: serine/threonine-protein kinase 1...  80.9    1e-14    
ref|XP_011049586.1|  PREDICTED: serine/threonine-protein kinase 1...  80.9    1e-14    
gb|KIY43898.1|  kinase-like protein                                   81.3    1e-14    
ref|XP_011140913.1|  PREDICTED: serine/threonine-protein kinase 1...  80.9    1e-14    
tpg|DAA39533.1|  TPA: putative protein kinase superfamily protein     77.0    1e-14    
ref|XP_006679528.1|  hypothetical protein BATDEDRAFT_33346            81.6    1e-14    
ref|XP_004365225.2|  hypothetical protein CAOG_00354                  83.6    1e-14    
ref|XP_006135689.1|  PREDICTED: serine/threonine-protein kinase 16    80.5    1e-14    
gb|EHH21695.1|  hypothetical protein EGK_04819                        80.9    2e-14    
gb|EHH55185.1|  hypothetical protein EGM_04337                        80.9    2e-14    
ref|XP_777046.1|  hypothetical protein CNBB2780                       80.9    2e-14    
ref|XP_006616705.1|  PREDICTED: serine/threonine-protein kinase 1...  79.7    2e-14    
ref|XP_009181397.1|  PREDICTED: serine/threonine-protein kinase 16    79.7    3e-14    
ref|XP_009236419.1|  PREDICTED: serine/threonine-protein kinase 1...  80.9    3e-14    
ref|XP_005702234.1|  PREDICTED: serine/threonine-protein kinase 16    79.3    3e-14    
gb|EMP27432.1|  Serine/threonine-protein kinase 16                    79.7    3e-14    
ref|XP_006563128.1|  PREDICTED: serine/threonine-protein kinase 1...  79.7    3e-14    
emb|CCA71061.1|  related to Prk1p                                     81.3    3e-14    
gb|KHG26284.1|  Serine/threonine-protein kinase ppk13                 77.8    3e-14    
ref|XP_002676462.1|  predicted protein                                79.7    4e-14    
gb|AFR93303.2|  NAK protein kinase                                    80.1    4e-14    
ref|XP_003694450.1|  PREDICTED: serine/threonine-protein kinase 1...  79.3    4e-14    
gb|KGB74358.1|  NAK protein kinase                                    79.7    5e-14    
gb|EPY79421.1|  serine/threonine-protein kinase 16                    79.3    5e-14    
ref|XP_008614962.1|  NAK/MPSK protein kinase                          80.9    5e-14    
gb|KIR74195.1|  NAK protein kinase                                    79.7    5e-14    
gb|ERE86580.1|  serine/threonine-protein kinase 16-like protein       79.0    5e-14    
gb|KIR96896.1|  NAK protein kinase                                    79.7    5e-14    
emb|CCT66045.1|  related to Prk1p, and serine/threonine protein k...  80.1    5e-14    
gb|EWG43871.1|  NAK protein kinase                                    80.1    5e-14    
gb|KIR32493.1|  NAK protein kinase                                    79.7    5e-14    
gb|KIR24671.1|  NAK protein kinase                                    79.3    5e-14    
ref|XP_002592023.1|  hypothetical protein BRAFLDRAFT_114536           79.0    5e-14    
ref|XP_007068750.1|  PREDICTED: serine/threonine-protein kinase 16    79.7    5e-14    
ref|XP_010800641.1|  PREDICTED: serine/threonine-protein kinase 1...  79.0    6e-14    
gb|EGU89066.1|  hypothetical protein FOXB_00415                       79.7    6e-14    
ref|XP_007263188.1|  other/NAK protein kinase                         80.1    6e-14    
gb|KIL84301.1|  hypothetical protein FAVG1_12538                      79.7    6e-14    
gb|KDR07799.1|  Serine/threonine-protein kinase 16                    79.0    6e-14    
gb|EWC48059.1|  hypothetical protein DRE_02638                        79.3    6e-14    
gb|ERG82382.1|  ap2-associated protein kinase 1                       81.3    6e-14    
gb|KEQ83345.1|  kinase-like protein                                   79.7    6e-14    
gb|KDO28533.1|  NAK protein kinase                                    78.6    7e-14    
gb|KIX02735.1|  hypothetical protein Z518_08677                       80.1    7e-14    
ref|XP_008866641.1|  NAK/MPSK protein kinase, variant                 78.6    8e-14    
gb|KEQ67082.1|  kinase-like protein                                   79.3    8e-14    
gb|KDO23837.1|  NAK/MPSK protein kinase                               80.1    9e-14    
ref|XP_788316.3|  PREDICTED: cyclin-G-associated kinase-like          80.9    9e-14    
ref|XP_001636581.1|  predicted protein                                77.4    9e-14    
ref|XP_009832074.1|  NAK/MPSK protein kinase, variant                 78.2    9e-14    
ref|XP_002169756.2|  PREDICTED: probable ATP-dependent RNA helica...  80.5    9e-14    
ref|XP_010859537.1|  PREDICTED: serine/threonine-protein kinase 1...  77.8    1e-13    
gb|KFW04310.1|  Serine/threonine-protein kinase 16                    77.0    1e-13    
ref|XP_004335935.1|  protein kinase domain containing protein         80.1    1e-13    
ref|XP_008867074.1|  NAK protein kinase                               79.7    1e-13    
ref|XP_004355783.1|  putative protein serine/threonine kinase         80.5    1e-13    
ref|XP_011326486.1|  hypothetical protein FGSG_06832                  79.0    1e-13    
gb|EYB23207.1|  hypothetical protein FG05_06832                       79.0    1e-13    
ref|XP_007763588.1|  hypothetical protein CONPUDRAFT_134281           80.5    1e-13    
ref|XP_009832075.1|  NAK/MPSK protein kinase                          78.2    1e-13    
gb|KEY70585.1|  hypothetical protein S7711_02189                      76.6    1e-13    
gb|KIL64445.1|  hypothetical protein M378DRAFT_78338                  79.0    1e-13    
ref|XP_008866642.1|  NAK/MPSK protein kinase                          78.6    1e-13    
gb|ACO10919.1|  Serine/threonine-protein kinase 16                    77.8    1e-13    
ref|XP_009263226.1|  hypothetical protein FPSE_11834                  78.6    2e-13    
ref|XP_007501739.1|  PREDICTED: serine/threonine-protein kinase 1...  77.0    2e-13    
gb|EFA83040.1|  putative protein serine/threonine kinase              77.0    2e-13    
ref|XP_007004500.1|  hypothetical protein TREMEDRAFT_39060            77.8    2e-13    
dbj|GAA94070.1|  hypothetical protein E5Q_00717                       78.2    2e-13    
ref|XP_007362345.1|  Pkinase-domain-containing protein                78.6    2e-13    
ref|XP_569013.1|  serine/threonine-protein kinase                     77.4    3e-13    
ref|XP_009531486.1|  hypothetical protein PHYSODRAFT_367092           76.3    3e-13    
gb|KIW55799.1|  hypothetical protein PV05_04522                       78.2    3e-13    
gb|KIM33499.1|  hypothetical protein M408DRAFT_155596                 78.2    3e-13    
ref|XP_010148949.1|  PREDICTED: serine/threonine-protein kinase 16    75.5    3e-13    
gb|KFA61460.1|  hypothetical protein S40285_03432                     75.5    4e-13    
emb|CDH56229.1|  serine threonine protein                             77.4    4e-13    
ref|XP_006059053.1|  PREDICTED: serine/threonine-protein kinase 1...  76.3    4e-13    
ref|XP_002177071.1|  predicted protein                                76.6    4e-13    
gb|KIY50675.1|  kinase-like protein                                   76.3    4e-13    
emb|CDS09297.1|  hypothetical protein LRAMOSA10657                    77.4    4e-13    
gb|KIM36166.1|  hypothetical protein M413DRAFT_449359                 77.4    4e-13    
gb|KEQ91137.1|  hypothetical protein AUEXF2481DRAFT_70276             77.4    4e-13    



>ref|XP_006345079.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=342

 Score =   395 bits (1014),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++DP+ PGVSKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDPSNPGVSKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKD SH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLF+HPNLLPLLDHA+IAVKA   
Sbjct  61   FKDSSHISDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFTHPNLLPLLDHAIIAVKAGPD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QSWKHEAYLLFPVH+DGTLLDNATAMKAKKE FSTSDVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  QSWKHEAYLLFPVHLDGTLLDNATAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTH K QPPLA+LMDFGS RP
Sbjct  181  HNDVKPGNVLLTHSKEQPPLAVLMDFGSTRP  211



>ref|XP_004236087.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   392 bits (1008),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE+++DP+ PGVSKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVISDPSNPGVSKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKD SH SD+GTYAMKKVLIQNSEQL LVKEEIRVSSLF+HPNLLPLLDHA+IAVKA   
Sbjct  61   FKDSSHISDDGTYAMKKVLIQNSEQLALVKEEIRVSSLFTHPNLLPLLDHAIIAVKAGPD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QSWKHEAYLLFPVH+DGTLLDNAT MKAKKE FSTSDVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  QSWKHEAYLLFPVHLDGTLLDNATGMKAKKEFFSTSDVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHR+ QPPLA+LMDFGS RP
Sbjct  181  HNDVKPGNVLLTHRREQPPLAVLMDFGSTRP  211



>ref|XP_009766540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana sylvestris]
Length=342

 Score =   390 bits (1002),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 200/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++D + PG+S K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDTSNPGLSNK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKD SH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLF+H NLLPLLDHA+IAVKA+  
Sbjct  61   FKDSSHLSDDGTYAMKKVLIQNTEQLELVKEEIRVSSLFTHRNLLPLLDHAIIAVKAAPD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QSWKHEAYLLFPVH+DGTLLDNATAMKAKKE FSTSDVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  QSWKHEAYLLFPVHLDGTLLDNATAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLA+LMDFGS RP
Sbjct  181  HNDVKPGNVLLTHRKGQPPLAVLMDFGSTRP  211



>ref|XP_004241617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   388 bits (997),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLN LYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYV+LVKE+L+DP+ PG+SKK
Sbjct  1    MGCSISGLNGLYDAVNGGGDVWINENRFKIIRQLGEGGFAYVFLVKEVLSDPSNPGISKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKDPSH SD+GTYAMKKVLIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   FKDPSHISDDGTYAMKKVLIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIISVKVAQD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QS KHEAYLLFPVH+DGTLLDNA  M AKKE FSTSDVLQIFRQLCAGLKHMH+ +PSYA
Sbjct  121  QSLKHEAYLLFPVHLDGTLLDNAKTMNAKKEFFSTSDVLQIFRQLCAGLKHMHSLDPSYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  211



>ref|XP_009607782.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana tomentosiformis]
Length=342

 Score =   387 bits (994),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++D + PG+S K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDTSNPGLSNK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKD SH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLF+H NLLPLLDH +IAVKA+  
Sbjct  61   FKDSSHLSDDGTYAMKKVLIQNTEQLELVKEEIRVSSLFTHRNLLPLLDHGIIAVKAAPD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QSWKHEAYLLFPVH+DGTLLDNATAMKA KE FSTSDVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  QSWKHEAYLLFPVHLDGTLLDNATAMKANKEFFSTSDVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLA+LMDFGS RP
Sbjct  181  HNDVKPGNVLLTHRKGQPPLAVLMDFGSTRP  211



>ref|XP_011072928.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Sesamum indicum]
Length=344

 Score =   381 bits (979),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 200/213 (94%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFA+VYLVKE+L+DP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRILRQLGEGGFAFVYLVKELLSDPSNPADGIS  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            +K KDPSH S +GTYAMKKVLIQN+EQL+LV+EEIRVSS FSHPNLLPLLDHA+IAVKAS
Sbjct  61   RKIKDPSHVSGDGTYAMKKVLIQNNEQLELVREEIRVSSQFSHPNLLPLLDHAIIAVKAS  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            + QSWKHEAYLLFPVH+DGTLLDNA AMKAKKE FST+DVLQIFRQLCAGLKHMH+F+P 
Sbjct  121  QDQSWKHEAYLLFPVHLDGTLLDNAKAMKAKKEFFSTADVLQIFRQLCAGLKHMHSFDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+T+RKGQ PLA LMDFGSARP
Sbjct  181  YAHNDVKPGNVLVTYRKGQAPLATLMDFGSARP  213



>gb|EPS69990.1| hypothetical protein M569_04770 [Genlisea aurea]
Length=341

 Score =   380 bits (977),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE  ADP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKETPADPSDPAAGIS  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            +K KD +H S +GTYAMKK+LIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+IAVKAS
Sbjct  61   RKIKDSAHVSGDGTYAMKKILIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIIAVKAS  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            + QSWKHEAYLLFPVH+DGTLLDN+ AMKAKKE FSTSDVLQIFRQLCAGL+HMHNFEP 
Sbjct  121  QDQSWKHEAYLLFPVHLDGTLLDNSKAMKAKKEFFSTSDVLQIFRQLCAGLEHMHNFEPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHND+KPGNVL+T+RKG+PPLA LMDFGSARP
Sbjct  181  YAHNDIKPGNVLVTYRKGRPPLATLMDFGSARP  213



>ref|XP_008356645.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   378 bits (971),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 196/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQLCAGLKHMH F+P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKTKKEFFSTSDVLQIFRQLCAGLKHMHTFDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAILMDFGSARP  214



>ref|XP_008351873.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=271

 Score =   374 bits (960),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 195/214 (91%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH  +P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTLDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAILMDFGSARP  214



>ref|XP_006354740.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=339

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 196/211 (93%), Gaps = 3/211 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLN LYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYV+LVKE+L+DP   G+SKK
Sbjct  1    MGCSFSGLNGLYDAVNGGGDVWINENRFKIIRQLGEGGFAYVFLVKEVLSDP---GISKK  57

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            F+DPSH SD+GTYAMKKVLIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  58   FRDPSHISDDGTYAMKKVLIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIISVKVAQD  117

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QS KHEAYLLFPVH+DGTLLDNA  M AKKE FSTSDVLQIF QLCAGLKHMH+ +P YA
Sbjct  118  QSLKHEAYLLFPVHLDGTLLDNAKTMNAKKEFFSTSDVLQIFHQLCAGLKHMHSLDPPYA  177

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLAILMDFGSARP
Sbjct  178  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  208



>ref|XP_009337751.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 196/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH  +P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTLDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLA+LMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAMLMDFGSARP  214



>ref|XP_004299264.1| PREDICTED: serine/threonine-protein kinase 16 [Fragaria vesca 
subsp. vesca]
Length=343

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK-PGVSK  245
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFA+V+LVKE+++D +    ++ 
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAFVFLVKEVVSDSSSATSLAN  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            KFKD SH SD+GTYAMKKVLIQNSEQL+LVKEEI+VSSLF+HPNLLPLLDHA+I+VK ++
Sbjct  61   KFKDASHVSDDGTYAMKKVLIQNSEQLELVKEEIQVSSLFTHPNLLPLLDHAIISVKPTQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
             QSW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQLCAGLKHMHNFEP Y
Sbjct  121  DQSWNHEAYLLFPVHLDGTLLDNAKVMKTKKEFFSTSDVLQIFRQLCAGLKHMHNFEPPY  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHND+KPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  AHNDIKPGNVLITHRKGQPPLAILMDFGSARP  212



>gb|EYU19016.1| hypothetical protein MIMGU_mgv1a009372mg [Erythranthe guttata]
Length=344

 Score =   375 bits (963),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE+LADP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKELLADPSNPSNGIS  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
             K KD SH S +GTYAMKKVLIQNSEQL+LV+EEI VSS FSHPNLLPLLDHA+IAVKAS
Sbjct  61   SKIKDSSHVSVDGTYAMKKVLIQNSEQLELVREEIHVSSQFSHPNLLPLLDHAIIAVKAS  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            + Q+WKHEAYLLFPVH+DGTLLDN  AMK KKE FSTS VLQIFRQLCAGLKHMHN +P 
Sbjct  121  QEQTWKHEAYLLFPVHLDGTLLDNTKAMKDKKEFFSTSHVLQIFRQLCAGLKHMHNSDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVLLTHRKGQ PLA LMDFGSARP
Sbjct  181  YAHNDVKPGNVLLTHRKGQSPLATLMDFGSARP  213



>ref|XP_010678394.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Beta vulgaris subsp. vulgaris]
Length=344

 Score =   373 bits (958),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADP--AKPGVS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE++ D   A  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVTDASAASAGLS  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
             K KDPS  SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I VKA+
Sbjct  61   NKLKDPSFLSDDGTYAMKKVLIQNTEQLELVREEIRVSSLFNHPNLLPLLDHAIIKVKAT  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            + QSWKHEAYLLFPVH+DGTLLDN TAMKA+KE FST DVLQIFRQLCAGLKHMH+F+P 
Sbjct  121  QEQSWKHEAYLLFPVHLDGTLLDNTTAMKAQKEFFSTVDVLQIFRQLCAGLKHMHSFDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+ HRKGQ PLA+LMDFGSARP
Sbjct  181  YAHNDVKPGNVLIKHRKGQAPLAVLMDFGSARP  213



>ref|XP_008453331.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X3 
[Cucumis melo]
Length=288

 Score =   371 bits (953),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  236
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
             ++ +SW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQLCAGLKHMHNF+
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLDNAKTMKGKKEFFSTSDVLQIFRQLCAGLKHMHNFD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+T RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARP  215



>ref|XP_008360890.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   373 bits (958),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 195/214 (91%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH  +P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTLDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAILMDFGSARP  214



>ref|XP_007037718.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY22219.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
Length=271

 Score =   370 bits (950),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+TAMKAKKE FSTSDVLQIFRQLCAGLKHMH+ EP
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSTAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARP  214



>ref|XP_008367568.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   373 bits (957),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 195/214 (91%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH  +P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTLDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAILMDFGSARP  214



>ref|XP_009346448.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   373 bits (957),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 196/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSSSGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKD SH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDSSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH F+P
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTFDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQSPLAILMDFGSARP  214



>gb|KHG15042.1| Serine/threonine-protein kinase 16 [Gossypium arboreum]
Length=345

 Score =   372 bits (956),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 194/214 (91%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEVISDASSASSVGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+K 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AMKAKKE FSTSDVLQIFRQLCAGLKHMH   P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSNAMKAKKEFFSTSDVLQIFRQLCAGLKHMHGLVP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLT RKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTRRKGQAPLAILMDFGSARP  214



>ref|XP_007037719.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY22220.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
Length=279

 Score =   370 bits (949),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+TAMKAKKE FSTSDVLQIFRQLCAGLKHMH+ EP
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSTAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARP  214



>ref|XP_010031327.1| PREDICTED: serine/threonine-protein kinase 16 [Eucalyptus grandis]
 gb|KCW83786.1| hypothetical protein EUGRSUZ_B00658 [Eucalyptus grandis]
Length=345

 Score =   372 bits (954),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 195/214 (91%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFA+VYLVKE++ D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRILRQLGEGGFAFVYLVKEVVNDNSSVSGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTL DNA  MKAKKE FST+DVLQIFRQLCAGLKHMH+ EP
Sbjct  121  AQEGSWNHEAYLLFPVHLDGTLFDNAKVMKAKKEFFSTADVLQIFRQLCAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  214



>ref|XP_008453330.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cucumis melo]
Length=311

 Score =   370 bits (950),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  236
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
             ++ +SW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQLCAGLKHMHNF+
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLDNAKTMKGKKEFFSTSDVLQIFRQLCAGLKHMHNFD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+T RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARP  215



>ref|XP_007155191.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
 gb|ESW27185.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
Length=342

 Score =   371 bits (952),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VN GGD WIN+NRFRIVRQLGEGGFAYVYLVKE++ D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNNGGDAWINENRFRIVRQLGEGGFAYVYLVKELINDSAASGLANK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KD SH S++GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   LKDSSHVSEDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTQE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVHMDGTLLDNA  MK KKE +ST+DVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  TSWNHEAYLLFPVHMDGTLLDNAKVMKTKKEFYSTADVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKGQPPLAILMDFGSARP  211



>ref|XP_010099029.1| Serine/threonine-protein kinase 16 [Morus notabilis]
 gb|EXB76387.1| Serine/threonine-protein kinase 16 [Morus notabilis]
Length=345

 Score =   371 bits (952),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFAYV+LVKE++ D +  G  ++
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIIRQLGEGGFAYVFLVKEVVTDTSANGGGLA  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK KD SH SD+GTYAMKKVLIQNSEQL+LV+EEI VSSLF HPNLLPLLDHA+IAVKA+
Sbjct  61   KKVKDSSHLSDDGTYAMKKVLIQNSEQLELVREEIHVSSLFCHPNLLPLLDHAIIAVKAT  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +  SWKHEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVL IFRQLCAGLKHMHN +P 
Sbjct  121  QEGSWKHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLHIFRQLCAGLKHMHNLDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+THRKGQPPLAILMDFGS RP
Sbjct  181  YAHNDVKPGNVLITHRKGQPPLAILMDFGSTRP  213



>ref|XP_003609185.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES91382.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=342

 Score =   370 bits (951),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKE   D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRILRQLGEGGFAYVYLVKEAPNDSATGGLANK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KD SH +D+G+YAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   LKDSSHLADDGSYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTQE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIFRQLCAGLKHMHN +P YA
Sbjct  121  TSWSHEAYLLFPVHLDGTLLDNAKTMKAKKEHYSTSDVLQIFRQLCAGLKHMHNLDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKGQPPLAILMDFGSARP  211



>gb|KJB06908.1| hypothetical protein B456_001G066000 [Gossypium raimondii]
Length=345

 Score =   370 bits (951),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEVISDASSASSVGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+K 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AMKAKKE F TSDVLQIFRQLCAGLKHMH   P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSNAMKAKKEFFPTSDVLQIFRQLCAGLKHMHGLLP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLT RKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTRRKGQAPLAILMDFGSARP  214



>gb|ACU19230.1| unknown [Glycine max]
Length=230

 Score =   365 bits (938),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSK  245
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A   G+SK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKETPNDSAVAAGLSK  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK ++
Sbjct  61   KLKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIFRQLCAGLKHMH+F+P +
Sbjct  121  ETSWNHEAYLLFPVHLDGTLLDNAKIMKAKKEFYSTSDVLQIFRQLCAGLKHMHSFDPPH  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  AHNDVKPGNVLITHRKGQPPLAILMDFGSARP  212



>ref|XP_007037717.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY22218.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
Length=345

 Score =   370 bits (949),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+TAMKAKKE FSTSDVLQIFRQLCAGLKHMH+ EP
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSTAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARP  214



>ref|XP_008453329.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cucumis melo]
Length=346

 Score =   369 bits (948),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  236
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
             ++ +SW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQLCAGLKHMHNF+
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLDNAKTMKGKKEFFSTSDVLQIFRQLCAGLKHMHNFD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+T RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARP  215



>ref|XP_003524500.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Glycine max]
Length=342

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A  G++KK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEAPDDSAAAGLAKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK +  
Sbjct  61   LKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTHE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  TSWNHEAYLLFPVHLDGTLLDNAKIMKAKKEFYSTSDVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKGQPPLAILMDFGSARP  211



>ref|XP_004138208.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 ref|XP_004154941.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 gb|KGN63753.1| Serine/threonine protein kinase [Cucumis sativus]
Length=346

 Score =   369 bits (946),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  236
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKELLADTSSDAVQSG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            + KKFKD +H SD+G+YA+KKVLIQ +EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQTNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
             ++ +SW HEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMHNF+
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHNFD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+T RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARP  215



>ref|XP_007209310.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
 gb|EMJ10509.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
Length=345

 Score =   368 bits (945),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 197/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGC+FSGLNALYDAVNGGGDVWIN+ RF+IVRQLGEGGFAYV+LVKE+++D +  G   +
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINETRFKIVRQLGEGGFAYVFLVKEVVSDSSASGGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQ+CAGLKHMH+F+P
Sbjct  121  TQEASWNHEAYLLFPVHLDGTLLDNAKTMKTKKEFFSTSDVLQIFRQICAGLKHMHSFDP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLITHRKGQPPLAILMDFGSARP  214



>ref|XP_008240053.1| PREDICTED: serine/threonine-protein kinase 16 [Prunus mume]
Length=346

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  236
            MGC+FSGLNALYDAVNGGGDVWIN+ RF+IVRQLGEGGFAYV+LVKE+++D +  G    
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINETRFKIVRQLGEGGFAYVFLVKEVVSDSSASGGGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VK
Sbjct  61   LAKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
             ++  SW HEAYLLFPVH+DGTLLDNA  MK KKE FSTSDVLQIFRQ+CAGLKHMH+F+
Sbjct  121  PTQEASWNHEAYLLFPVHLDGTLLDNAKTMKTKKEFFSTSDVLQIFRQICAGLKHMHSFD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARP  215



>ref|XP_002512018.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50687.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=347

 Score =   368 bits (944),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 194/216 (90%), Gaps = 5/216 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP-----  233
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE+L           
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVLVTDTSAIAGGG  60

Query  234  GVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV  413
            G++KK KD SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+V
Sbjct  61   GLAKKVKDTSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISV  120

Query  414  KASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNF  593
            KA++  SW HEAYLLFPVH+DGTLLDN+ AMKAKKE FSTSDVLQIFRQLCAGLKHMH+ 
Sbjct  121  KANQEGSWNHEAYLLFPVHLDGTLLDNSKAMKAKKEFFSTSDVLQIFRQLCAGLKHMHSL  180

Query  594  EPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            +P YAHNDVKPGN+LLT RKGQPPLAILMDFGSARP
Sbjct  181  DPPYAHNDVKPGNILLTRRKGQPPLAILMDFGSARP  216



>ref|XP_009597332.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   368 bits (944),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI++QLGEGG   V++VKEI++DP+ PG SKK
Sbjct  1    MGCSFSGLNALYDGANGGGDVWINENRFRILKQLGEGGLDNVFIVKEIISDPSNPGFSKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKDPS  SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKA++ 
Sbjct  61   FKDPSLVSDDGTYAMKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKATQD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            Q  KHEAYLLFPVH+DGTLLDNA  MKAKKE FSTS+VLQIFRQLCAGLKHMHNF+P YA
Sbjct  121  QPKKHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSEVLQIFRQLCAGLKHMHNFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKP NVLLTHRKGQ PLA LMDFG+ARP
Sbjct  181  HNDVKPANVLLTHRKGQTPLAKLMDFGNARP  211



>emb|CDY21515.1| BnaC09g47770D [Brassica napus]
Length=343

 Score =   368 bits (944),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+VYLVKEI+AD +  G++KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVYLVKEIVADASGGGLAKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPSH S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +G
Sbjct  61   VKDPSHISADGTYAVKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQG  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             + KHEA+LLFPVH+DGTLLDN+T+MKAKKESFST+DVL IFRQLC GLKHMH+ EP YA
Sbjct  121  GARKHEAFLLFPVHLDGTLLDNSTSMKAKKESFSTADVLHIFRQLCDGLKHMHSLEPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLLTRRKGQPPLAILMDFGSARP  211



>ref|XP_010522295.1| PREDICTED: serine/threonine-protein kinase 16-like [Tarenaya 
hassleriana]
Length=349

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+VYLVKE + D +      G
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVYLVKETVTDASAAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK
Sbjct  61   MAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN TAMKAKKESFST+DVLQIFRQLC GLKHMH+ +
Sbjct  121  DGQEGTWKHEAFLLFPVHLDGTLLDNFTAMKAKKESFSTTDVLQIFRQLCDGLKHMHSMD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  215



>emb|CDO98513.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   367 bits (941),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEI-LADPAK-PGVS  242
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR++RQLGEGGFAYVYLVKEI  +DP+   G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVIRQLGEGGFAYVYLVKEIPSSDPSSNAGLS  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA-  419
            KK K+ SH S++GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+KA 
Sbjct  61   KKCKNSSHLSEDGTYAMKKVLIQNTEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKAP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++ QSWKHEAYLLFPVH+DGTL+DN+  MKAKKE FSTSDVLQIF QLCAGLKHMHNFEP
Sbjct  121  TQDQSWKHEAYLLFPVHLDGTLMDNSKTMKAKKEFFSTSDVLQIFHQLCAGLKHMHNFEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVK GNVLLTHRKGQ PLAILMDFGSARP
Sbjct  181  PYAHNDVKAGNVLLTHRKGQAPLAILMDFGSARP  214



>gb|KJB19472.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
 gb|KJB19473.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=240

 Score =   362 bits (928),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AM ++KE FS SDVLQIFRQLCAGLKHMHN  P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSKAMTSRKEFFSASDVLQIFRQLCAGLKHMHNLGP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARP  214



>gb|KFK25181.1| hypothetical protein AALP_AA8G077200 [Arabis alpina]
Length=348

 Score =   365 bits (937),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 195/215 (91%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDNAT+MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNATSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>dbj|BAJ53163.1| JHL10I11.9 [Jatropha curcas]
 gb|KDP20046.1| hypothetical protein JCGZ_05815 [Jatropha curcas]
Length=350

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 193/219 (88%), Gaps = 8/219 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  236
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++ D +       
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVTDSSASTGGGV  60

Query  237  ----VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  404
                ++KK KD SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+
Sbjct  61   AGGGLAKKVKDTSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAI  120

Query  405  IAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHM  584
            IAVK ++  SW HEAYLLFPVH+DGTLLDN+ AMKAKKE FSTSD+LQIFRQLCAGLKHM
Sbjct  121  IAVKNNQEGSWNHEAYLLFPVHLDGTLLDNSKAMKAKKEFFSTSDILQIFRQLCAGLKHM  180

Query  585  HNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            H+  P YAHNDVKPGNVLLTHRKGQ PLAILMDFGSARP
Sbjct  181  HSLNPPYAHNDVKPGNVLLTHRKGQSPLAILMDFGSARP  219



>ref|XP_006600612.1| PREDICTED: serine/threonine-protein kinase 16 [Glycine max]
 gb|KHN18398.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=343

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSK  245
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A   G+SK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKETPNDSAVAAGLSK  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK ++
Sbjct  61   KLKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIFRQLCAGLKHMH+F+P +
Sbjct  121  ETSWNHEAYLLFPVHLDGTLLDNAKIMKAKKEFYSTSDVLQIFRQLCAGLKHMHSFDPPH  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  AHNDVKPGNVLITHRKGQPPLAILMDFGSARP  212



>ref|XP_002269355.1| PREDICTED: serine/threonine-protein kinase 16 [Vitis vinifera]
 emb|CBI15371.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 1/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVR LGEGGFAYV+LVKE++ D +    SKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRPLGEGGFAYVFLVKEVVTDSSS-SASKK  59

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  + 
Sbjct  60   FKDPSHVSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQE  119

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             +WKHEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH+ EP YA
Sbjct  120  GAWKHEAYLLFPVHLDGTLLDNANVMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLEPPYA  179

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLA+LMDFGSARP
Sbjct  180  HNDVKPGNVLLTHRKGQPPLAVLMDFGSARP  210



>ref|XP_006399302.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
 gb|ESQ40755.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
Length=347

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 195/215 (91%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN+T+MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNSTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>gb|KJB19471.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=255

 Score =   360 bits (925),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK---PGV  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AM ++KE FS SDVLQIFRQLCAGLKHMHN  P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSKAMTSRKEFFSASDVLQIFRQLCAGLKHMHNLGP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARP  214



>ref|XP_004508637.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cicer arietinum]
 ref|XP_004508638.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cicer arietinum]
Length=342

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALY +VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKE+  + A  G++ K
Sbjct  1    MGCSFSGLNALYTSVNGGGDVWINENRFRILRQLGEGGFAYVYLVKELPNESATGGLANK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KD SH SD+G+YAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK +  
Sbjct  61   IKDSSHISDDGSYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTPE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLDNA  MKAKKE ++TSDVLQIFRQLCAGLKHMH+ +P YA
Sbjct  121  TSWSHEAYLLFPVHLDGTLLDNAKTMKAKKEHYTTSDVLQIFRQLCAGLKHMHSLDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRK QPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKEQPPLAILMDFGSARP  211



>emb|CDX69971.1| BnaA10g23200D [Brassica napus]
Length=343

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI++D +  G++KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVSDASAGGLAKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPSH S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +G
Sbjct  61   VKDPSHLSVDGTYAVKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQG  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             + KHEA+LLFPVH+DGTLLDN+T+MKAKKESFST+DVL IFRQLC GLKHMH+ EP YA
Sbjct  121  GARKHEAFLLFPVHLDGTLLDNSTSMKAKKESFSTADVLHIFRQLCDGLKHMHSLEPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLT R GQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLLTRRTGQPPLAILMDFGSARP  211



>gb|KJB19474.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=271

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AM ++KE FS SDVLQIFRQLCAGLKHMHN  P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSKAMTSRKEFFSASDVLQIFRQLCAGLKHMHNLGP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARP  214



>ref|XP_010423128.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 195/215 (91%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADP---AKPG-  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD    A PG 
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADAPSAASPGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T+MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>gb|ABK92466.1| unknown [Populus trichocarpa]
Length=350

 Score =   362 bits (930),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 195/219 (89%), Gaps = 8/219 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  224
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASAPASGGGA  60

Query  225  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  404
               G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   VAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  405  IAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHM  584
            IAVKA++  SW HEAYLLFPVH+DGTLLDN+TAMKAKKE FST+DVLQIFRQLCAGLKHM
Sbjct  121  IAVKATQEGSWNHEAYLLFPVHLDGTLLDNSTAMKAKKEFFSTTDVLQIFRQLCAGLKHM  180

Query  585  HNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNF+PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARP
Sbjct  181  HNFDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARP  219



>gb|KDO65614.1| hypothetical protein CISIN_1g024842mg [Citrus sinensis]
Length=262

 Score =   359 bits (921),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 191/214 (89%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  239
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SWKHEAYLLFPVH+DGTLLD+A  M+ KKE FSTSDVLQIF Q+CAGLKHMH+ EP
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLDHAKVMQTKKEFFSTSDVLQIFYQICAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGN+L+T RKGQPPLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNILITCRKGQPPLAILMDFGSARP  214



>ref|NP_196433.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AAG40409.1|AF325057_1 AT5g08160 [Arabidopsis thaliana]
 gb|AAB69123.1| serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAB93717.1| serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN60359.1| unknown [Arabidopsis thaliana]
 gb|ABF18990.1| At5g08160 [Arabidopsis thaliana]
 gb|AED91259.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=347

 Score =   362 bits (929),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 193/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>ref|XP_006440851.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54091.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=269

 Score =   359 bits (922),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 191/214 (89%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  239
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SWKHEAYLLFPVH+DGTLLD+A  M+ KKE FSTSDVLQIF Q+CAGLKHMH+ EP
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLDHAKVMQTKKEFFSTSDVLQIFYQICAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGN+L+T RKGQPPLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNILITCRKGQPPLAILMDFGSARP  214



>emb|CAN66918.1| hypothetical protein VITISV_043041 [Vitis vinifera]
Length=341

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRF IVR LGEGGFAYV+LVKE++ D +    SKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFXIVRPLGEGGFAYVFLVKEVVTDSSS-SASKK  59

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
            FKDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  + 
Sbjct  60   FKDPSHVSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQE  119

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             +WKHEAYLLFPVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH+ EP YA
Sbjct  120  GAWKHEAYLLFPVHLDGTLLDNANVMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLEPPYA  179

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQPPLA+LMDFGSARP
Sbjct  180  HNDVKPGNVLLTHRKGQPPLAVLMDFGSARP  210



>ref|XP_009798655.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
sylvestris]
Length=343

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI++QLGEGG   V++VKEI++DP+ P  SKK
Sbjct  1    MGCSFSGLNALYDGANGGGDVWINENRFRILKQLGEGGLDNVFIVKEIISDPSIPSFSKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPS  SD+GTYAMKKV+IQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  61   LKDPSLVSDDGTYAMKKVIIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            Q  KHEAYLLFPVH+DGTLLDNA  MKAKKE FSTS+VLQIFRQLCAGLKHMHNF+P YA
Sbjct  121  QPKKHEAYLLFPVHLDGTLLDNAKTMKAKKEFFSTSEVLQIFRQLCAGLKHMHNFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKP NVLLTH+KGQ PLA LMDFG+ARP
Sbjct  181  HNDVKPANVLLTHKKGQTPLAKLMDFGNARP  211



>ref|XP_009131040.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brassica rapa]
Length=345

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+VYLVKEI+AD +  G ++K
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVYLVKEIVADASSGGGLAK  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
               WKHEA+LLFPVH+DGTLLDN+T+MKAKKE+FST+DVL IFRQLC GLKHMH+ +P Y
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLDNSTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLDPPY  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  AHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  212



>ref|XP_002873344.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49603.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 193/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK K+P+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKNPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>gb|AAM65833.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=347

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 193/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAH+DVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHDDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>ref|XP_010257846.1| PREDICTED: serine/threonine-protein kinase 16 [Nelumbo nucifera]
Length=344

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 192/215 (89%), Gaps = 6/215 (3%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  236
            MGCSFSGLNALYD VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKEI+ D A  G    
Sbjct  1    MGCSFSGLNALYDVVNGGGDVWINENRFRILRQLGEGGFAYVYLVKEIVKDVATDGGVGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDPS  SD+GTYAMKKVLIQ SEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+  
Sbjct  61   IAKKVKDPSFVSDDGTYAMKKVLIQTSEQLELVREEIRVSSLFSHPNLLPLLDHAIIS--  118

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
            A++  S  HEAYLLFPVH+DGTLLDNA AMKAKKE FST DVLQIFRQLCAGLKHMH++E
Sbjct  119  ATQEGSGNHEAYLLFPVHLDGTLLDNAKAMKAKKEFFSTIDVLQIFRQLCAGLKHMHSYE  178

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  179  PPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  213



>ref|XP_006374373.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
 gb|ERP52170.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
Length=350

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 194/219 (89%), Gaps = 8/219 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  224
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASAPASGGGA  60

Query  225  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  404
               G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   VAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  405  IAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHM  584
            IAVKA++  SW HEAYLLFPVH+DGTLLDN+TAMKAKKE FST+DVLQIFRQLCAGLKHM
Sbjct  121  IAVKATQEGSWNHEAYLLFPVHLDGTLLDNSTAMKAKKEFFSTTDVLQIFRQLCAGLKHM  180

Query  585  HNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HN +PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARP
Sbjct  181  HNLDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARP  219



>gb|KJB19470.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=345

 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN+ AM ++KE FS SDVLQIFRQLCAGLKHMHN  P
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNSKAMTSRKEFFSASDVLQIFRQLCAGLKHMHNLGP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARP  214



>emb|CDY67889.1| BnaAnng25480D [Brassica napus]
Length=345

 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++K
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAK  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
               WKHEA+LLFPVH+DGTLLDN+T+MKAKKE+FST+DVL IFRQLC GLKHMH+ +P Y
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLDNSTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLDPPY  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  AHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  212



>ref|XP_006485732.1| PREDICTED: serine/threonine-protein kinase 16-like [Citrus sinensis]
Length=349

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 193/214 (90%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  239
            MGCSFSGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE++   A  A  G+
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKEMVTTDASAASGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SWKHEAYLLFPVH+DGTLLD+A  M+ KKE FSTSDVLQIF Q+CAGLKHMH+ EP
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLDHAKVMQTKKEFFSTSDVLQIFYQICAGLKHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGN+L+T RKGQPPLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNILITRRKGQPPLAILMDFGSARP  214



>ref|XP_010491440.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 193/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADP----AKPG  236
            MGCSFSGLNALYDAVNGG DVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD     +  G
Sbjct  1    MGCSFSGLNALYDAVNGGADVWINENRFRVVRQLGEGGFAFVFLVKEIVADAPSAASAGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAIKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T+MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>ref|XP_006288089.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
 gb|EOA20987.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
Length=347

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSATSGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T MKAKK+ FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTLMKAKKDIFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>ref|XP_010452793.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASAGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
              +  +WKHEA+LLFPVH+DGTLLDN T+MKAKKE+FST+DVL IFRQLC GLKHMH+ E
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLDNFTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  215



>ref|XP_006844169.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
 gb|ERN05844.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
Length=338

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 188/211 (89%), Gaps = 4/211 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NR+RI+RQLGEGGFA+VYLVKE++A+    G  KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRYRIIRQLGEGGFAFVYLVKEVVAE----GSVKK  56

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPSH SDNG YA+KKVLIQ  EQL+LV++EIRVSSLFSHPNLLPLLDHA+IAVK ++ 
Sbjct  57   LKDPSHISDNGMYAVKKVLIQTPEQLELVRQEIRVSSLFSHPNLLPLLDHAIIAVKGTQE  116

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLD A AMK KKE F T  VLQIF+QLCAGLKHMHNFEP+YA
Sbjct  117  GSWNHEAYLLFPVHLDGTLLDRAKAMKEKKEFFPTLTVLQIFQQLCAGLKHMHNFEPAYA  176

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+T+RKGQPPLAILMDFGSA P
Sbjct  177  HNDVKPGNVLITNRKGQPPLAILMDFGSAGP  207



>ref|XP_010261723.1| PREDICTED: serine/threonine-protein kinase 16-like [Nelumbo nucifera]
Length=346

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 190/215 (88%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  236
            MGCSFSGLNALYDAVNGG DVWINDNRF+I+RQLGEGGF+YVYLVKE++ D A  G    
Sbjct  1    MGCSFSGLNALYDAVNGGEDVWINDNRFKILRQLGEGGFSYVYLVKEVVEDVAGDGGGGG  60

Query  237  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
            + KK KD S  SD+GTYAMKKVLIQ +EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK
Sbjct  61   IRKKIKDSSFVSDDGTYAMKKVLIQTNEQLELVREEIRVSSLFSHPNLLPLLDHAIIQVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
            A++ +SW  EAYLLFPVH+DGTLLDNA AMK KKE FST DVLQIFRQLCAGLKHMHNFE
Sbjct  121  ATQERSWNSEAYLLFPVHLDGTLLDNAKAMKEKKEFFSTIDVLQIFRQLCAGLKHMHNFE  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHND+KPGNVL+THRKGQ PLAILMDFGSA+P
Sbjct  181  PPYAHNDLKPGNVLITHRKGQSPLAILMDFGSAQP  215



>emb|CDY70989.1| BnaC03g71390D [Brassica napus]
Length=344

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI++D +  G ++ 
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVSDASSGGGLAN  60

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
               WKHEA+LLFPVH+DGTLLDN+T+MKAKKE+FST+DVL IFRQLC GLKHMH+ +P Y
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLDNSTSMKAKKETFSTTDVLHIFRQLCDGLKHMHSLDPPY  180

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  181  AHNDVKPGNVLLTRRKGQPPLAILMDFGSARP  212



>ref|XP_002317918.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
 gb|EEE96138.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
Length=352

 Score =   355 bits (910),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 193/221 (87%), Gaps = 10/221 (5%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--ADPAKPG--  236
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++  + PA  G  
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVNVSSPASSGGR  60

Query  237  ------VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDH  398
                  +SKK KD SH S +GTYAMKKVLIQN+EQL+ V+EEIRVSSLF+H NLLPLLDH
Sbjct  61   AAVGGGLSKKVKDKSHLSVDGTYAMKKVLIQNNEQLEFVREEIRVSSLFNHSNLLPLLDH  120

Query  399  AVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLK  578
            A+I+VKA++  SW HEAYLLFPVH+DGTLLDN+ AMK+KKE FST+DVLQIFRQLCAGLK
Sbjct  121  AIISVKATQEGSWNHEAYLLFPVHLDGTLLDNSAAMKSKKEFFSTTDVLQIFRQLCAGLK  180

Query  579  HMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            +MHN +P YAHNDVKPGNVLLTHRKG  PLAILMDFGSARP
Sbjct  181  NMHNLDPPYAHNDVKPGNVLLTHRKGHSPLAILMDFGSARP  221



>ref|XP_011011304.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=350

 Score =   355 bits (910),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 192/219 (88%), Gaps = 8/219 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  224
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASSPASGGGA  60

Query  225  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  404
            A  G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   AAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  405  IAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHM  584
            IAVKA++  SW HE YLLFPVH+DGTLLDN+TAMK  KE FST+DVLQIFRQLCAGLKHM
Sbjct  121  IAVKATQEGSWNHEGYLLFPVHLDGTLLDNSTAMKTNKEFFSTTDVLQIFRQLCAGLKHM  180

Query  585  HNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HN +PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARP
Sbjct  181  HNLDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARP  219



>gb|AIZ68208.1| Serine/threonine-protein kinase 16 [Ornithogalum saundersiae]
Length=341

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 191/212 (90%), Gaps = 3/212 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  245
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYVYLVKE+++D    G++ K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKILRQLGEGGFAYVYLVKEVVSDGG--GIAGK  58

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K K+PSH SD+GTYAMKKVLIQ+ EQL LV+EEI VSSLFSHPNLLPLLDHA+IAVK ++
Sbjct  59   KIKNPSHISDDGTYAMKKVLIQSEEQLALVREEIHVSSLFSHPNLLPLLDHAIIAVKDNQ  118

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              SW+HEAYLLFPVH+DGTLLDNA  M+ KKE + T  VL IFRQLCAGLKHMHNF+PSY
Sbjct  119  QGSWRHEAYLLFPVHLDGTLLDNANTMQTKKEFYPTLTVLLIFRQLCAGLKHMHNFDPSY  178

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVL+THRKGQPP+AILMDFGSARP
Sbjct  179  AHNDVKPGNVLITHRKGQPPVAILMDFGSARP  210



>ref|XP_009125719.1| PREDICTED: serine/threonine-protein kinase 16-like [Brassica 
rapa]
 emb|CDY40762.1| BnaAnng06250D [Brassica napus]
Length=342

 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 191/212 (90%), Gaps = 3/212 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCSFSGLNALYD+  GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++ 
Sbjct  1    MGCSFSGLNALYDS--GGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAS  58

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K KDP+H SD+GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  59   KVKDPAHLSDDGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIIPVKGGQ  118

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              + KHEA+LLFPVH+DGTLLDN+TAMKAKKE+FST+DVLQIFRQLC GLKHMH+ EP Y
Sbjct  119  EGAGKHEAFLLFPVHLDGTLLDNSTAMKAKKETFSTTDVLQIFRQLCDGLKHMHSLEPPY  178

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVLLT RKGQ PLAILMDFGSARP
Sbjct  179  AHNDVKPGNVLLTRRKGQTPLAILMDFGSARP  210



>gb|KJB51100.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
 gb|KJB51101.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
Length=345

 Score =   352 bits (904),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 189/214 (88%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK---PGV  239
            MGC+FSG NA+YDA NGGGDVWIND RF+IVRQLGEGGFAYVYLVKE+ +D +     G+
Sbjct  1    MGCTFSGFNAMYDAANGGGDVWINDIRFKIVRQLGEGGFAYVYLVKEVTSDSSSISAGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSH NLLPLLDHA+I+VK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHHNLLPLLDHAIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN  AM AK + FSTSDVLQIFRQLCAGL+HMH+ EP
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNFKAMSAKNDFFSTSDVLQIFRQLCAGLEHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHND+KPGNVLLTHRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDIKPGNVLLTHRKGESPLAILMDFGSARP  214



>ref|XP_009415450.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLN+ YDAVNG GDVWIN+NRFRIVRQLGEGGFA+V+LVKE++AD A     KK
Sbjct  1    MGCSFSGLNSFYDAVNGAGDVWINENRFRIVRQLGEGGFAFVFLVKEVVADGAAGLARKK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              +PSH SD+GTYAMKKV+IQ  EQL++VK+EIRVSSLFSHPNLLPLLDHA+I VK +  
Sbjct  61   SINPSHVSDDGTYAMKKVIIQTEEQLEMVKQEIRVSSLFSHPNLLPLLDHAIIPVKGTHD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             S KHEAYLLFPVH+DGTLLD AT M++KKE+F+T+ VLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  ISRKHEAYLLFPVHLDGTLLDIATIMQSKKENFTTTTVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKGQPPLAILMDFGSARP  211



>ref|XP_011005497.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
 ref|XP_011005498.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=354

 Score =   350 bits (899),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 193/223 (87%), Gaps = 12/223 (5%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL-----------  215
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVNVSPPASSSSG  60

Query  216  -ADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLL  392
             A     G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLL
Sbjct  61   GAAAVSGGLSKKVKDKSHLSVDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLL  120

Query  393  DHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAG  572
            DHA+I+VKA++  SW HEAYLLFPVH+DGTLLDN+ AMK+KKE FST+DVLQIFRQLCAG
Sbjct  121  DHAIISVKATQEGSWNHEAYLLFPVHLDGTLLDNSAAMKSKKEFFSTTDVLQIFRQLCAG  180

Query  573  LKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            LK+MHN +P YAHNDVKPGNVLLTHR+G+ PLAILMDFGSARP
Sbjct  181  LKNMHNLDPPYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARP  223



>emb|CDY44759.1| BnaC02g01280D [Brassica napus]
Length=342

 Score =   350 bits (898),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 190/212 (90%), Gaps = 3/212 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCSFSGLNALYD+  GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++ 
Sbjct  1    MGCSFSGLNALYDS--GGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAS  58

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  59   KVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIIPVKGGQ  118

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              + KHEA+LLFPVH+DGTLLDN+TAMKAKKE+FST+DVLQIFRQLC GLKHMH+ EP Y
Sbjct  119  EGAGKHEAFLLFPVHLDGTLLDNSTAMKAKKETFSTTDVLQIFRQLCDGLKHMHSLEPPY  178

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVLLT RKGQ PLAILMDFGSARP
Sbjct  179  AHNDVKPGNVLLTRRKGQTPLAILMDFGSARP  210



>ref|XP_008393382.1| PREDICTED: serine/threonine-protein kinase 16, partial [Malus 
domestica]
Length=331

 Score =   349 bits (896),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 183/200 (92%), Gaps = 3/200 (2%)
 Frame = +3

Query  111  VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---VSKKFKDPSHASDNG  281
            VNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   ++KKFKDPSH SD+G
Sbjct  1    VNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGLAKKFKDPSHVSDDG  60

Query  282  TYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLF  461
            TYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK ++ QSW HEAYLLF
Sbjct  61   TYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKTTQEQSWNHEAYLLF  120

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            PVH+DGTLLDNA  MKAKKE FSTSDVLQIFRQLCAGLKHMH  +P YAHND+KPGNVL+
Sbjct  121  PVHLDGTLLDNAKTMKAKKEFFSTSDVLQIFRQLCAGLKHMHTLDPPYAHNDIKPGNVLI  180

Query  642  THRKGQPPLAILMDFGSARP  701
            THRKGQ PLAILMDFGSARP
Sbjct  181  THRKGQSPLAILMDFGSARP  200



>ref|XP_010547731.1| PREDICTED: serine/threonine-protein kinase 16 [Tarenaya hassleriana]
Length=349

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 188/215 (87%), Gaps = 4/215 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS--  242
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFA+VYLVKEI AD +       
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAFVYLVKEIAADASAAAAGGG  60

Query  243  --KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  416
              KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+++VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIVSVK  120

Query  417  ASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFE  596
            A +  SWKHEA+LLFPVH++GTLLDN TAMKAKKESFST DVL IF QLC GLKHMH+ +
Sbjct  121  AGQEGSWKHEAFLLFPVHLEGTLLDNFTAMKAKKESFSTIDVLHIFHQLCDGLKHMHSLD  180

Query  597  PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            P YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP
Sbjct  181  PPYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  215



>ref|XP_009396202.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNA YDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++AD A      K
Sbjct  1    MGCSFSGLNAFYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVADGAAGLARNK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              DPSH SD+GTYAMKKV+IQ  EQL+LVK+EIRVSSLF+HPNLLPLLDH VI VK ++ 
Sbjct  61   SIDPSHISDHGTYAMKKVIIQTEEQLELVKQEIRVSSLFNHPNLLPLLDHVVIPVKGTQD  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             S KHEAYLLFPVH+DGTLLD A  M++KKE F+T+ VLQIFRQLCAGLKHMH+F+P YA
Sbjct  121  GSRKHEAYLLFPVHLDGTLLDIAKVMQSKKEFFTTTTVLQIFRQLCAGLKHMHSFDPPYA  180

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQPP AILMDFGSARP
Sbjct  181  HNDVKPGNVLITHRKGQPPGAILMDFGSARP  211



>ref|NP_001267650.1| serine/threonine-protein kinase 16-like [Cucumis sativus]
 ref|XP_004157430.1| PREDICTED: serine/threonine-protein kinase 16-like [Cucumis sativus]
 emb|CAI30891.1| somatic embryogenesis serine-threonine protein kinase 1 [Cucumis 
sativus]
 gb|KGN64092.1| hypothetical protein Csa_1G041540 [Cucumis sativus]
Length=344

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 193/214 (90%), Gaps = 4/214 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE+++D + P    +
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVSDSSSPSGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPS  S +GTYA+KKVLIQ+SEQL+LV+EEIR+SSLFSHPNLLPLLDHA+IAVK+
Sbjct  61   AKKLKDPSRLSGDGTYALKKVLIQSSEQLELVREEIRISSLFSHPNLLPLLDHAIIAVKS  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            SEG S KHEAYLLFPVH+DGTLLDNA  MKAKKE FST DVL+IFRQLCAGLKHMH+ EP
Sbjct  121  SEG-SVKHEAYLLFPVHLDGTLLDNAQTMKAKKEFFSTLDVLEIFRQLCAGLKHMHSNEP  179

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLTHRKG  PLAILMDFGS RP
Sbjct  180  PYAHNDVKPGNVLLTHRKGMSPLAILMDFGSTRP  213



>ref|XP_008455005.1| PREDICTED: serine/threonine-protein kinase 16 [Cucumis melo]
Length=344

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 194/214 (91%), Gaps = 4/214 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE+++D + P    +
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVSDSSSPSGGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPS  S +GTYA+KKVLIQ+SEQL+LV+EEIR+SSLF HPNLLPLLDHA+IAVK+
Sbjct  61   AKKLKDPSRLSGDGTYALKKVLIQSSEQLELVREEIRISSLFCHPNLLPLLDHAIIAVKS  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            SEG S KHEAYLLFPVH+DGTLLDNA  MKAKKE FST DVL+IFRQLCAGLKHMH+ EP
Sbjct  121  SEG-SVKHEAYLLFPVHLDGTLLDNAQTMKAKKEFFSTLDVLKIFRQLCAGLKHMHSNEP  179

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLTHRKG+ PLAILMDFGSARP
Sbjct  180  PYAHNDVKPGNVLLTHRKGKSPLAILMDFGSARP  213



>gb|AAZ39949.1| serine/threonine protein kinase [Gossypium hirsutum]
Length=345

 Score =   347 bits (890),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 187/214 (87%), Gaps = 3/214 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK---PGV  239
            MGC+FSG NA+YDA NG GD+WIND RF+IVRQLGEGGFAYVYLVKE+ +D +     G+
Sbjct  1    MGCTFSGFNAMYDAANGEGDIWINDIRFKIVRQLGEGGFAYVYLVKEVTSDSSSISAGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSH NLLPLLDHA+I+VK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHRNLLPLLDHAIISVKP  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
            ++  SW HEAYLLFPVH+DGTLLDN  AM AK + FSTSDV QIFRQLCAGL+HMH+ EP
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLDNFKAMSAKNDFFSTSDVPQIFRQLCAGLEHMHSLEP  180

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVLLTHRKG+ PLAILMDFGSARP
Sbjct  181  PYAHNDVKPGNVLLTHRKGESPLAILMDFGSARP  214



>ref|XP_010905763.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905764.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905765.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
Length=347

 Score =   347 bits (890),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 189/214 (88%), Gaps = 5/214 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDD-ARSGSGLA  59

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK   PSH S++GTYAMKKVLIQ+ +QL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK 
Sbjct  60   AKKSMHPSHVSEDGTYAMKKVLIQSEDQLQLVREEIRVSSLFNHPNLLPLLDHAIIAVKG  119

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
             +G  W HEAYLLFPVH+DGTLLDNA  M+AKKE FST  VLQIF+QLCAGLKHMH+F+P
Sbjct  120  PQG-GWNHEAYLLFPVHLDGTLLDNAKVMQAKKEFFSTVTVLQIFQQLCAGLKHMHSFDP  178

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVL+THRKGQPPL ILMDFGSARP
Sbjct  179  PYAHNDVKPGNVLMTHRKGQPPLTILMDFGSARP  212



>ref|XP_008804427.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=347

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 187/213 (88%), Gaps = 3/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  242
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI++Q+GEGGFAYVYLVKE++AD    G   +
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILKQIGEGGFAYVYLVKEVVADARSGGGLAA  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK   PSH S++GTYAMKKVLIQ+ +QL LV+EEI VSSLF+HPNLLPLLDHA+IAVK  
Sbjct  61   KKSVPPSHVSEDGTYAMKKVLIQSEDQLQLVREEIHVSSLFNHPNLLPLLDHAIIAVKGP  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +G  W HEAYLLFPVH+DGTLLDNA  M+AKKE  ST  VLQIF+QLCAGLKHMH+F+P 
Sbjct  121  QG-GWNHEAYLLFPVHLDGTLLDNAKVMQAKKEFLSTVTVLQIFQQLCAGLKHMHSFDPP  179

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  180  YAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  212



>gb|EPS73700.1| hypothetical protein M569_01056 [Genlisea aurea]
Length=336

 Score =   344 bits (883),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 183/211 (87%), Gaps = 2/211 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGL A YD VNGG DVWIN NRFRIVRQLGEGGFAYV+LVKE+L+D    G S+K
Sbjct  1    MGCSFSGLTAFYDVVNGGDDVWINGNRFRIVRQLGEGGFAYVFLVKELLSD-FTAGFSRK  59

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDP+H SD+GTYAMKKVLIQNSEQL +V+EEIRVSSLF+HPNLLPLLDHA+IAVKA + 
Sbjct  60   IKDPAHVSDDGTYAMKKVLIQNSEQLKIVREEIRVSSLFTHPNLLPLLDHAIIAVKAPD-  118

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QSWKHEAY LFPVHM GTLLDN+ +M+AK + F TSDVL IFRQLCAGL H+HN +P YA
Sbjct  119  QSWKHEAYFLFPVHMGGTLLDNSMSMRAKNDFFPTSDVLHIFRQLCAGLDHIHNLDPPYA  178

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HN+VKPGNVLLT RKG PPLA LMDFGSARP
Sbjct  179  HNNVKPGNVLLTFRKGHPPLATLMDFGSARP  209



>ref|XP_010905766.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Elaeis guineensis]
Length=346

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 188/214 (88%), Gaps = 6/214 (3%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDD-ARSGSGLA  59

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            +KK   PSH SD GTYAMKKVLIQ+ +QL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK 
Sbjct  60   AKKSMHPSHVSD-GTYAMKKVLIQSEDQLQLVREEIRVSSLFNHPNLLPLLDHAIIAVKG  118

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
             +G  W HEAYLLFPVH+DGTLLDNA  M+AKKE FST  VLQIF+QLCAGLKHMH+F+P
Sbjct  119  PQG-GWNHEAYLLFPVHLDGTLLDNAKVMQAKKEFFSTVTVLQIFQQLCAGLKHMHSFDP  177

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
             YAHNDVKPGNVL+THRKGQPPL ILMDFGSARP
Sbjct  178  PYAHNDVKPGNVLMTHRKGQPPLTILMDFGSARP  211



>ref|XP_008804428.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=346

 Score =   342 bits (876),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 186/213 (87%), Gaps = 4/213 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  242
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI++Q+GEGGFAYVYLVKE++AD    G   +
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILKQIGEGGFAYVYLVKEVVADARSGGGLAA  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK   PSH SD GTYAMKKVLIQ+ +QL LV+EEI VSSLF+HPNLLPLLDHA+IAVK  
Sbjct  61   KKSVPPSHVSD-GTYAMKKVLIQSEDQLQLVREEIHVSSLFNHPNLLPLLDHAIIAVKGP  119

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +G  W HEAYLLFPVH+DGTLLDNA  M+AKKE  ST  VLQIF+QLCAGLKHMH+F+P 
Sbjct  120  QG-GWNHEAYLLFPVHLDGTLLDNAKVMQAKKEFLSTVTVLQIFQQLCAGLKHMHSFDPP  178

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  179  YAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  211



>gb|KHN15181.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=361

 Score =   341 bits (875),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 187/230 (81%), Gaps = 19/230 (8%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A     ++
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEAPDDSAARWPRQE  60

Query  249  FKD-------------------PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSH  371
             +                     S   D+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+H
Sbjct  61   AQRLLSSLRNREIIFVRCDECPISRFGDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNH  120

Query  372  PNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQI  551
            PNLLPLL+HA+I+VK +   SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQI
Sbjct  121  PNLLPLLEHAIISVKPTHETSWNHEAYLLFPVHLDGTLLDNAKIMKAKKEFYSTSDVLQI  180

Query  552  FRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            FRQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  FRQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  230



>ref|XP_009395860.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=362

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 186/212 (88%), Gaps = 5/212 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  245
            MGCS SGLNA YDAV+GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE++AD    G++ K
Sbjct  24   MGCSLSGLNAFYDAVSGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVAD----GLARK  79

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K  +PSH SD+GTYAMKK++IQ  EQL+LV++EIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  80   KSINPSHISDDGTYAMKKIIIQTEEQLELVRQEIRVSSLFSHPNLLPLLDHAIIPVKGMQ  139

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              S KHEAYLLFPVH+DGTLLD A AM+ KKESF+T  VL IFRQ+C GLKHMH+F+P Y
Sbjct  140  DGSLKHEAYLLFPVHLDGTLLDIAEAMQLKKESFTTITVLHIFRQVCGGLKHMHSFDPPY  199

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  200  AHNDVKPGNVLITHRKGQPPLAILMDFGSARP  231



>ref|XP_010942233.1| PREDICTED: serine/threonine-protein kinase 16-like [Elaeis guineensis]
Length=344

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  242
            MGCSFSGLNA YDAVN GGD WIN+NRFRI+RQLGEGGFAYVYLVKE+++D    G    
Sbjct  1    MGCSFSGLNAFYDAVNAGGDAWINENRFRILRQLGEGGFAYVYLVKEVVSDGGGGGGLAK  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK  DPSH SD+GTYAMKK+LIQ+ EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK +
Sbjct  61   KKSVDPSHISDDGTYAMKKILIQSEEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKGA  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +  S  HEAYLLFPVH+DGTLLD    M+ KKE F T  VL IFRQLCAGLKHMHNF+P 
Sbjct  121  QQGSRNHEAYLLFPVHLDGTLLDVTKVMQTKKEFFPTITVLHIFRQLCAGLKHMHNFDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+THRKGQ PLAILMDFGSARP
Sbjct  181  YAHNDVKPGNVLITHRKGQQPLAILMDFGSARP  213



>gb|AFK43523.1| unknown [Lotus japonicus]
Length=202

 Score =   332 bits (851),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+  D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVPNDSAAGGLANK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             K  SH SD+G+YAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++ 
Sbjct  61   LKHSSHISDDGSYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKRTQE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIF+QLC GLKHMH+ EP YA
Sbjct  121  TSWTHEAYLLFPVHLDGTLLDNAQTMKAKKEFYSTSDVLQIFQQLCEGLKHMHSLEPPYA  180

Query  609  HNDVKPGNVLLTHRK  653
            HNDVKPGNVL+THRK
Sbjct  181  HNDVKPGNVLITHRK  195



>ref|XP_008797567.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Phoenix dactylifera]
Length=347

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 185/213 (87%), Gaps = 2/213 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  245
            MGCSFSGLNALYDAVN GGDVWIN+NRF+I+RQLGEGGFAYVYLVKE+++D    G ++K
Sbjct  1    MGCSFSGLNALYDAVNAGGDVWINENRFQILRQLGEGGFAYVYLVKEVVSDGGGGGGLAK  60

Query  246  KFK-DPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            K   DPSH S +GTYAMKK+LIQ+ EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK +
Sbjct  61   KISVDPSHISGDGTYAMKKILIQSEEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKGA  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +  S  HEAYLLFPVH+DGTLLD    M+ KKE F T  VL IFRQLCAGLKHMH+F+P 
Sbjct  121  QQGSRNHEAYLLFPVHLDGTLLDVTKVMQTKKEFFPTITVLDIFRQLCAGLKHMHSFDPP  180

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+THRKGQPPLAILMDFGSARP
Sbjct  181  YAHNDVKPGNVLITHRKGQPPLAILMDFGSARP  213



>ref|XP_010929080.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Elaeis guineensis]
Length=341

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 3/212 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNA YD+V+ GGDVWIN+NRFRI+RQLGEGGFAYVYLVKE+++D    G++KK
Sbjct  1    MGCSFSGLNAFYDSVSAGGDVWINENRFRILRQLGEGGFAYVYLVKEVVSDGG--GLAKK  58

Query  249  FK-DPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
               DPSH S +GTYAMKKVLIQ+ EQL+LV+EEI VSSLF+HPNLLPLLDHA+IAVK ++
Sbjct  59   KSIDPSHISADGTYAMKKVLIQSEEQLELVREEIHVSSLFNHPNLLPLLDHAIIAVKGAQ  118

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              +  HEAYLLFPVH+DGTLLD    M+AKKE F T  VLQIFRQLCAGLKHMH+F+P Y
Sbjct  119  QGAQSHEAYLLFPVHLDGTLLDVTKVMQAKKEFFPTITVLQIFRQLCAGLKHMHSFDPPY  178

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGN+++THRKGQPPLAILMDFGS  P
Sbjct  179  AHNDVKPGNIMITHRKGQPPLAILMDFGSTCP  210



>ref|XP_004252263.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=335

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 180/211 (85%), Gaps = 9/211 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI+RQ     F  V+LVKE+++DP       K
Sbjct  1    MGCSFSGLNALYDNANGGGDVWINENRFRILRQ---ATFPNVFLVKELISDP------NK  51

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPSH SD+GTYAMKKVLIQN+E+L+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  52   IKDPSHVSDDGTYAMKKVLIQNNEELELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  111

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QS K EAYLLFP HMDGTLLD+  AM+AK+E FST +VLQIF QLCAGLKHMH+F+P YA
Sbjct  112  QSRKQEAYLLFPAHMDGTLLDSMKAMQAKQEFFSTLEVLQIFHQLCAGLKHMHSFDPPYA  171

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLTHRKGQ PLA LMDFG+A P
Sbjct  172  HNDVKPGNVLLTHRKGQAPLAKLMDFGNACP  202



>ref|XP_006345347.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=335

 Score =   324 bits (830),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 177/211 (84%), Gaps = 9/211 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD  N GGDVWIN+NRFRI+RQ     F  V+LVKE+++DP       K
Sbjct  1    MGCSFSGLNALYDNANSGGDVWINENRFRILRQ---ASFPNVFLVKELISDP------NK  51

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KDPSH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  52   IKDPSHVSDDGTYAMKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  111

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            QS K EAYLLFP H+DGTLLD+   M+AK+E FST +VLQIF QLCAGLKHMHNF+P YA
Sbjct  112  QSRKQEAYLLFPAHLDGTLLDSMKTMQAKQEFFSTLEVLQIFHQLCAGLKHMHNFDPPYA  171

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVK GNVLLTHRKGQ PLA LMDFG+A P
Sbjct  172  HNDVKSGNVLLTHRKGQAPLAKLMDFGNAHP  202



>ref|NP_001132895.1| LOC100194392 [Zea mays]
 gb|ACF81929.1| unknown [Zea mays]
 tpg|DAA61226.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=338

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 180/213 (85%), Gaps = 8/213 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  249  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK+ 
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKSQ  115

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +G  W HEAYLLFPVH+DGTL DNA  M +++E +ST+DVLQIF+Q+C GLKHMH+F+P 
Sbjct  116  QG-DWSHEAYLLFPVHLDGTLFDNANIMLSRREFYSTADVLQIFQQMCEGLKHMHSFDPP  174

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+T RKGQ P+A LMDFGSARP
Sbjct  175  YAHNDVKPGNVLITWRKGQAPVATLMDFGSARP  207



>ref|XP_004956689.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X1 [Setaria italica]
Length=338

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--QQPASNAAPAR  58

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              D +H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLFSHPNLLPLLDHA+IAVK+ +G
Sbjct  59   RHD-AHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFSHPNLLPLLDHAIIAVKSPQG  117

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPVH+DGTL DN+  M ++KE +ST+DVLQIFRQ+C GLKHMH+F+P YA
Sbjct  118  -DWSHEAYLLFPVHLDGTLFDNSNIMLSRKEYYSTADVLQIFRQMCEGLKHMHSFDPPYA  176

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+T RKGQ P+A LMDFGSARP
Sbjct  177  HNDVKPGNVLITRRKGQAPVATLMDFGSARP  207



>ref|XP_008783057.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
 ref|XP_008783058.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=341

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 179/212 (84%), Gaps = 3/212 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  245
            MGCSFSGLNA YDAV  GGDVWIN+NRFR++RQLGEGG +YVYLVKE+++D A  G++ K
Sbjct  1    MGCSFSGLNAFYDAVGAGGDVWINENRFRVLRQLGEGGLSYVYLVKEVVSDGA--GLARK  58

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K  DPSH SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++
Sbjct  59   KSIDPSHISDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQ  118

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              S   EAYLLFPVH+DGTLLD    M+AK + F T  VLQIFRQLCAGLKHMH+F+P Y
Sbjct  119  QGSQNREAYLLFPVHLDGTLLDVTKVMQAKMDFFPTITVLQIFRQLCAGLKHMHSFDPPY  178

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AHNDVKPGN+++THRKGQPPLAILMDFGS  P
Sbjct  179  AHNDVKPGNIMITHRKGQPPLAILMDFGSTCP  210



>gb|EMS68366.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=336

 Score =   319 bits (818),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 178/211 (84%), Gaps = 5/211 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALY+A  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSLSGLNALYEAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHDAS----SYAAR  56

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             + PSH SD+GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK+++G
Sbjct  57   DRHPSHVSDDGTYAMKKVLIQSREQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKSTQG  116

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPVH+DGTL DNA  M+++KE +S  DVL+IF+Q+C GLKHMH+ +P YA
Sbjct  117  -DWSHEAYLLFPVHLDGTLFDNAAVMQSRKEFYSVVDVLRIFQQICEGLKHMHSLDPPYA  175

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+T RKGQ PLA LMDFGS+RP
Sbjct  176  HNDVKPGNVLVTRRKGQAPLATLMDFGSSRP  206



>ref|NP_001063027.1| Os09g0372800 [Oryza sativa Japonica Group]
 dbj|BAD26364.1| putative serine/threonine-protein kinase 16 [Oryza sativa Japonica 
Group]
 dbj|BAF24941.1| Os09g0372800 [Oryza sativa Japonica Group]
 gb|EAZ08870.1| hypothetical protein OsI_31131 [Oryza sativa Indica Group]
 gb|EAZ44518.1| hypothetical protein OsJ_29137 [Oryza sativa Japonica Group]
 dbj|BAG93927.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 178/211 (84%), Gaps = 5/211 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E  A       + +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVREHQAS----ADAAR  56

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             + PS AS++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHAVIAVK  +G
Sbjct  57   GRSPSLASEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKNQQG  116

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPV++DGTL DNA  M+++KE +ST DVL+IF+QLC GLKHMH+F+P YA
Sbjct  117  -DWNHEAYLLFPVYIDGTLFDNAKVMQSRKEFYSTIDVLRIFQQLCEGLKHMHSFDPPYA  175

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVK GNVL+THRKGQ PLA LMDFGSARP
Sbjct  176  HNDVKTGNVLITHRKGQAPLATLMDFGSARP  206



>ref|XP_004956690.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X2 [Setaria italica]
Length=335

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 175/211 (83%), Gaps = 7/211 (3%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--QQPASNAAPAR  58

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              D +H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLFSHPNLLPLLDHA+IAVK    
Sbjct  59   RHD-AHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFSHPNLLPLLDHAIIAVKGD--  115

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPVH+DGTL DN+  M ++KE +ST+DVLQIFRQ+C GLKHMH+F+P YA
Sbjct  116  --WSHEAYLLFPVHLDGTLFDNSNIMLSRKEYYSTADVLQIFRQMCEGLKHMHSFDPPYA  173

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+T RKGQ P+A LMDFGSARP
Sbjct  174  HNDVKPGNVLITRRKGQAPVATLMDFGSARP  204



>ref|XP_010238122.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Brachypodium 
distachyon]
Length=336

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 177/211 (84%), Gaps = 5/211 (2%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSMSGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHEAS----SDAAR  56

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             + PSH S++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK  +G
Sbjct  57   GRHPSHVSEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKTEQG  116

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPV++DGTL DN+ AM ++KE +S   +LQIFRQ+C G+KHMH+F+P YA
Sbjct  117  D-WSHEAYLLFPVYLDGTLFDNSKAMWSRKEFYSVFHILQIFRQICEGVKHMHSFDPPYA  175

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQ PLA LMDFGS+RP
Sbjct  176  HNDVKPGNVLITHRKGQAPLATLMDFGSSRP  206



>ref|XP_008650962.1| PREDICTED: LOC100194392 isoform X1 [Zea mays]
 gb|ACF80463.1| unknown [Zea mays]
 tpg|DAA61225.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=335

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 177/213 (83%), Gaps = 11/213 (5%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  249  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKGD  115

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
                W HEAYLLFPVH+DGTL DNA  M +++E +ST+DVLQIF+Q+C GLKHMH+F+P 
Sbjct  116  ----WSHEAYLLFPVHLDGTLFDNANIMLSRREFYSTADVLQIFQQMCEGLKHMHSFDPP  171

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+T RKGQ P+A LMDFGSARP
Sbjct  172  YAHNDVKPGNVLITWRKGQAPVATLMDFGSARP  204



>gb|ACG33051.1| serine/threonine-protein kinase 16 [Zea mays]
Length=335

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 177/213 (83%), Gaps = 11/213 (5%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  249  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKGD  115

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
                W HEAYLLFPVH+DGTL DNA  M +++E +ST+DVLQIF+Q+C GLKHMH+F+P 
Sbjct  116  ----WSHEAYLLFPVHLDGTLFDNANIMLSRREFYSTADVLQIFQQMCEGLKHMHSFDPP  171

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHNDVKPGNVL+T RKGQ P+A LMDFGSARP
Sbjct  172  YAHNDVKPGNVLITWRKGQAPVATLMDFGSARP  204



>gb|AFK34971.1| unknown [Lotus japonicus]
Length=184

 Score =   309 bits (792),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+  D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVPNDSAAGGLANK  60

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             K  SH SD+G+YAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++ 
Sbjct  61   LKHSSHISDDGSYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKRTQE  120

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             SW HEAYLLFPVH+DGTLLDNA  MKAKKE +STSDVLQIF QLC GLKHMH+ EP YA
Sbjct  121  TSWTHEAYLLFPVHLDGTLLDNAQTMKAKKEFYSTSDVLQIFLQLCEGLKHMHSLEPPYA  180

Query  609  HNDV  620
            HNDV
Sbjct  181  HNDV  184



>ref|XP_010238123.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Brachypodium 
distachyon]
Length=333

 Score =   313 bits (803),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 175/211 (83%), Gaps = 8/211 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSMSGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHEAS----SDAAR  56

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             + PSH S++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK    
Sbjct  57   GRHPSHVSEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKGD--  114

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
              W HEAYLLFPV++DGTL DN+ AM ++KE +S   +LQIFRQ+C G+KHMH+F+P YA
Sbjct  115  --WSHEAYLLFPVYLDGTLFDNSKAMWSRKEFYSVFHILQIFRQICEGVKHMHSFDPPYA  172

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVL+THRKGQ PLA LMDFGS+RP
Sbjct  173  HNDVKPGNVLITHRKGQAPLATLMDFGSSRP  203



>ref|NP_850792.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AED91260.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=311

 Score =   305 bits (782),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 165/211 (78%), Gaps = 32/211 (15%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI                              
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRI------------------------------  30

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              DP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  + 
Sbjct  31   --DPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQE  88

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             +WKHEA+LLFPVH+DGTLLDN T MKAKKE+FST+DVL IFRQLC GLKHMH+ EP YA
Sbjct  89   GAWKHEAFLLFPVHLDGTLLDNFTLMKAKKETFSTTDVLHIFRQLCDGLKHMHSLEPPYA  148

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HNDVKPGNVLLT RKGQPPLAILMDFGSARP
Sbjct  149  HNDVKPGNVLLTRRKGQPPLAILMDFGSARP  179



>gb|ABB72838.1| serine/threonine kinase [Elaeis guineensis]
Length=346

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 181/215 (84%), Gaps = 8/215 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILAD-PAKPGVS-  242
            MGCSFSGLNALY+AVNGGGDV IN+N FRI+RQ+GEGGFAYVYLVKE++ D P++ G++ 
Sbjct  1    MGCSFSGLNALYNAVNGGGDVLINENPFRILRQIGEGGFAYVYLVKEVVDDAPSRSGLAA  60

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK   PSH S++GTY+MKKVLIQ+ +QL  V+EEI VSSLF+HPNLL LLDHA+I+VK  
Sbjct  61   KKSMHPSHVSEDGTYSMKKVLIQSEDQLQFVREEIPVSSLFNHPNLLSLLDHAIISVKGP  120

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +G  W HEAYLLFPVH+DGT LDN+  M+AKKE FST  VLQIF+QLCAGLKHMH+F+P 
Sbjct  121  QG-GWNHEAYLLFPVHLDGTFLDNSKVMQAKKEFFSTLTVLQIFQQLCAGLKHMHSFDPP  179

Query  603  YAHNDVKPGNVLLT--HRKGQPPLAILMDFGSARP  701
            YAHNDV   N++++  HRKGQPPL ILMDFG ARP
Sbjct  180  YAHNDV---NLVISHAHRKGQPPLTILMDFGRARP  211



>dbj|BAJ87464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 169/225 (75%), Gaps = 14/225 (6%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV-  239
            MGCSFSGLNALYD V GGGD+W+ND RFR++R+LG+ G A   V+LVKE++A  A     
Sbjct  1    MGCSFSGLNALYDTVGGGGDIWVNDYRFRVLRRLGDAGPAGSSVFLVKEVVAAAAPSDGT  60

Query  240  -----------SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLP  386
                        KK  DPSH S +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLP
Sbjct  61   AGAGPGAAGLAKKKGVDPSHISADGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLP  120

Query  387  LLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLC  566
            LL++A+IAVK  +  S  HEAYLLFPVH+DGTL D   +M+ KKE  ST  +LQIFRQLC
Sbjct  121  LLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDVTKSMQEKKEYLSTITILQIFRQLC  180

Query  567  AGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARP
Sbjct  181  AGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESARP  225



>ref|NP_001062642.1| Os09g0237600 [Oryza sativa Japonica Group]
 dbj|BAD33903.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF24556.1| Os09g0237600 [Oryza sativa Japonica Group]
 gb|EAZ43874.1| hypothetical protein OsJ_28494 [Oryza sativa Japonica Group]
Length=358

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 170/226 (75%), Gaps = 15/226 (7%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADP-----  224
            MGCSFSGLNALYD V GGG D+W+ND RFR+VR+LG+ G A  +V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGGGGDIWVNDYRFRVVRRLGDAGPAGSFVFLVKEVVAAATASDG  60

Query  225  ---AKPGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
               A PG S    KK  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLL
Sbjct  61   TGGAVPGASGLAKKKGIDPSHISADGTYALKKVLIQNEQHLEQVRQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL++A+IAVK  +  S  HEAYLLFPVH+DGTL D    M  KKE F T  +LQIFRQL
Sbjct  121  PLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDINKNMLEKKEYFPTISILQIFRQL  180

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            CAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARP
Sbjct  181  CAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARP  226



>gb|EAZ08255.1| hypothetical protein OsI_30510 [Oryza sativa Indica Group]
Length=358

 Score =   276 bits (705),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 169/226 (75%), Gaps = 15/226 (7%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADP-----  224
            MGCSFSGLNALYD V GGG D+W+ND RFR+VR+LG+ G A  +V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGGGGDIWVNDYRFRVVRRLGDAGPAGSFVFLVKEVVAAATASDG  60

Query  225  ---AKPGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
               A PG S    KK  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLL
Sbjct  61   TGGAVPGASGLAKKKGIDPSHISADGTYALKKVLIQNEQHLEQVRQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL++A+IAVK  +     HEAYLLFPVH+DGTL D    M  KKE F T  +LQIFRQL
Sbjct  121  PLLENAIIAVKGVQDGLQNHEAYLLFPVHLDGTLQDINKNMLEKKEYFPTISILQIFRQL  180

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            CAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARP
Sbjct  181  CAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARP  226



>ref|XP_004956402.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Setaria italica]
Length=358

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 169/226 (75%), Gaps = 15/226 (7%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAK---  230
            MGCSFSGLNALYD V GGG DVW+ND RFR++R+LG+ G A   V+LVKE++A  A    
Sbjct  1    MGCSFSGLNALYDNVGGGGGDVWVNDYRFRVLRRLGDAGPAGSSVFLVKEVVAAAASSDG  60

Query  231  -----PGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
                 PG S    KK  DPSH S +G YA+KKVLI++ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGAGPGTSGIARKKGVDPSHISADGIYALKKVLIRSEQHLELVRQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL+HA+IAVK  +  S  HEAYLLFPVH+DGTL D    M+ + ESF T  VLQIFRQL
Sbjct  121  PLLEHAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDVTKTMQERNESFPTITVLQIFRQL  180

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            CAGLKHMH+F+P YAHN VKP NVL+THRK  P LAILMDF SA P
Sbjct  181  CAGLKHMHSFDPPYAHNAVKPDNVLITHRKELPHLAILMDFESAGP  226



>ref|XP_010237321.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brachypodium distachyon]
Length=362

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 167/230 (73%), Gaps = 19/230 (8%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGG--DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPG  236
            MGCSFSGLNALYD V GGG  DVW+ND RFR++R+LG+ G A   V+LVKEI+A  +   
Sbjct  1    MGCSFSGLNALYDTVGGGGGGDVWVNDYRFRVLRRLGDAGPAGSSVFLVKEIVAAASAAS  60

Query  237  ---------------VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSH  371
                             KK  DPSH S +GTYA+KKVLIQ+ + L LV++EIRVSS FSH
Sbjct  61   DAGAGGGAGPGPVGLAKKKGVDPSHISADGTYALKKVLIQSDQHLQLVRQEIRVSSQFSH  120

Query  372  PNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQI  551
            PNLLPLL++A+IAVK  +  S  HEAYLLFPVH+DGTL D   +M  KKE F T  +LQI
Sbjct  121  PNLLPLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDATKSMLEKKEYFPTITILQI  180

Query  552  FRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            FRQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARP
Sbjct  181  FRQLCAGLKHMHSFEPPYAHNGVKPDNVLITLRKEQPHLAILMDFESARP  230



>ref|XP_002991218.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
 gb|EFJ07762.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
Length=342

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 155/211 (73%), Gaps = 9/211 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALY+AV+G  D+WIN+ RFRIVRQLGEGGFA+VYL +EI  D       + 
Sbjct  1    MGCSFSGLNALYEAVSGAADIWINERRFRIVRQLGEGGFAFVYLAREIQGD-------RP  53

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK-ASE  425
             K  S  SD+G YA+KKVLIQ+ EQL LVK EI+VSSLF HPNLLPLL+H++IAVK  S 
Sbjct  54   LKQSSQVSDDGLYAVKKVLIQSEEQLALVKREIQVSSLFKHPNLLPLLEHSMIAVKQGSR  113

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              +W  EAYLLFPV+ DGTL      M+++ E F    VL IF+Q+C  LK MH  +PSY
Sbjct  114  EGTWNTEAYLLFPVYPDGTLQSQLEEMRSRGEFFPAVTVLHIFQQICQALKQMHKHDPSY  173

Query  606  AHNDVKPGNVLLTHRKGQ-PPLAILMDFGSA  695
            +HNDVKPGNVLL+    Q PP A++MDFGSA
Sbjct  174  SHNDVKPGNVLLSKSSNQDPPKAVVMDFGSA  204



>ref|NP_001149977.1| serine/threonine-protein kinase 16 [Zea mays]
 gb|ACF85515.1| unknown [Zea mays]
 gb|ACG37388.1| serine/threonine-protein kinase 16 [Zea mays]
 tpg|DAA39536.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=357

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 168/226 (74%), Gaps = 16/226 (7%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  218
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  219  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL+HA++AVK  +  S  +EAYLLFPVH++GTL D    M  KKE F T  VLQIFRQL
Sbjct  121  PLLEHAIVAVKGVQDGSQNYEAYLLFPVHLEGTLHDITKTMLEKKEFFPTITVLQIFRQL  180

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            C+GLKHMH+F+P YAHN VKP NVL+T RK Q  LAILMDF SA P
Sbjct  181  CSGLKHMHSFDPPYAHNGVKPDNVLITQRK-QSHLAILMDFESAGP  225



>ref|XP_002991279.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
 gb|EFJ07707.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
Length=342

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 154/211 (73%), Gaps = 9/211 (4%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCSFSGLNALY+AV+G  D+WIN  RFRIVRQLGEGGFA+VYL +EI  D       + 
Sbjct  1    MGCSFSGLNALYEAVSGAADIWINQRRFRIVRQLGEGGFAFVYLAREIQGD-------RP  53

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK-ASE  425
             K  S  SD+G YA+KKVLIQ+ EQL LVK EI+VSSLF HPNLLPLL+H++IAVK  S 
Sbjct  54   LKQSSQVSDDGLYAVKKVLIQSEEQLALVKREIQVSSLFKHPNLLPLLEHSMIAVKQGSR  113

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              +W  EAYLLFPV+ DGTL      M+++ E F    VL IF+Q+C  LK MH  +PSY
Sbjct  114  EGTWNTEAYLLFPVYPDGTLQSQLEEMRSRGEFFPAVTVLHIFQQICQALKQMHKHDPSY  173

Query  606  AHNDVKPGNVLLTHRKGQ-PPLAILMDFGSA  695
            +HNDVKPGNVLL+    Q PP A++MDFGSA
Sbjct  174  SHNDVKPGNVLLSKSSNQDPPKAVVMDFGSA  204



>ref|XP_008668044.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Zea 
mays]
 tpg|DAA39534.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=354

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 167/226 (74%), Gaps = 19/226 (8%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  218
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  219  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL+HA++AVK     S  +EAYLLFPVH++GTL D    M  KKE F T  VLQIFRQL
Sbjct  121  PLLEHAIVAVKDG---SQNYEAYLLFPVHLEGTLHDITKTMLEKKEFFPTITVLQIFRQL  177

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            C+GLKHMH+F+P YAHN VKP NVL+T RK Q  LAILMDF SA P
Sbjct  178  CSGLKHMHSFDPPYAHNGVKPDNVLITQRK-QSHLAILMDFESAGP  222



>ref|XP_001779469.1| predicted protein [Physcomitrella patens]
 gb|EDQ55747.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 159/211 (75%), Gaps = 2/211 (1%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGC++SGL+ALY AV  G +V++N  RF+I RQLGEGGFA+VYLV+E++  PA     K 
Sbjct  1    MGCTWSGLDALYGAVGSGAEVFVNKRRFKIQRQLGEGGFAFVYLVRELI--PAGLQPLKD  58

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
              DP+  S++G YA+KKVLIQ+ EQL+LV++EI VSSLF+HPN++ LL+H++I V  +E 
Sbjct  59   SDDPNPGSEDGMYALKKVLIQSDEQLELVEKEIEVSSLFNHPNVIRLLEHSIIKVAKTES  118

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
            Q    E YLLFPV+ DGTLLD+ T M+  K  F T  VL IFRQ+CAGLKHMH   P YA
Sbjct  119  QPEHQEGYLLFPVYRDGTLLDHLTRMQEAKTFFPTITVLHIFRQICAGLKHMHTHGPPYA  178

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            HND+KPGNVL++  K  PP+A++MD GSARP
Sbjct  179  HNDIKPGNVLVSLPKNAPPVAVIMDMGSARP  209



>dbj|BAJ95332.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   244 bits (624),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 156/225 (69%), Gaps = 30/225 (13%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV-  239
            MGCSFSGLNALYD                ++R+LG+ G A   V+LVKE++A  A     
Sbjct  1    MGCSFSGLNALYD----------------VLRRLGDAGPAGSSVFLVKEVVAAAAPSDGT  44

Query  240  -----------SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLP  386
                        KK  DPSH S +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLP
Sbjct  45   AGAGPGAAGLAKKKGVDPSHISADGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLP  104

Query  387  LLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLC  566
            LL++A+IAVK  +  S  HEAYLLFPVH+DGTL D   +M+ KKE  ST  +LQIFRQLC
Sbjct  105  LLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDVTKSMQEKKEYLSTITILQIFRQLC  164

Query  567  AGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            AGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARP
Sbjct  165  AGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESARP  209



>ref|XP_006661175.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=305

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  273  DNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAY  452
            D+GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHAVIAVK+ +G  W HEAY
Sbjct  33   DDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKSQQG-DWNHEAY  91

Query  453  LLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGN  632
            LLFPVH+DGTL DNA  M+++KE +ST +VLQIF+QLC GL+HMHNF+P YAHNDVKPGN
Sbjct  92   LLFPVHIDGTLFDNAKVMQSRKEFYSTINVLQIFQQLCEGLRHMHNFDPPYAHNDVKPGN  151

Query  633  VLLTHRKGQPPLAILMDFGSARP  701
            VL+TH+KGQ PLA LMDFGSARP
Sbjct  152  VLITHQKGQAPLATLMDFGSARP  174



>ref|XP_006440850.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54090.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=221

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 143/214 (67%), Gaps = 51/214 (24%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  239
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVK 
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKI  120

Query  420  SEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP  599
              G   KH                    M + +  ++ +DV                   
Sbjct  121  CAG--LKH--------------------MHSLEPPYAHNDV-------------------  139

Query  600  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
                   KPGN+L+T RKGQPPLAILMDFGSARP
Sbjct  140  -------KPGNILITCRKGQPPLAILMDFGSARP  166



>ref|XP_006661044.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=477

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 149/212 (70%), Gaps = 14/212 (7%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV------------SK  245
            A N   D+W+ND RFR++R+L + G A   V+LVKE++A  A                 K
Sbjct  134  AKNKESDIWVNDYRFRVIRRLSDAGPAGSSVFLVKEVVAAAAASDGTAGAGPGAAGLAKK  193

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
            K  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLLPLL++A+I+VK  +
Sbjct  194  KGVDPSHISADGTYALKKVLIQNDQHLEQVRQEIRVSSQFSHPNLLPLLENAIISVKGVQ  253

Query  426  GQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSY  605
              S  HEAYLLFPVH+DGTL D   +M  KKE   T  +LQI RQLCAGLKHMH+F+P Y
Sbjct  254  DGSHNHEAYLLFPVHLDGTLQDINKSMLEKKEYLPTITILQILRQLCAGLKHMHSFDPPY  313

Query  606  AHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            +HN VKP NVL+T RK QP LAILMDF SARP
Sbjct  314  SHNGVKPDNVLITQRKDQPHLAILMDFESARP  345



>ref|XP_008783059.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X3 [Phoenix dactylifera]
Length=341

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  267  ASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHE  446
            +SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++  S   E
Sbjct  70   SSDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQQGSQNRE  129

Query  447  AYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKP  626
            AYLLFPVH+DGTLLD    M+AK + F T  VLQIFRQLCAGLKHMH+F+P YAHNDVKP
Sbjct  130  AYLLFPVHLDGTLLDVTKVMQAKMDFFPTITVLQIFRQLCAGLKHMHSFDPPYAHNDVKP  189

Query  627  GNVLLTHRKGQPPLAILMDFGSARP  701
            GN+++THRKGQPPLAILMDFGS  P
Sbjct  190  GNIMITHRKGQPPLAILMDFGSTCP  214



>ref|XP_008783056.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=345

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  267  ASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHE  446
            +SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++  S   E
Sbjct  70   SSDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQQGSQNRE  129

Query  447  AYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKP  626
            AYLLFPVH+DGTLLD    M+AK + F T  VLQIFRQLCAGLKHMH+F+P YAHNDVKP
Sbjct  130  AYLLFPVHLDGTLLDVTKVMQAKMDFFPTITVLQIFRQLCAGLKHMHSFDPPYAHNDVKP  189

Query  627  GNVLLTHRKGQPPLAILMDFGSARP  701
            GN+++THRKGQPPLAILMDFGS  P
Sbjct  190  GNIMITHRKGQPPLAILMDFGSTCP  214



>gb|EMT14968.1| Serine/threonine-protein kinase 16 [Aegilops tauschii]
Length=350

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK  DPSH S +GTYA+KKV IQ+ + L+LV++EIRVSS FSHPNLLPLL++A+IAVK  
Sbjct  66   KKGVDPSHISADGTYALKKVFIQSDQHLELVRQEIRVSSQFSHPNLLPLLENAIIAVKGV  125

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            +  S  HEAYLLFPVH+DGTL D   +M+ KKE  ST  +LQIFRQLCAGLKHMH+FEP 
Sbjct  126  QDGSQNHEAYLLFPVHLDGTLQDVTKSMQEKKEYLSTITILQIFRQLCAGLKHMHSFEPP  185

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
            YAHN VKP NVL+T RK QP LAILMDF SA P
Sbjct  186  YAHNGVKPDNVLITQRKEQPHLAILMDFESACP  218



>gb|EMS65453.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=306

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  276  NGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYL  455
            +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLPLL++A+IAVK  +  S  HEAYL
Sbjct  33   DGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLPLLENAIIAVKGVQDGSQNHEAYL  92

Query  456  LFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV  635
            LFPVH+DGTL D   +M+ KKE  ST  +LQIFRQLCAGLKHMH+FEP YAHN VKP NV
Sbjct  93   LFPVHLDGTLQDVTKSMQEKKEYLSTITILQIFRQLCAGLKHMHSFEPPYAHNGVKPDNV  152

Query  636  LLTHRKGQPPLAILMDFGSARP  701
            L+T RK QP LAILMDF SARP
Sbjct  153  LITQRKEQPHLAILMDFESARP  174



>gb|ACN26380.1| unknown [Zea mays]
 tpg|DAA39535.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=328

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 142/226 (63%), Gaps = 45/226 (20%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  218
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  219  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  383
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  384  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            PLL+HA++AVK  +  S  +EAYLLFPVH++GTL D    M  KKE F T  VLQIFRQ 
Sbjct  121  PLLEHAIVAVKGVQDGSQNYEAYLLFPVHLEGTLHDITKTMLEKKEFFPTITVLQIFRQ-  179

Query  564  CAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP  701
                                         + Q  LAILMDF SA P
Sbjct  180  -----------------------------RKQSHLAILMDFESAGP  196



>tpg|DAA61227.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=119

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 3/119 (3%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--HQPASDAAFAR  58

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  425
             +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  E
Sbjct  59   -RDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKHLE  116



>ref|XP_008370887.1| PREDICTED: uncharacterized protein LOC103434325 [Malus domestica]
Length=208

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 3/109 (3%)
 Frame = +3

Query  117  GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GVSKKFKDPSHASDNGTY  287
            G GD+       +IVRQLG+GGFAYV+LVK+++AD +     G++KKFKD SH SD+GTY
Sbjct  21   GYGDLEKLQKLVKIVRQLGKGGFAYVFLVKKVVADSSASSGGGLAKKFKDHSHVSDDGTY  80

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQS  434
            AMKKVLIQNSEQL+LV EEIRVSSLFSHPNL PLLDHA+IA   + G S
Sbjct  81   AMKKVLIQNSEQLELVNEEIRVSSLFSHPNLFPLLDHAIIASLMAGGIS  129



>gb|ABB72840.1| serine/threonine kinase splice variant 1 [Elaeis guineensis]
Length=91

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 5/93 (5%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  239
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVV-DDARSGSGLA  59

Query  240  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVK  338
            +KK   PSH SD GTYAMKKVLIQ+ +QL  V+
Sbjct  60   AKKSMHPSHVSD-GTYAMKKVLIQSEDQLQFVR  91



>ref|XP_006575874.1| PREDICTED: uncharacterized protein LOC100811063 [Glycine max]
Length=224

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +3

Query  111  VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSKKFKDPSHASDNGTY  287
            +NGGG+V IN N FRIVR+  E GFAYVYL+KE+  D A   G+SKK K  SH S++ TY
Sbjct  63   LNGGGNVCINKNHFRIVRKFREDGFAYVYLIKEVPNDSAITGGLSKKLKGSSHLSNDETY  122

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  419
            AMKKVLIQN+ Q +LV+EEIRVSSLF+HPN+LP LDH++++VK+
Sbjct  123  AMKKVLIQNNGQQELVREEIRVSSLFNHPNMLPFLDHSIVSVKS  166



>gb|KHG05751.1| Serine/threonine-protein kinase 16 [Gossypium arboreum]
Length=197

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  504  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD  683
            M AK + FSTSDVLQIFRQLCAGL+HMH+ EP YAHNDVKPGNVLLTHRKG+ PLAILMD
Sbjct  1    MSAKNDFFSTSDVLQIFRQLCAGLEHMHSLEPPYAHNDVKPGNVLLTHRKGESPLAILMD  60

Query  684  FGSARP  701
            FGSARP
Sbjct  61   FGSARP  66



>gb|ABB72839.1| serine/threonine kinase [Elaeis guineensis]
Length=83

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +3

Query  96   ALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VSKKFKDPSHA  269
            ALY+A+NGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D    G   +KK   PSH 
Sbjct  1    ALYNAMNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDDARSGGGLAAKKSMHPSHV  60

Query  270  SDNGTYAMKKVLIQNSEQLDLVK  338
            S++GTYAMKKVLIQ+ +QL  V+
Sbjct  61   SEDGTYAMKKVLIQSEDQLQFVR  83



>ref|XP_005096441.1| PREDICTED: serine/threonine-protein kinase 16-like [Aplysia californica]
Length=308

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 110/199 (55%), Gaps = 24/199 (12%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             + G   + I+D RF I ++LGEGGF+YV LV++         VS K           TY
Sbjct  3    CMCGKESLSIDDRRFFIRQRLGEGGFSYVDLVED--------AVSHK-----------TY  43

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV-KASEGQSWKHEAYLLFP  464
            A+K++L  + E+  +  +E+ V    +HPN++PL  H+   V + S+      E +L+ P
Sbjct  44   ALKRILCHSKEEEQIALQEVEVMRAVAHPNVIPLECHSFHKVGQYSKAVDITCEVFLVIP  103

Query  465  VHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLT  644
            ++  GTL D    +K KKE F+  ++ ++   +C G+K +H+  P YAH D+KP NV +T
Sbjct  104  LYRRGTLQDRIDTLKLKKEKFTEDEIWKLMLGICKGIKALHDHNPPYAHRDIKPDNV-MT  162

Query  645  HRKGQPPLAILMDFGSARP  701
            H  G P   ++MD GSA P
Sbjct  163  HDDGTP---VVMDLGSAAP  178



>ref|XP_005767918.1| hypothetical protein EMIHUDRAFT_245791 [Emiliania huxleyi CCMP1516]
 gb|EOD15489.1| hypothetical protein EMIHUDRAFT_245791 [Emiliania huxleyi CCMP1516]
Length=200

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 29/186 (16%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  314
            +N+   R+V+ L EGGF++VYLV++                     +   YA+KKVL Q 
Sbjct  29   VNERNLRVVKLLAEGGFSFVYLVED--------------------DEKKKYALKKVLAQL  68

Query  315  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDN  494
             E  +L + E++V   F H NL+PL+DHAV++       S   E  LL P++ DGTLLD 
Sbjct  69   PEASELARWEVQVHQSFKHANLMPLIDHAVVSTA-----SGAEEFRLLMPLYPDGTLLDL  123

Query  495  ATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAI  674
            A  +    +       L +F Q+C G+  +H+  P +AH D+KP N+LL+  +G  P  +
Sbjct  124  AVRLMEGGKRLEEGRALHLFAQVCEGVLALHSHSPPWAHRDIKPANILLS--EGDVP--V  179

Query  675  LMDFGS  692
            LMDFGS
Sbjct  180  LMDFGS  185



>ref|XP_005794443.1| hypothetical protein EMIHUDRAFT_431902 [Emiliania huxleyi CCMP1516]
 gb|EOD42014.1| hypothetical protein EMIHUDRAFT_431902 [Emiliania huxleyi CCMP1516]
Length=329

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 109/205 (53%), Gaps = 30/205 (15%)
 Frame = +3

Query  81   FSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKD  257
            ++ + +L  AV      + +N+   R+V+ L EGGF++VYLV++                
Sbjct  18   YAWVTSLCCAVTCSTQSMQVNERNLRVVKLLAEGGFSFVYLVED----------------  61

Query  258  PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW  437
                 +   YA+KKVL Q  E  +L + E++V   F H NL+PL+DHAV++       S 
Sbjct  62   ----DEKKKYALKKVLAQLPEASELARWEVQVHQSFKHANLMPLIDHAVVSTA-----SG  112

Query  438  KHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHND  617
              E  LL P++ DGTLLD A  +    +       L +F Q+C G+  +H+  P +AH D
Sbjct  113  AEEFRLLMPLYPDGTLLDLAVRLMEGGKRLEEGRALHLFAQVCEGVLALHSHSPPWAHRD  172

Query  618  VKPGNVLLTHRKGQPPLAILMDFGS  692
            +KP N+LL+  +G  P  +LMDFGS
Sbjct  173  IKPANILLS--EGDVP--VLMDFGS  193



>ref|XP_003060182.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56134.1| predicted protein [Micromonas pusilla CCMP1545]
Length=377

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 122/234 (52%), Gaps = 43/234 (18%)
 Frame = +3

Query  63   KKMGCSFSGL-NALYDAVNGGG--------DVWINDNRFRIVRQLGEGGFAYVYLVKEIL  215
            ++ GC+  G+  A+ DA    G        +V + D  F IV++LGEGGF+YV+L +EI 
Sbjct  10   EQYGCNVDGIWRAVVDAGKQVGLTLPPLTEEVVVEDKTFAIVKKLGEGGFSYVHLAREI-  68

Query  216  ADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLD  395
                          P  AS++  YA+K++LI   E    ++ EI V     HPN+LPLL 
Sbjct  69   --------------PDLASED--YALKRILIHEEEHQGAIQNEIDVMRALDHPNILPLL-  111

Query  396  HAVIAVKASEGQSW----KHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQL  563
            +A I    S         +  A L+FP ++DGT+ D AT  + + ++F+++ ++ I  QL
Sbjct  112  YAEIEPHRSPPPGARVFVRKRASLVFPAYLDGTMFDRATT-RPEADAFTSTQLMSIAAQL  170

Query  564  CAGLKHMHNFEP---SYAHNDVKPGNVLLTHRKGQPPL-----AILMDFGSARP  701
            C  L+ MH   P     AH DVK  NVLL   +  P       A+LMDFGSA+P
Sbjct  171  CDALECMHTLSPPLGPIAHRDVKLDNVLL---ESSPETEGGLKAVLMDFGSAKP  221



>ref|XP_005848000.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
 gb|EFN55898.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
Length=452

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 96/191 (50%), Gaps = 34/191 (18%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKE------ILADPAKPGVSKKFKDPSHASDNGTYAMK  296
            +   R R+VRQLGEGG+++VYLV+E      +LA PA                 G +A+K
Sbjct  58   LGARRLRVVRQLGEGGYSFVYLVREGAGSGGLLAAPA---------------GTGLFALK  102

Query  297  KVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD  476
            +VL    +QL   + E+       HP LLPLLD AV   +  +G S +    +LFPV+  
Sbjct  103  RVLCGGPDQLSEAQHEVATMRRLRHPCLLPLLDAAVREQRTPDGGS-RQVVLMLFPVYAQ  161

Query  477  GTLLDNATAMKAKKESFSTS------------DVLQIFRQLCAGLKHMHNFEPSYAHNDV  620
            G L D     + + +  +              +VLQ+F Q+CA L  MH+ EP  AH DV
Sbjct  162  GNLFDFIQEQRQQWQRLAAGPARAALRRQQLREVLQLFLQVCAALHSMHSMEPPLAHRDV  221

Query  621  KPGNVLLTHRK  653
            KP NVLL  R+
Sbjct  222  KPQNVLLRLRQ  232



>gb|ADE75600.1| unknown [Picea sitchensis]
Length=197

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  504  MKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMD  683
            MKAK E F+   VL IF+QLCAGLKHMH+F+P YAHNDVKPGNVL+T RK QPPLA+LMD
Sbjct  1    MKAKNEFFTPGIVLHIFKQLCAGLKHMHSFDPPYAHNDVKPGNVLITWRKSQPPLAVLMD  60

Query  684  FGSARP  701
            FGSA P
Sbjct  61   FGSAAP  66



>ref|XP_009045048.1| hypothetical protein LOTGIDRAFT_223991 [Lottia gigantea]
 gb|ESP04238.1| hypothetical protein LOTGIDRAFT_223991 [Lottia gigantea]
Length=313

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 107/211 (51%), Gaps = 35/211 (17%)
 Frame = +3

Query  66   KMGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSK  245
            +MGC F G  A++          +N+  F    +LGEGGF+YV LV+++           
Sbjct  6    RMGC-FCGKEAIH----------VNNRSFYTKSRLGEGGFSYVDLVEDV-----------  43

Query  246  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA-S  422
                    + +  YA+KK+   + +   +  EE+ V  LF H N++PL + AV+ +   +
Sbjct  44   --------NSHKLYALKKITCHSKDDERIALEEVEVMKLFKHDNIVPLEEAAVVPINVYT  95

Query  423  EGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPS  602
            + +    E  ++ P +  G++ D    +K K E  S  D+ ++F Q+C GLK MH+  P 
Sbjct  96   KMRDVVSEVLIIMPFYRRGSIEDQMERLKKKNEHMSEIDLWKMFLQICEGLKAMHHHNPP  155

Query  603  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSA  695
            YAH DVKP NV++    G     ILMD GSA
Sbjct  156  YAHRDVKPANVMI----GDDSTPILMDLGSA  182



>gb|KIY96099.1| serine/threonine kinase 16 [Monoraphidium neglectum]
Length=433

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 93/176 (53%), Gaps = 26/176 (15%)
 Frame = +3

Query  147  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL  326
            R+R + QLGEGG+A+VYLV+E+      P   +         D+   A+K++   + ++L
Sbjct  34   RYRAL-QLGEGGYAFVYLVREV------PTAQQPL------VDDAPLALKRINAASGDRL  80

Query  327  DLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWK--------HE---AYLLFPVHM  473
               K EI      SHPN LPLLDHAV A  A    S          HE     LLFP   
Sbjct  81   QQAKREIATMRALSHPNCLPLLDHAVCAGGAGAAASGGAGGGGRTPHEGCTVLLLFPAFE  140

Query  474  DGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            DGTL D    + A ++  +T DVL +F Q+CAG+ HMH+     AH D+KP N+L+
Sbjct  141  DGTLFDELQRLAAARQRLATQDVLDVFEQVCAGVAHMHSRR--IAHRDIKPHNILV  194



>ref|XP_007419860.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Python 
bivittatus]
Length=305

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + IN  R+ ++ +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTITINSKRYLLIHRLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + +       E+ +  LF HPN+LPL  HA++  K S     KHEA+LL P 
Sbjct  47   ALKRILCHDKDDRQEALHEVEMHLLFEHPNILPLCAHAMVE-KGS-----KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL     A++ K        +L IF  +C GL+ +HN    YAH D+KP NVLL +
Sbjct  101  LKRGTLWQEVEALRDKGSFMPEERILVIFHGICRGLQAIHN--KGYAHRDLKPTNVLLDN  158

Query  648  RKGQPPLAILMDFGS  692
             + QP   +LMD GS
Sbjct  159  -EDQP---LLMDLGS  169



>ref|XP_011456099.1| PREDICTED: serine/threonine-protein kinase 16-like [Crassostrea 
gigas]
Length=318

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 100/198 (51%), Gaps = 24/198 (12%)
 Frame = +3

Query  105  DAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT  284
            + V G   + IN+ RF I  +LGEGGF+YV L+++                   A ++  
Sbjct  12   NCVCGREALTINNRRFYIRNRLGEGGFSYVDLIED-------------------ARNHKD  52

Query  285  YAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV-KASEGQSWKHEAYLLF  461
            YA+K++   + E+  +  +E+ +   F HPN++PL + A I V K S+      E  ++ 
Sbjct  53   YALKRITCHSKEEERVAAQEVELMRRFKHPNIIPLEESANIKVSKYSKTLDILSEVLIVM  112

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P +  G++ D+   +  K E      +  +FR LC  +K  H+  P YAH D+KP NV++
Sbjct  113  PYYCRGSIQDHIDKLSKKSEKIPEEQIWTMFRGLCQAVKEFHSQNPPYAHRDIKPANVMI  172

Query  642  THRKGQPPLAILMDFGSA  695
                G P   ILMD GSA
Sbjct  173  AA-DGSP---ILMDLGSA  186



>ref|XP_008906617.1| NAK/MPSK protein kinase [Phytophthora parasitica INRA-310]
 gb|ETI45892.1| NAK/MPSK protein kinase [Phytophthora parasitica P1569]
 gb|ETK85822.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETL39252.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETL92375.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETM45669.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETN08329.1| NAK/MPSK protein kinase [Phytophthora parasitica INRA-310]
 gb|ETO74563.1| NAK/MPSK protein kinase [Phytophthora parasitica P1976]
 gb|ETP15723.1| NAK/MPSK protein kinase [Phytophthora parasitica CJ01A1]
 gb|ETP43757.1| NAK/MPSK protein kinase [Phytophthora parasitica P10297]
Length=339

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 110/228 (48%), Gaps = 43/228 (19%)
 Frame = +3

Query  51   PIARKKMG------CS------FSGLNALYDAVNGGGDVWINDNRFRIVR-QLGEGGFAY  191
            P+AR+  G      CS      F     L   +     + +   R  IV  ++ +GGF++
Sbjct  9    PVARQSPGATSSRICSAVTFFPFYAAQRLLSCLGYTHSIRMQSGRTVIVSSEIAQGGFSF  68

Query  192  VYLVKEILADPAKPGVSKKFKDPSHASDNG-TYAMKKVLIQNSEQLDLVKEEIRVSSLFS  368
            VY  ++                    +D G  +A+KK+L Q +EQ+ L K EI+    F+
Sbjct  69   VYKARD--------------------TDTGEAFALKKILCQTNEQVQLAKAEIQAHKAFA  108

Query  369  HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQ  548
            HPN++PL D+AV++           E YLLFP   +GTL D      ++      + +L 
Sbjct  109  HPNIMPLCDYAVVSTGVE-----MFEYYLLFPFMENGTLRDMINTAISQDVRIPEAQILD  163

Query  549  IFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS  692
            +F Q+C  +  +H+  P  AH D+KP NV+L+  +G+P   +L DFGS
Sbjct  164  MFLQICRAVAELHSKSPPLAHRDIKPENVMLSD-EGEP---LLTDFGS  207



>gb|AAN60358.1| unknown [Arabidopsis thaliana]
Length=149

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  243  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  422
            KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HP LLP LDHA+I+VK  
Sbjct  82   KKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPXLLPXLDHAIISVKDG  141

Query  423  EGQSWKH  443
               +WKH
Sbjct  142  XXGAWKH  148



>ref|XP_004997989.1| NAK/MPSK protein kinase [Salpingoeca rosetta]
 gb|EGD79033.1| NAK/MPSK protein kinase [Salpingoeca rosetta]
Length=313

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 102/209 (49%), Gaps = 24/209 (11%)
 Frame = +3

Query  69   MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  248
            MG     L+ L   V  G  V +   RF I ++L  GGF+ V LV ++           +
Sbjct  1    MGQGLGVLDCLAGVVGNGQTVEVGSRRFSIRKRLATGGFSNVDLVCDV-----------Q  49

Query  249  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  428
             KD         YAMK++L     ++   K E+    LF HPN++ +++  V++++ ++G
Sbjct  50   TKD--------MYAMKRMLCTEKAEVQRAKAEVEYYRLFDHPNIIQVVESGVLSLRRNQG  101

Query  429  QSWKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYA  608
             +   E   +FP++  GTLLD    +  +       ++L +F+ +C  L  MH       
Sbjct  102  -APSQEVVCVFPLYERGTLLDYVAHVHEQGGYLPEHELLTLFKGICLALDQMHTRVEPLC  160

Query  609  HNDVKPGNVLLTHRKGQPPLAILMDFGSA  695
            H D+KPGNVLL  R G P   +LMDFGS 
Sbjct  161  HRDIKPGNVLLA-RDGTP---VLMDFGSV  185



>ref|XP_003287685.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
 gb|EGC35791.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
Length=311

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 100/194 (52%), Gaps = 31/194 (16%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  314
            +N  ++ + R LGEGGF++VYLVK+                    S++  YA+K ++ Q 
Sbjct  15   VNGAKYTVNRVLGEGGFSFVYLVKD--------------------SNSRKYALKVMICQT  54

Query  315  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL---  485
            +E ++  K EI +   F+HPN++ L+DH+     +S+      +  LL P + DG+L   
Sbjct  55   NESINTAKREINIFKTFNHPNIMKLVDHS-----SSQYSQDGKQYLLLLPYYKDGSLQDL  109

Query  486  LDNATAMKAK---KESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG  656
            +DN   +  K   K  F    +L  F+++C  ++  H  EP  AH D+KPGN+LL +   
Sbjct  110  IDNQRIVHGKHTTKPLFDEKTLLIFFKKICEAIQVFHTHEPPLAHRDIKPGNILLANSND  169

Query  657  QPPLAILMDFGSAR  698
                 IL DFGS +
Sbjct  170  GILNPILTDFGSVK  183



>ref|XP_004067141.1| PREDICTED: serine/threonine-protein kinase 16 [Oryzias latipes]
 ref|XP_011489098.1| PREDICTED: serine/threonine-protein kinase 16 [Oryzias latipes]
Length=305

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CVCSRGSMTIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +FSHPN+L L+ H  +          K EA+LL P 
Sbjct  47   ALKRILCHDREGRKEAQTEVEMHQMFSHPNILSLVSHTFVDAGG------KTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQIFR +C+GLK +H  E  YAH D+KP NVLL  
Sbjct  101  MSKGSLWSVLEKLRDKGSSMPEKQILQIFRGICSGLKAIH--EKGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
             +   PL  LMD GS
Sbjct  158  -ENNKPL--LMDLGS  169



>ref|XP_004342629.1| serine/threonine protein kinase [Capsaspora owczarzaki ATCC 30864]
Length=340

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 104/230 (45%), Gaps = 55/230 (24%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT-  284
             +  G  V IN +   I + LGEGGF+ VYL                      A DN T 
Sbjct  8    CLGSGETVVINKHTLTIKQVLGEGGFSVVYL----------------------AEDNLTS  45

Query  285  --YAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLL  458
              YA+K++   + EQ      E+ +  +F H NL+ ++D A++  + +     K + Y++
Sbjct  46   RLYALKRMTCHDDEQQRDSMREVELYRMFDHENLMRVVDSAILPSRTNPNSHVK-DLYVM  104

Query  459  FPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP-------SYAHND  617
             P +  GTL D   A+KA    FS  ++L +FR +C G+K +H + P        YAH D
Sbjct  105  LPYYPRGTLQDRIEAVKAHGSQFSEREILSVFRGICLGVKALHQYTPPMRNNRMPYAHRD  164

Query  618  VKPGNVLLT-HRKGQPPLA---------------------ILMDFGSARP  701
            +KPGNVLL  H +   P A                     ILMDFGS  P
Sbjct  165  LKPGNVLLADHAESGAPFARSASASVPAGMADTPLDRLTPILMDFGSMAP  214



>ref|XP_010794760.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Notothenia 
coriiceps]
Length=320

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  21   CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  61

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+KK+L  + E     + E+ +  +F+HPN+L ++ H  +       +  K EA+LL P 
Sbjct  62   ALKKILCHDREGRQEAQTEMEMHQIFNHPNILSIVAHTFV------DRGGKTEAWLLLPY  115

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K+   S   +LQIFR +C+GLK MH  E  YAH D+KP NVLL  
Sbjct  116  IGKGSLWSVLEKLRDKRSLMSEKQILQIFRGICSGLKAMH--EKGYAHRDLKPTNVLLD-  172

Query  648  RKGQPPLAILMDFGS  692
             +   PL  LMD GS
Sbjct  173  -EDDRPL--LMDLGS  184



>ref|XP_010794761.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Notothenia 
coriiceps]
Length=305

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+KK+L  + E     + E+ +  +F+HPN+L ++ H  +       +  K EA+LL P 
Sbjct  47   ALKKILCHDREGRQEAQTEMEMHQIFNHPNILSIVAHTFV------DRGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K+   S   +LQIFR +C+GLK MH  E  YAH D+KP NVLL  
Sbjct  101  IGKGSLWSVLEKLRDKRSLMSEKQILQIFRGICSGLKAMH--EKGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
             +   PL  LMD GS
Sbjct  158  -EDDRPL--LMDLGS  169



>ref|NP_001004792.1| serine/threonine-protein kinase 16 [Xenopus (Silurana) tropicalis]
 gb|AAH74528.1| MGC69350 protein [Xenopus (Silurana) tropicalis]
Length=305

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I + R+  V +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGSITIENKRYFFVHKLGEGGFSYVDLVEGV-------------------QDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  LF+HPN+LPL+ H++I     +G  W  EA+LL P 
Sbjct  47   ALKRILCHDREDRKEAQHEVEMHRLFNHPNVLPLVAHSII----EKGPKW--EAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    ++ +    S   ++ I   +C GLK +H+    YAH D+KP NVLL  
Sbjct  101  VKGGTLWNQVEVLRDRNSFLSEDRIVHILHGICLGLKAIHD--RGYAHRDLKPTNVLL--  156

Query  648  RKGQPPLAILMDFGS  692
                 PL  LMD GS
Sbjct  157  EDDDRPL--LMDLGS  169



>dbj|GAM27617.1| hypothetical protein SAMD00019534_107930 [Acytostelium subglobosum 
LB1]
Length=306

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 96/193 (50%), Gaps = 33/193 (17%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  314
            IN  ++   R L EGGF++VYLVK+                    +    YA+K +L Q 
Sbjct  15   INGKKYICSRLLAEGGFSFVYLVKD--------------------ASGRRYALKSMLCQT  54

Query  315  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL---  485
            +E   +   EI+V + F+HPN+L L+DH+V      +G     E  +L P + DG+L   
Sbjct  55   AESEQVANREIQVFNKFNHPNILRLIDHSVCKSHKVQG---AKEYNMLMPFYKDGSLQDV  111

Query  486  LDNATAMKAKKESFSTSD---VLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG  656
            LD    +  K  + S  +   +L  FRQ+   +   H+ +P  AH D+KPGNVLL+  K 
Sbjct  112  LDRQRTVNGKDYTISIYNEHQLLTTFRQILDAIAQFHHCDPPLAHRDIKPGNVLLSDEKK  171

Query  657  QPPLAILMDFGSA  695
                 +LMDFGS 
Sbjct  172  ----PVLMDFGST  180



>ref|XP_004358442.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
 gb|EGG20592.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
Length=305

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 98/194 (51%), Gaps = 33/194 (17%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  314
            IN  R+   R LGEGGF++VYLVK+                    S    YA+K +L Q 
Sbjct  15   INGKRYTCSRLLGEGGFSFVYLVKD--------------------SSGKKYALKSMLCQT  54

Query  315  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL---  485
             E L++  +E+ +    +HPN++ ++D   I    S    +  E  +L P   +GTL   
Sbjct  55   PESLNVANKEVNLLRQLNHPNIIKVIDSDTI---NSVQLDYAKEVLILLPFCKEGTLQDV  111

Query  486  LDNATAMKAKK---ESFSTSDVLQIFRQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRK  653
            LD    +  K      F+ ++++ IF+QLC  +  +H+ +P+  AH D+KPGN+LL    
Sbjct  112  LDKQRTVNGKSCMISVFTQAEIINIFQQLCQAVLVLHSLQPTPLAHRDLKPGNILLEGEN  171

Query  654  GQPPLAILMDFGSA  695
             +P   IL+DFGS 
Sbjct  172  NKP---ILLDFGSV  182



>ref|XP_002504178.1| serine/threonine-protein kinase [Micromonas sp. RCC299]
 gb|ACO65436.1| serine/threonine-protein kinase [Micromonas sp. RCC299]
Length=391

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 101/218 (46%), Gaps = 47/218 (22%)
 Frame = +3

Query  126  DVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVL  305
            +V +   RF++ +QLGEGGF+YV+L +E+   P   GV                A+K++L
Sbjct  46   EVTVQGRRFQVQQQLGEGGFSYVFLAREV---PDSRGVD--------------VALKRML  88

Query  306  IQNSEQLDLVKEEIRVSSLFSHPNLLPLL------------DHAVIAVKA-----SEGQS  434
            I   EQ D    E+       HPNLLPL+               VIA  A          
Sbjct  89   IHEREQEDDALREMETMRRIDHPNLLPLILGEIEEEPHPPSTSYVIASPARTRPAGGAGG  148

Query  435  WKHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHN  614
                 +++FP   +GT LD   +    K +F+   +L I  QLC GL+HMH      AH 
Sbjct  149  GPRRCHMVFPAFPEGTALDRCVSRPVAK-AFTPLQLLGIGCQLCRGLEHMHAL--GIAHY  205

Query  615  DVKPGNVLLTH-------RKGQPP---LAILMDFGSAR  698
            DVKPGNVLL          +G  P    A+LMDFGSAR
Sbjct  206  DVKPGNVLLESVMDSMDGAEGSCPGGFRAVLMDFGSAR  243



>ref|XP_004262741.1| PREDICTED: serine/threonine-protein kinase 16 [Orcinus orca]
 ref|XP_004320388.1| PREDICTED: serine/threonine-protein kinase 16 [Tursiops truncatus]
Length=305

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEQLKDKGNFLTEEQILQLLLSICRGLEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003389271.2| PREDICTED: serine/threonine-protein kinase 16-like [Amphimedon 
queenslandica]
Length=302

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 97/193 (50%), Gaps = 29/193 (15%)
 Frame = +3

Query  120  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK  299
            G  + IN   +R+VR++GEGGF+YV LV+                      +   +A+K+
Sbjct  10   GRTLSINGESYRVVRRIGEGGFSYVDLVR--------------------GRNGEQFALKQ  49

Query  300  VLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG  479
            +LIQ  EQ + V+ EI +    +HPN+L L+D  +     +E  + +    LLFP +  G
Sbjct  50   LLIQVEEQRESVEREIYMHQTVTHPNVLQLVDSQI-----TEQGNGEARGLLLFPFYQYG  104

Query  480  TLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNF-EPSYAHNDVKPGNVLLTHRKG  656
            TL D   A  ++    S   +L +F   C GL  +H       AH D+KPGN+LL+  K 
Sbjct  105  TLEDEIEASMSRGRKISEERILNLFLSACQGLHALHTSGNEGLAHRDIKPGNLLLSDNKE  164

Query  657  QPPLAILMDFGSA  695
            +    ++MD GSA
Sbjct  165  E---LVIMDLGSA  174



>ref|XP_009525867.1| hypothetical protein PHYSODRAFT_459513, partial [Phytophthora 
sojae]
 gb|EGZ16809.1| hypothetical protein PHYSODRAFT_459513 [Phytophthora sojae]
Length=324

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 102/205 (50%), Gaps = 29/205 (14%)
 Frame = +3

Query  81   FSGLNALYDAVNGGGDVWINDNRFRIVR-QLGEGGFAYVYLVKEILADPAKPGVSKKFKD  257
            F     L   +     V +   R  +V  ++ +GGF++VY  ++   D  +P        
Sbjct  31   FYAAQRLLSCLGYSHSVRMQSGRTVVVSSEIAQGGFSFVYRARD--TDTGEP--------  80

Query  258  PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW  437
                     +A+KK+L Q  EQ+ L K EI+    F+HPN++PL D+AV+    S G   
Sbjct  81   ---------FALKKILCQTDEQVQLAKAEIQAHKSFAHPNIMPLSDYAVV----SSGPE-  126

Query  438  KHEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHND  617
              E YLLFP   +GTL +      ++      + +L +F Q+C  +  +H+  P  AH D
Sbjct  127  TFEYYLLFPFMENGTLREVINTAISQDVRIPEAQILDMFLQICRAVAELHSKSPPLAHRD  186

Query  618  VKPGNVLLTHRKGQPPLAILMDFGS  692
            +KP NV+L+  +G+P   +L DFGS
Sbjct  187  IKPENVMLSD-EGEP---LLTDFGS  207



>ref|XP_007519784.1| PREDICTED: serine/threonine-protein kinase 16 [Erinaceus europaeus]
Length=305

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVLDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+LPL+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILPLMAYCL------KERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  IKRGTLWNEIEKLKDKGNFLTEDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|EWM24320.1| serine threonine protein kinase [Nannochloropsis gaditana]
Length=401

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 95/190 (50%), Gaps = 29/190 (15%)
 Frame = +3

Query  144  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ  323
             + RIV+QL EGGF YV+L ++     A                   +A+K++L Q  EQ
Sbjct  38   RKVRIVKQLAEGGFGYVFLAQDRRTGEA-------------------FALKRMLCQTQEQ  78

Query  324  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD----  491
            +  VK E+     F HPNLLP++D  V      +  S     YLLFP    G+L D    
Sbjct  79   IYAVKREMLYHREFQHPNLLPVIDTHVQQQHRPQSGSTGIYVYLLFPYLSGGSLRDEIDR  138

Query  492  ---NATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP  662
               +  + +    ++    +L++FR +  G++H+H  EP++AH D+KP NVLL      P
Sbjct  139  RILSPLSRRGMLGAWPEDRLLRLFRDILLGVRHLHEHEPAFAHRDIKPENVLLKADGLTP  198

Query  663  PLAILMDFGS  692
               +L+DFGS
Sbjct  199  ---VLIDFGS  205



>ref|XP_010728226.1| PREDICTED: serine/threonine-protein kinase 16 [Larimichthys crocea]
Length=305

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K+VL  + E     + E+ +  +F+HPN+L L+ HA +       +  K EA+LL P 
Sbjct  47   ALKRVLCHDREGRQEAQTEMEMHQMFNHPNILSLVAHAFV------DRGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQI R +C+GLK +H  E  YAH D+KP NVLL  
Sbjct  101  ISKGSLWSVLEKLRDKGSSMPEKQILQILRGICSGLKAIH--EKGYAHRDLKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               +P   +LMD GS
Sbjct  159  -DDRP---VLMDLGS  169



>ref|NP_001087851.1| serine/threonine kinase 16 [Xenopus laevis]
 gb|AAH82377.1| MGC81705 protein [Xenopus laevis]
Length=305

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I + R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGSITIENKRYFFVQKLGEGGFSYVDLVEGV-------------------HDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  LF+HPN+L L+ H +I     +G  W  EA+LL P 
Sbjct  47   ALKRILCHDREDRKEAQHEVEMHRLFNHPNILSLVAHCII----EKGPKW--EAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    ++ K        ++ I  ++C GLK +H  +  YAH D+KP NVLL  
Sbjct  101  VKGGTLWNQVETLRDKNNFLPEDRIVHILHRICLGLKAIH--DRGYAHRDLKPTNVLL--  156

Query  648  RKGQPPLAILMDFGS  692
                 PL  LMD GS
Sbjct  157  EDDDRPL--LMDLGS  169



>ref|XP_007122499.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Physeter 
catodon]
Length=273

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEQLKDKGNFLTEEQILRLLLSICRGLEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_002895305.1| serine/threonine protein kinase [Phytophthora infestans T30-4]
 gb|EEY58784.1| serine/threonine protein kinase [Phytophthora infestans T30-4]
Length=327

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 113/229 (49%), Gaps = 46/229 (20%)
 Frame = +3

Query  51   PIARKKMG-----CSFSGLNALYDA------VNGGGDVWINDNRFRIVR-QLGEGGFAYV  194
            P+AR+        CS   L  LY A      +     V +   R  IV  ++ +GGF++V
Sbjct  9    PVARQSPDTSSRICSAVTLFPLYAAQRLLSCLGYTHSVRMQSGRTVIVSSEITQGGFSFV  68

Query  195  YLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHP  374
            Y  K I  D  +P                 +A+KK+L Q +EQ+ L K EI+    F+HP
Sbjct  69   Y--KAIDTDTGEP-----------------FALKKILCQTNEQVQLAKAEIQALKAFTHP  109

Query  375  NLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL---LDNATAMKAKKESFSTSDVL  545
            N++ L D+AV++  A        E YLLFP   +GTL   ++NA +   +        +L
Sbjct  110  NIMSLRDYAVVSTGAD-----SFEYYLLFPFMENGTLRTMINNAISQDVR---IPEVQIL  161

Query  546  QIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGS  692
             +F Q+C  +  +H+  P  AH D+KP NVLL+  +G+P   +L DFGS
Sbjct  162  DMFLQVCRAVAELHSKSPPLAHRDIKPENVLLSD-EGEP---LLTDFGS  206



>ref|XP_007188028.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=273

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEKLKDKGNFLTEEQILRLLLSICRGLEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006168692.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Tupaia 
chinensis]
 ref|XP_006168693.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Tupaia 
chinensis]
 gb|ELV10670.1| Serine/threonine-protein kinase 16 [Tupaia chinensis]
Length=305

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEHQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKKGTLWEEIERLKDKGSFLTEEQILQLLLGICRGLEAIHT--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003215036.1| PREDICTED: serine/threonine-protein kinase 16 [Anolis carolinensis]
Length=305

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 86/176 (49%), Gaps = 27/176 (15%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + IN+ R+  + +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTITINNKRYLSIHRLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K+++  + +       EI +  LF HPN+LPL  HAV+  K S     KHEA+LL P 
Sbjct  47   ALKRIVCHDKDDRQEAMHEIEMHQLFDHPNILPLCAHAVVE-KGS-----KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNV  635
               GTL     A+K K        +L I   LC GL+ +HN    YAH D+KP NV
Sbjct  101  LKRGTLWQEVEALKDKGAFMPEERILAILHGLCRGLQAIHN--KGYAHRDLKPTNV  154



>ref|XP_007122498.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Physeter 
catodon]
Length=305

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEQLKDKGNFLTEEQILRLLLSICRGLEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006168694.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Tupaia 
chinensis]
Length=273

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEHQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKKGTLWEEIERLKDKGSFLTEEQILQLLLGICRGLEAIHT--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_426593.1| PREDICTED: serine/threonine-protein kinase 16 isoformX2 [Gallus 
gallus]
Length=305

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 94/195 (48%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +   R+ ++++L EGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVSLGGARYLLLQRLAEGGFSYVDLVEGL-------------------RDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E       E+ + +LF HPN+L L  H ++   A      KHEA+LL P 
Sbjct  47   ALKRILCHDKEDRQAALREVEMHNLFQHPNILRLEAHCMVEKGA------KHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL     A++ K        +L I R +C+GL+ +H     YAH D+KP NVLL  
Sbjct  101  VKGGTLWSEVEALREKGTFMPEQRILLILRGICSGLQAIHG--KGYAHRDLKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               QP   ILMD GS
Sbjct  159  -DDQP---ILMDLGS  169



>ref|XP_004348721.1| serine/threonine protein kinase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22207.1| serine/threonine protein kinase [Acanthamoeba castellanii str. 
Neff]
Length=303

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 97/190 (51%), Gaps = 27/190 (14%)
 Frame = +3

Query  126  DVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNG-TYAMKKV  302
            ++ +N +  R +RQ+GEG ++ VY V E                    SD G  YA+K +
Sbjct  11   EIAVNRHIVRPIRQIGEGAYSQVYEVME--------------------SDTGDRYALKTM  50

Query  303  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGT  482
            L Q+   L+  K EI V +  +HPN++ L+DHA      S   +   +   LFP++  GT
Sbjct  51   LCQSPALLERAKLEIEVLTSCAHPNVVSLVDHAQ---STSTTAAASDQILFLFPLYRRGT  107

Query  483  LLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP  662
            L      M+A+ + +S   VL++F  LC GL  +H+  P   H D+K  NVLL+    Q 
Sbjct  108  LRAVLEEMEARNQRWSERQVLELFLGLCKGLAVLHSHSPPLVHRDLKCLNVLLSDDGRQ-  166

Query  663  PLAILMDFGS  692
              AILMDFGS
Sbjct  167  --AILMDFGS  174



>ref|XP_004942901.1| PREDICTED: serine/threonine-protein kinase 16 isoform X4 [Gallus 
gallus]
Length=321

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 94/195 (48%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +   R+ ++++L EGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVSLGGARYLLLQRLAEGGFSYVDLVEGL-------------------RDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E       E+ + +LF HPN+L L  H ++   A      KHEA+LL P 
Sbjct  47   ALKRILCHDKEDRQAALREVEMHNLFQHPNILRLEAHCMVEKGA------KHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL     A++ K        +L I R +C+GL+ +H     YAH D+KP NVLL  
Sbjct  101  VKGGTLWSEVEALREKGTFMPEQRILLILRGICSGLQAIHG--KGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
               QP   ILMD GS
Sbjct  158  EDDQP---ILMDLGS  169



>ref|XP_007188026.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007188027.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=305

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEKLKDKGNFLTEEQILRLLLSICRGLEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006763424.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Myotis 
davidii]
Length=273

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+                      D   Y
Sbjct  6    CICSPGTVIIDNKRYLFIQKLGEGGFSYVDLVEGF-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHHLFNHPNILHLVAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKRGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  158  DEGQP---VLMDLGSMK  171



>gb|AAV38392.1| serine/threonine kinase 16 [Homo sapiens]
Length=310

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + L+  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDLEEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003784978.1| PREDICTED: serine/threonine-protein kinase 16 [Otolemur garnettii]
Length=305

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   ILMD GS
Sbjct  159  -EGQP---ILMDLGS  169



>ref|XP_005883518.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Myotis 
brandtii]
 ref|XP_005883519.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Myotis 
brandtii]
 gb|EPQ18456.1| Serine/threonine-protein kinase 16 [Myotis brandtii]
Length=305

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 102/197 (52%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSPGIVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHHLFNHPNILHLVAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKRGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  159  -EGQP---VLMDLGSMK  171



>ref|XP_004762884.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mustela 
putorius furo]
 ref|XP_004762885.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mustela 
putorius furo]
 ref|XP_004762886.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Mustela 
putorius furo]
 ref|XP_004807201.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mustela 
putorius furo]
 ref|XP_004807202.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mustela 
putorius furo]
 ref|XP_004807203.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Mustela 
putorius furo]
Length=305

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   ILMD GS
Sbjct  159  -EGQP---ILMDLGS  169



>ref|XP_011231795.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ailuropoda 
melanoleuca]
Length=273

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEQILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_004674323.1| PREDICTED: serine/threonine-protein kinase 16 [Condylura cristata]
Length=308

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIMDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  K E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAKREADMHRLFQHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006082609.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Myotis 
lucifugus]
Length=273

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSPGIVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHHLFDHPNILHLVAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKRGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  158  DEGQP---VLMDLGSMK  171



>ref|XP_006763422.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Myotis 
davidii]
 ref|XP_006763423.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Myotis 
davidii]
 gb|ELK30541.1| Serine/threonine-protein kinase 16 [Myotis davidii]
Length=305

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+                      D   Y
Sbjct  6    CICSPGTVIIDNKRYLFIQKLGEGGFSYVDLVEGF-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHHLFNHPNILHLVAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKRGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  158  DEGQP---VLMDLGSMK  171



>ref|XP_003445781.1| PREDICTED: serine/threonine-protein kinase 16-like [Oreochromis 
niloticus]
Length=305

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V     + I++ ++  V++L EGGF++V LV+ +                    D   Y
Sbjct  6    CVCSRASIIIDNKKYYFVQKLDEGGFSFVDLVEGV-------------------KDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +F+HPN+L L+ HA +   A      K EA+LL P 
Sbjct  47   ALKRILCHDREGRQEAQTEVEMHQMFNHPNVLSLVAHAFVDHGA------KTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQIFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  MRKGSLWSVLEKLRDKGSSMPEKQILQIFRGICSGLKAIH--DKGYAHRDIKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               +P   +LMD GS
Sbjct  159  -DDRP---VLMDLGS  169



>ref|XP_008143361.1| PREDICTED: serine/threonine-protein kinase 16 [Eptesicus fuscus]
Length=305

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSPGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF+HPN+L L  + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHRLFNHPNILRLEAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKGGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  159  -EGQP---VLMDLGSMK  171



>ref|XP_005395633.1| PREDICTED: serine/threonine-protein kinase 16 isoform X6 [Chinchilla 
lanigera]
Length=273

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 35/197 (18%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  461
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P H  GTL      +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL
Sbjct  99   PFHKRGTLWSEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILL  156

Query  642  THRKGQPPLAILMDFGS  692
               +GQP   +LMD GS
Sbjct  157  G-DEGQP---VLMDLGS  169



>ref|XP_007560183.1| PREDICTED: serine/threonine-protein kinase 16 [Poecilia formosa]
Length=305

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 101/195 (52%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + +     + E+ +  +F+HPN+L L+ +A      S G   K EA+LL P 
Sbjct  47   ALKRILCHDRQARQEAQTEVEMHQMFNHPNILSLVAYAF---SDSGG---KTEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      ++ K  S   + +L+IFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  VRKGTLWSVLEKLRDKGSSMPENQILKIFRGICSGLKTIH--DKGYAHRDLKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
             + +P   +LMD GS
Sbjct  159  -EDRP---VLMDLGS  169



>ref|XP_545656.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Canis 
lupus familiaris]
Length=305

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006082607.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Myotis 
lucifugus]
 ref|XP_006082608.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Myotis 
lucifugus]
Length=305

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 31/197 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSPGIVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    + ++  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDVEEAQREADMHHLFDHPNILHLVAYCL------KERGTKHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +  ++LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  LKRGTLWNEIERLKDKGNFLTEDEILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGSAR  698
             +GQP   +LMD GS +
Sbjct  158  DEGQP---VLMDLGSMK  171



>ref|XP_008057071.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Tarsius 
syrichta]
Length=305

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILHLVAYCL------KERGPKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICTGLEAIH--AKGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  158  DEGQP---VLMDLGS  169



>ref|XP_002913702.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ailuropoda 
melanoleuca]
Length=305

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEQILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005395632.1| PREDICTED: serine/threonine-protein kinase 16 isoform X5 [Chinchilla 
lanigera]
Length=305

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 35/197 (18%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  461
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P H  GTL      +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL
Sbjct  99   PFHKRGTLWSEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILL  156

Query  642  THRKGQPPLAILMDFGS  692
               +GQP   +LMD GS
Sbjct  157  GD-EGQP---VLMDLGS  169



>ref|XP_008688657.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ursus 
maritimus]
Length=273

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEKILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008057070.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Tarsius 
syrichta]
Length=309

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILHLVAYCL------KERGPKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICTGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_007445878.1| PREDICTED: serine/threonine-protein kinase 16 [Lipotes vexillifer]
Length=305

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFRHPNILRLVAYCL------KERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL D    +K K    +   +L++   +C  L+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWDEIEQLKDKGNFLTEEQILRLLLSICRALEAIHA--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005395628.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005395629.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005395630.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005395631.1| PREDICTED: serine/threonine-protein kinase 16 isoform X4 [Chinchilla 
lanigera]
Length=332

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 35/197 (18%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  461
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P H  GTL      +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL
Sbjct  99   PFHKRGTLWSEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILL  156

Query  642  THRKGQPPLAILMDFGS  692
               +GQP   +LMD GS
Sbjct  157  GD-EGQP---VLMDLGS  169



>ref|XP_008057069.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Tarsius 
syrichta]
Length=341

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILHLVAYCL------KERGPKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICTGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008688654.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ursus 
maritimus]
 ref|XP_008688655.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ursus 
maritimus]
Length=305

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEKILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003991222.1| PREDICTED: serine/threonine-protein kinase 16 [Felis catus]
 ref|XP_006935655.1| PREDICTED: serine/threonine-protein kinase 16 [Felis catus]
 ref|XP_006935656.1| PREDICTED: serine/threonine-protein kinase 16 [Felis catus]
 ref|XP_006935657.1| PREDICTED: serine/threonine-protein kinase 16 [Felis catus]
 ref|XP_007086218.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007086219.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Panthera 
tigris altaica]
 ref|XP_007086220.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Panthera 
tigris altaica]
 ref|XP_007086221.1| PREDICTED: serine/threonine-protein kinase 16 isoform X4 [Panthera 
tigris altaica]
Length=305

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--ARGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005672285.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Sus 
scrofa]
Length=273

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------RDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIEKLKDKGNFLTEEQILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|NP_001253902.1| serine/threonine-protein kinase 16 [Macaca mulatta]
 ref|XP_007964536.1| PREDICTED: serine/threonine-protein kinase 16 [Chlorocebus sabaeus]
 ref|XP_007964537.1| PREDICTED: serine/threonine-protein kinase 16 [Chlorocebus sabaeus]
Length=305

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LFSHPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFSHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005574406.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Macaca 
fascicularis]
 ref|XP_005574407.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Macaca 
fascicularis]
Length=305

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LFSHPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFSHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_635157.1| hypothetical protein DDB_G0291350 [Dictyostelium discoideum AX4]
 sp|Q54ET3.1|Y6373_DICDI RecName: Full=Probable serine/threonine-protein kinase DDB_G0291350 
[Dictyostelium discoideum]
 gb|EAL61659.1| hypothetical protein DDB_G0291350 [Dictyostelium discoideum AX4]
Length=369

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 30/177 (17%)
 Frame = +3

Query  135  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  314
            IN  ++ + R LGEGGF++VYLVK+                    S++  YA+K ++ Q 
Sbjct  17   INGVKYTVNRILGEGGFSFVYLVKD-------------------NSNSKKYALKVMICQT  57

Query  315  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL---  485
             E ++  K EI     F+H N++ L+DH++    ++  Q  K E  LL P + DGTL   
Sbjct  58   QESINTAKREINAFQTFNHENIMKLIDHSI----SNHSQDTK-EYRLLLPYYKDGTLQDL  112

Query  486  LDNATAM---KAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
            +DN   +     KK  F     LQ F ++C  ++  HN  P  AH D+KPGN++L +
Sbjct  113  IDNQRTIYGKDTKKPLFKEKKCLQFFLKVCEAIQVFHNHSPPLAHRDIKPGNIVLQN  169



>ref|XP_004576867.1| PREDICTED: serine/threonine-protein kinase 16 [Ochotona princeps]
Length=305

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCLRERDA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWTEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008585681.1| PREDICTED: serine/threonine-protein kinase 16 [Galeopterus variegatus]
 ref|XP_008585682.1| PREDICTED: serine/threonine-protein kinase 16 [Galeopterus variegatus]
Length=305

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+L+  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILIGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005330559.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005330560.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ictidomys 
tridecemlineatus]
Length=305

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILRLLLGICRGLEAIHT--KGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005001103.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Cavia 
porcellus]
Length=273

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 35/197 (18%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  461
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGSKHEAWLLL  98

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P +  GTL      +K K    S   +L +   +C GL+ +H     YAH D+KP N+LL
Sbjct  99   PFYKRGTLWSEIERLKDKGNFLSEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILL  156

Query  642  THRKGQPPLAILMDFGS  692
               +GQP   +LMD GS
Sbjct  157  G-DEGQP---VLMDLGS  169



>ref|XP_005724188.1| PREDICTED: serine/threonine-protein kinase 16-like [Pundamilia 
nyererei]
Length=305

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V     + I++ ++  V++L EGGF++V LV+ +                    D   Y
Sbjct  6    CVCSRASITIDNKKYYFVQKLDEGGFSFVDLVEGV-------------------KDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +F+HPN+L L+ H+ +          K EA+LL P 
Sbjct  47   ALKRILCHDREGRQEAQTEVEMHQMFNHPNVLSLVAHSFV------DHGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQIFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  MRKGSLWSVLEKLRDKGSSMPEKLILQIFRGICSGLKAIH--DKGYAHRDIKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               +P   +LMDFGS
Sbjct  159  -DDRP---VLMDFGS  169



>ref|XP_003464049.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Cavia 
porcellus]
 ref|XP_005001102.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Cavia 
porcellus]
Length=305

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 35/197 (18%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  461
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGSKHEAWLLL  98

Query  462  PVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLL  641
            P +  GTL      +K K    S   +L +   +C GL+ +H     YAH D+KP N+LL
Sbjct  99   PFYKRGTLWSEIERLKDKGNFLSEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILL  156

Query  642  THRKGQPPLAILMDFGS  692
               +GQP   +LMD GS
Sbjct  157  GD-EGQP---VLMDLGS  169



>ref|XP_001928241.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Sus 
scrofa]
 ref|XP_005672284.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Sus 
scrofa]
Length=305

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------RDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIEKLKDKGNFLTEEQILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008528199.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Equus 
przewalskii]
Length=273

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCL------KERGAKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWTEIERLKDKGNFLTQDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008528196.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Equus 
przewalskii]
 ref|XP_008528197.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Equus 
przewalskii]
Length=305

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWTEIERLKDKGNFLTQDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006906757.1| PREDICTED: serine/threonine-protein kinase 16 [Pteropus alecto]
 gb|ELK17182.1| Serine/threonine-protein kinase 16 [Pteropus alecto]
Length=305

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKSNFLTEEQILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLG-  157

Query  648  RKGQPPLAILMDFGS  692
              GQP   +LMD GS
Sbjct  158  DGGQP---VLMDLGS  169



>ref|XP_005153910.1| PREDICTED: serine/threonine-protein kinase 16 [Melopsittacus 
undulatus]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 93/195 (48%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +   R+ ++ +L EGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVSLGGARYLVLHRLAEGGFSYVDLVEGL-------------------RDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E       E+ +  LF HPN+L L+ H ++   A      KHEA+LL P 
Sbjct  47   ALKRILCHDKEDHQAALREVEMHGLFDHPNILRLVAHCMVEKGA------KHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL     A++ K        +L I   +C+GL+ +H+    YAH D+KP NVLL  
Sbjct  101  VKGGTLWSEVEALRKKGNFMPEQRILHILHGICSGLQAIHS--KGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
               QP   +LMD GS
Sbjct  158  EDDQP---LLMDLGS  169



>ref|XP_004638249.1| PREDICTED: serine/threonine-protein kinase 16 [Octodon degus]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 96/192 (50%), Gaps = 35/192 (18%)
 Frame = +3

Query  123  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV  302
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct  11   GTVLIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI  51

Query  303  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLFPVHMD  476
            L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL P +  
Sbjct  52   LCHEQQDQEEAQREADMHRLFHHPNILHLVAYCL--------KEWGTKHEAWLLLPFYKK  103

Query  477  GTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKG  656
            GTL      +K K    S   +L +   +C GL+ +H     YAH D+KP N+LL   +G
Sbjct  104  GTLWSEIERLKDKGNFLSEEQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLG-DEG  160

Query  657  QPPLAILMDFGS  692
            QP   +LMD GS
Sbjct  161  QP---VLMDLGS  169



>ref|XP_010610139.1| PREDICTED: serine/threonine-protein kinase 16 [Fukomys damarensis]
 ref|XP_010610140.1| PREDICTED: serine/threonine-protein kinase 16 [Fukomys damarensis]
 gb|KFO20162.1| Serine/threonine-protein kinase 16 [Fukomys damarensis]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFHHPNILHLVAYCL------KERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
            +  GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  YKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_006780460.1| PREDICTED: serine/threonine-protein kinase 16-like [Neolamprologus 
brichardi]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V     + I++ ++  V++L EGGF++V LV+ +                    D   Y
Sbjct  6    CVCSRASITIDNKKYYFVQKLDEGGFSFVDLVEGV-------------------KDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +F+HPN+L L+ HA +          K EA+LL P 
Sbjct  47   ALKRILCHDREGRQEAQTEVDMHQMFNHPNVLSLVAHAFV------DHGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQIFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  MRKGSLWSVLEKLRDKGSSMPEKQILQIFRGICSGLKTIH--DKGYAHRDIKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               +P   +LMD GS
Sbjct  159  -DDRP---VLMDLGS  169



>ref|XP_011356864.1| PREDICTED: serine/threonine-protein kinase 16 [Pteropus vampyrus]
 ref|XP_011356865.1| PREDICTED: serine/threonine-protein kinase 16 [Pteropus vampyrus]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEEQILQLLLGICRGLEAIH--AQGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
              GQP   +LMD GS
Sbjct  159  -GGQP---VLMDLGS  169



>ref|XP_001493234.1| PREDICTED: serine/threonine-protein kinase 16 [Equus caballus]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHHLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      +K K    +   +LQ+   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWTEIERLKDKGNFLTQDQILQLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008823981.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Nannospalax 
galili]
Length=273

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        Q  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFHHPNVLRLVAYCL------REQGAKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQDNFLTEDQILRLLLGICRGLEAIHG--KGYAHRDLKPTNILLDD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008823979.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Nannospalax 
galili]
 ref|XP_008823980.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Nannospalax 
galili]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        Q  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFHHPNVLRLVAYCL------REQGAKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQDNFLTEDQILRLLLGICRGLEAIHG--KGYAHRDLKPTNILLDD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_004662965.1| PREDICTED: serine/threonine-protein kinase 16 [Jaculus jaculus]
Length=305

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L++   +C GL+ +H     YAH D+KP N+LL+ 
Sbjct  101  FKRGTLWNEIERLKDQGNFLTEDQILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLSD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|EGW11867.1| Serine/threonine-protein kinase 16 [Cricetulus griseus]
Length=213

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  D  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQDEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|EDL75404.1| serine/threonine kinase 16, isoform CRA_b [Rattus norvegicus]
Length=205

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008402689.1| PREDICTED: serine/threonine-protein kinase 16 [Poecilia reticulata]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 101/195 (52%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGQFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + +     + E+ +  +F+HPN+L L+ +A      S G   K EA+LL P 
Sbjct  47   ALKRILCHDRQARQEAQTEVEMHQMFNHPNILSLVAYAF---SDSGG---KTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S   + +L+IFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  VRKGSLWSVLEKLRDKGSSMPENQILKIFRGICSGLKTIH--DKGYAHRDLKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
             + +P   +LMD GS
Sbjct  159  -EDRP---VLMDLGS  169



>ref|XP_002749858.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 ref|XP_008997780.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 ref|XP_008997781.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 gb|ABY89799.1| serine/threonine kinase 16, isoform 2 (predicted) [Callithrix 
jacchus]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFNHPNILHLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_002712533.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257430.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257431.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257432.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257433.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257434.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCLRERDA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL      +K K    +  ++L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWAEIERLKDKGSFLTEDEILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_008290775.1| PREDICTED: serine/threonine-protein kinase 16 [Stegastes partitus]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 95/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSLTIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +F+HPN+L L+ H  +          K EA+LL P 
Sbjct  47   ALKRILCHDREGRQEAQTEMEMHQMFNHPNVLSLVAHTFV------DHGGKSEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K        +LQIFR +C+GLK +H  E  YAH D+KP NVLL  
Sbjct  101  VRKGSLWSVLEKLRDKGSLMPEKQILQIFRGICSGLKAIH--EKGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
               +    +LMD GS
Sbjct  158  ---EDDRPVLMDLGS  169



>ref|XP_004876210.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004876211.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004876212.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004864601.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864602.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004864603.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Heterocephalus 
glaber]
 gb|EHA97559.1| Serine/threonine-protein kinase 16 [Heterocephalus glaber]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHHLFYHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
            +  GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  YKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005935306.1| PREDICTED: serine/threonine-protein kinase 16-like [Haplochromis 
burtoni]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V     + I++ ++  V++L EGGF++V LV+ +                    D   Y
Sbjct  6    CVCSRASITIDNKKYYFVQKLDEGGFSFVDLVEGV-------------------KDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  +F+HPN+L L+ H+ +          K EA+LL P 
Sbjct  47   ALKRILCHDREGRQEAQTEVEMHQMFNHPNVLSLVAHSFV------DHGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +LQIFR +C+GLK +H  +  YAH D+KP NVLL  
Sbjct  101  MRKGSLWSVLEKLRDKGSSMPEKQILQIFRGICSGLKAIH--DKGYAHRDIKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
               +P   +LMD GS
Sbjct  159  -DDRP---VLMDLGS  169



>gb|AAQ02488.1| serine/threonine kinase 16, partial [synthetic construct]
Length=306

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003272445.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
16 [Nomascus leucogenys]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVTIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>emb|CAA06700.1| PKL12 protein [Homo sapiens]
Length=310

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|ACQ58215.1| Serine/threonine-protein kinase 16 [Anoplopoma fimbria]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +   G + I++ ++  V++L EGGF+YV LV+                    A D   Y
Sbjct  6    CICSRGSITIDNKKYYFVQKLDEGGFSYVDLVE-------------------GAKDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L ++ E     + E+ +  +F+HPN+L L+ +  +      G+  K EA+LL P 
Sbjct  47   ALKRILCRDREGHQEAQTEVEMHQIFNHPNVLSLVANTFV------GRGGKTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               G+L      ++ K  S     +L I R +C+GLK +H  E  YAH D+KP NVLL  
Sbjct  101  IRKGSLWSVLEKLRDKGSSMPEKQILHILRGICSGLKAIH--EKGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
             +   PL  LMD GS
Sbjct  158  -EDDRPL--LMDLGS  169



>ref|XP_010358600.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
 ref|XP_010358601.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
 ref|XP_010358602.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|AAC28337.1| myristilated and palmitylated serine-threonine kinase MPSK [Homo 
sapiens]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003818698.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pan 
paniscus]
 ref|XP_003818699.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pan 
paniscus]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>gb|AAH02618.1| Serine/threonine kinase 16 [Homo sapiens]
 emb|CAG28603.1| STK16 [Homo sapiens]
 gb|ACE86734.1| serine/threonine kinase 16 protein [synthetic construct]
 gb|AIC55438.1| STK16, partial [synthetic construct]
 gb|AIC62641.1| STK16, partial [synthetic construct]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>emb|CAA09387.1| serine/threonine kinase [Homo sapiens]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_001162451.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Pan 
troglodytes]
 ref|XP_001162494.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Pan 
troglodytes]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|NP_001008910.1| serine/threonine-protein kinase 16 [Homo sapiens]
 ref|XP_002812932.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pongo 
abelii]
 ref|XP_004033297.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004033298.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Gorilla 
gorilla gorilla]
 sp|O75716.4|STK16_HUMAN RecName: Full=Serine/threonine-protein kinase 16; AltName: Full=Myristoylated 
and palmitoylated serine/threonine-protein 
kinase; Short=MPSK; AltName: Full=Protein kinase PKL12; AltName: 
Full=TGF-beta-stimulated factor 1; Short=TSF-1; AltName: 
Full=Tyrosine-protein kinase STK16; AltName: Full=hPSK [Homo 
sapiens]
 gb|AAG23728.1|AF203910_1 serine/threonine kinase KRCT [Homo sapiens]
 dbj|BAB16311.1| F5-2 [Homo sapiens]
 gb|AAH53998.1| Serine/threonine kinase 16 [Homo sapiens]
 gb|EAW70714.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
 gb|EAW70717.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
 gb|AIC50153.1| STK16, partial [synthetic construct]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>dbj|BAF85383.1| unnamed protein product [Homo sapiens]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_005519774.1| PREDICTED: serine/threonine-protein kinase 16 [Pseudopodoces 
humilis]
Length=305

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 92/195 (47%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V +   R+ ++ +L EGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVSLGGARYLLLHRLAEGGFSYVDLVEGL-------------------RDGRFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E       E+ +  LF HPN+L L+ H ++   A      KHEA+LL P 
Sbjct  47   ALKRILCHDKEDRQAALHEVEMHGLFDHPNILRLVAHCMVEKGA------KHEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL     A++ K        +L I   +C GL+ +H+    YAH D+KP NVLL  
Sbjct  101  VKGGTLWREVEALREKGTFMPEQRILHILHGICRGLQAIHS--KGYAHRDLKPTNVLLD-  157

Query  648  RKGQPPLAILMDFGS  692
               QP   +LMD GS
Sbjct  158  EDDQP---VLMDLGS  169



>ref|XP_008467843.1| PREDICTED: serine/threonine-protein kinase 16 [Diaphorina citri]
Length=322

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 100/208 (48%), Gaps = 27/208 (13%)
 Frame = +3

Query  87   GLNALYD--AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDP  260
            GLN ++    +     V++  +++ IV ++GEGGF+ V L++                  
Sbjct  5    GLNLIFQMGCLCSKEAVYVKSDKYYIVEKIGEGGFSTVSLIE------------------  46

Query  261  SHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWK  440
             H+     YA+KK++    E       E+     F HPN+LPLLDHA+    A    +  
Sbjct  47   -HSQTKKRYALKKIICHGREDQAQAIREVEHHKTFVHPNILPLLDHALTGC-ADPVLNST  104

Query  441  HEAYLLFPVHMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEP-SYAHND  617
             +  ++ P +  GTL ++       K   S+ D+L++F ++C  +K  H+ +P +YAH D
Sbjct  105  SQVLMVLPYYPKGTLANDLELRSVGKHYMSSVDILKMFLKICEAVKVFHDAKPIAYAHRD  164

Query  618  VKPGNVLLTHRKGQPPLAILMDFGSARP  701
            +K  NVLL +        +LMD GS  P
Sbjct  165  LKTANVLLANDNN----PLLMDLGSVAP  188



>ref|XP_007646375.1| PREDICTED: serine/threonine-protein kinase 16 [Cricetulus griseus]
 ref|XP_007614240.1| PREDICTED: serine/threonine-protein kinase 16 [Cricetulus griseus]
 gb|ERE86579.1| serine/threonine-protein kinase 16-like protein [Cricetulus griseus]
Length=305

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  D  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQDEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_004402801.1| PREDICTED: serine/threonine-protein kinase 16 [Odobenus rosmarus 
divergens]
Length=305

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 96/195 (49%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+   +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFRHPNILRLVASCL------RERGTKHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +LQ+   +C GL+ +H     +AH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILQLLLGICRGLEAIH--ARGFAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



>ref|XP_003969924.1| PREDICTED: serine/threonine-protein kinase 16-like [Takifugu 
rubripes]
Length=300

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             +     + I + ++  V++L EGGF+YV  V+                    A D   Y
Sbjct  6    CICSPSSITIENKKYYFVQKLAEGGFSYVDKVE-------------------GAKDGHYY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L  + E     + E+ +  LF+HPN+L L+ H  I +        K EA+LL P 
Sbjct  47   AVKRILCHDREGRQEAQTEVEMHQLFNHPNILTLVAHTFIDIGG------KTEAWLLLPY  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
              +GTL      ++ + +    ++VL+I   +C+GLK MH+    YAH D+KP NVLL  
Sbjct  101  FTNGTLWCLLEKLRDRAKFLCENEVLEILHGICSGLKAMHD--KGYAHRDLKPTNVLLDE  158

Query  648  RKGQPPLAILMDFGS  692
             + +P   +LMD GS
Sbjct  159  -ENRP---VLMDLGS  169



>ref|XP_010334582.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334583.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334584.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334585.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=351

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFNHPNVLHLVAYCLRERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K K    +   +L++   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDKGNFLTEDQILRLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
              GQP   +LMD GS
Sbjct  159  -DGQP---VLMDLGS  169



>ref|XP_006245222.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Rattus 
norvegicus]
Length=273

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (50%), Gaps = 31/195 (16%)
 Frame = +3

Query  108  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  287
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  288  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  467
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  468  HMDGTLLDNATAMKAKKESFSTSDVLQIFRQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH  647
               GTL +    +K +    +   +L +   +C GL+ +H     YAH D+KP N+LL  
Sbjct  101  FKRGTLWNEIERLKDQGNFLTEDQILPLLLGICRGLEAIH--AKGYAHRDLKPTNILLGD  158

Query  648  RKGQPPLAILMDFGS  692
             +GQP   +LMD GS
Sbjct  159  -EGQP---VLMDLGS  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335