BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021I05

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594055.1|  PREDICTED: nicotinamide adenine dinucleotide...    240   9e-75   Nicotiana tomentosiformis
ref|XP_002273574.1|  PREDICTED: nicotinamide adenine dinucleotide...    240   1e-74   Vitis vinifera
ref|XP_009784346.1|  PREDICTED: nicotinamide adenine dinucleotide...    238   7e-74   Nicotiana sylvestris
ref|XP_010559180.1|  PREDICTED: nicotinamide adenine dinucleotide...    229   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_006359875.1|  PREDICTED: nicotinamide adenine dinucleotide...    229   2e-70   Solanum tuberosum [potatoes]
ref|XP_010103406.1|  Mitochondrial substrate carrier family prote...    228   6e-70   Morus notabilis
ref|XP_007051022.1|  NAD+ transporter 1                                 227   1e-69   
gb|EYU46767.1|  hypothetical protein MIMGU_mgv1a010350mg                226   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_002523136.1|  mitochondrial carrier protein, putative            224   1e-68   Ricinus communis
ref|XP_010326568.1|  PREDICTED: nicotinamide adenine dinucleotide...    223   6e-68   Solanum lycopersicum
ref|XP_011082440.1|  PREDICTED: nicotinamide adenine dinucleotide...    222   7e-68   Sesamum indicum [beniseed]
ref|XP_006294636.1|  hypothetical protein CARUB_v10023674mg             223   8e-68   Capsella rubella
ref|XP_007200447.1|  hypothetical protein PRUPE_ppa008929mg             223   9e-68   Prunus persica
gb|KDO87105.1|  hypothetical protein CISIN_1g021150mg                   221   2e-67   Citrus sinensis [apfelsine]
gb|KJB06733.1|  hypothetical protein B456_001G141500                    221   2e-67   Gossypium raimondii
ref|XP_008807764.1|  PREDICTED: nicotinamide adenine dinucleotide...    221   2e-67   Phoenix dactylifera
ref|XP_008235160.1|  PREDICTED: nicotinamide adenine dinucleotide...    221   3e-67   Prunus mume [ume]
gb|KDP28207.1|  hypothetical protein JCGZ_13978                         221   3e-67   Jatropha curcas
ref|XP_007163152.1|  hypothetical protein PHAVU_001G210600g             220   6e-67   Phaseolus vulgaris [French bean]
gb|KHG29129.1|  Mitochondrial nicotinamide adenine dinucleotide t...    219   2e-66   Gossypium arboreum [tree cotton]
ref|XP_010905689.1|  PREDICTED: nicotinamide adenine dinucleotide...    218   3e-66   
ref|XP_010905688.1|  PREDICTED: nicotinamide adenine dinucleotide...    218   4e-66   Elaeis guineensis
ref|XP_006480018.1|  PREDICTED: nicotinamide adenine dinucleotide...    218   4e-66   Citrus sinensis [apfelsine]
ref|XP_002880307.1|  mitochondrial substrate carrier family protein     218   6e-66   
ref|XP_010518450.1|  PREDICTED: nicotinamide adenine dinucleotide...    218   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010507885.1|  PREDICTED: nicotinamide adenine dinucleotide...    218   8e-66   Camelina sativa [gold-of-pleasure]
emb|CDP17096.1|  unnamed protein product                                217   1e-65   Coffea canephora [robusta coffee]
gb|KDO87104.1|  hypothetical protein CISIN_1g021150mg                   217   1e-65   Citrus sinensis [apfelsine]
ref|XP_010523970.1|  PREDICTED: nicotinamide adenine dinucleotide...    217   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_011041851.1|  PREDICTED: nicotinamide adenine dinucleotide...    217   2e-65   Populus euphratica
ref|NP_566102.1|  NAD+ transporter 1                                    216   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320327.1|  mitochondrial substrate carrier family protein     214   1e-64   
ref|XP_004495929.1|  PREDICTED: nicotinamide adenine dinucleotide...    214   1e-64   Cicer arietinum [garbanzo]
ref|XP_010506785.1|  PREDICTED: nicotinamide adenine dinucleotide...    214   1e-64   
ref|XP_011079611.1|  PREDICTED: nicotinamide adenine dinucleotide...    214   2e-64   Sesamum indicum [beniseed]
gb|KFK37525.1|  hypothetical protein AALP_AA4G268400                    212   9e-64   Arabis alpina [alpine rockcress]
ref|XP_010259426.1|  PREDICTED: nicotinamide adenine dinucleotide...    212   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_002302737.1|  mitochondrial substrate carrier family protein     211   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010507884.1|  PREDICTED: nicotinamide adenine dinucleotide...    211   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_011007801.1|  PREDICTED: nicotinamide adenine dinucleotide...    211   3e-63   Populus euphratica
ref|XP_008451527.1|  PREDICTED: LOW QUALITY PROTEIN: nicotinamide...    210   4e-63   Cucumis melo [Oriental melon]
ref|XP_003554533.1|  PREDICTED: nicotinamide adenine dinucleotide...    210   8e-63   Glycine max [soybeans]
ref|XP_004136010.1|  PREDICTED: mitochondrial substrate carrier f...    208   2e-62   Cucumis sativus [cucumbers]
ref|XP_003521580.1|  PREDICTED: nicotinamide adenine dinucleotide...    207   6e-62   Glycine max [soybeans]
ref|XP_009414905.1|  PREDICTED: nicotinamide adenine dinucleotide...    206   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006397944.1|  hypothetical protein EUTSA_v10001547mg             204   2e-60   Eutrema salsugineum [saltwater cress]
gb|AES61717.2|  substrate carrier family protein                        203   3e-60   Medicago truncatula
ref|NP_001055296.1|  Os05g0357200                                       202   7e-60   
ref|XP_009414904.1|  PREDICTED: nicotinamide adenine dinucleotide...    202   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE63395.1|  hypothetical protein OsJ_18207                          202   8e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KJB06737.1|  hypothetical protein B456_001G141500                    201   1e-59   Gossypium raimondii
ref|XP_009142527.1|  PREDICTED: nicotinamide adenine dinucleotide...    201   1e-59   Brassica rapa
ref|XP_004962357.1|  PREDICTED: nicotinamide adenine dinucleotide...    200   6e-59   Setaria italica
ref|XP_006444424.1|  hypothetical protein CICLE_v10024227mg             199   1e-58   
gb|KEH24418.1|  substrate carrier family protein                        199   2e-58   Medicago truncatula
emb|CDY57720.1|  BnaC04g51920D                                          198   2e-58   Brassica napus [oilseed rape]
gb|AFW81643.1|  hypothetical protein ZEAMMB73_626020                    195   3e-58   
ref|XP_006654293.1|  PREDICTED: nicotinamide adenine dinucleotide...    198   3e-58   Oryza brachyantha
ref|XP_004494928.1|  PREDICTED: nicotinamide adenine dinucleotide...    198   3e-58   
ref|XP_002439632.1|  hypothetical protein SORBIDRAFT_09g017280          198   4e-58   Sorghum bicolor [broomcorn]
gb|EPS67920.1|  hypothetical protein M569_06852                         197   5e-58   Genlisea aurea
ref|XP_006855345.1|  hypothetical protein AMTR_s00057p00101290          197   8e-58   Amborella trichopoda
ref|XP_010684596.1|  PREDICTED: nicotinamide adenine dinucleotide...    197   8e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008647348.1|  PREDICTED: uncharacterized protein LOC100192...    197   9e-58   Zea mays [maize]
ref|XP_010518451.1|  PREDICTED: nicotinamide adenine dinucleotide...    196   1e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001146478.1|  uncharacterized protein LOC100280066               196   2e-57   Zea mays [maize]
ref|NP_001131441.1|  uncharacterized protein LOC100192773               191   1e-55   Zea mays [maize]
ref|XP_009383545.1|  PREDICTED: nicotinamide adenine dinucleotide...    188   1e-54   
ref|XP_009383544.1|  PREDICTED: nicotinamide adenine dinucleotide...    189   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782321.1|  PREDICTED: nicotinamide adenine dinucleotide...    184   3e-52   Phoenix dactylifera
ref|XP_003568632.1|  PREDICTED: nicotinamide adenine dinucleotide...    183   3e-52   Brachypodium distachyon [annual false brome]
dbj|BAJ85199.1|  predicted protein                                      183   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89038.1|  predicted protein                                      183   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU15209.1|  unknown                                                 176   8e-52   Glycine max [soybeans]
gb|KEH24419.1|  substrate carrier family protein                        179   7e-51   Medicago truncatula
ref|XP_009409783.1|  PREDICTED: nicotinamide adenine dinucleotide...    178   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842368.1|  hypothetical protein AMTR_s00079p00187170          177   4e-50   
ref|XP_002527012.1|  mitochondrial carrier protein, putative            178   5e-50   Ricinus communis
ref|XP_010264768.1|  PREDICTED: nicotinamide adenine dinucleotide...    177   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010279335.1|  PREDICTED: nicotinamide adenine dinucleotide...    176   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_003591466.1|  Mitochondrial folate transporter/carrier           176   6e-49   
ref|XP_010925998.1|  PREDICTED: nicotinamide adenine dinucleotide...    175   7e-49   Elaeis guineensis
gb|KJB48099.1|  hypothetical protein B456_008G053500                    169   5e-48   Gossypium raimondii
gb|KJB48097.1|  hypothetical protein B456_008G053500                    169   1e-46   Gossypium raimondii
ref|XP_010906994.1|  PREDICTED: nicotinamide adenine dinucleotide...    166   3e-46   Elaeis guineensis
ref|XP_010906993.1|  PREDICTED: nicotinamide adenine dinucleotide...    166   4e-46   Elaeis guineensis
ref|XP_010922196.1|  PREDICTED: nicotinamide adenine dinucleotide...    166   8e-46   Elaeis guineensis
gb|KHG03180.1|  Mitochondrial substrate carrier family protein W        166   1e-45   Gossypium arboreum [tree cotton]
ref|XP_006344160.1|  PREDICTED: nicotinamide adenine dinucleotide...    164   5e-45   Solanum tuberosum [potatoes]
ref|XP_008792834.1|  PREDICTED: nicotinamide adenine dinucleotide...    163   7e-45   
ref|XP_004516758.1|  PREDICTED: nicotinamide adenine dinucleotide...    164   7e-45   Cicer arietinum [garbanzo]
ref|XP_004147114.1|  PREDICTED: mitochondrial substrate carrier f...    164   8e-45   Cucumis sativus [cucumbers]
ref|XP_007044248.1|  NAD+ transporter 2 isoform 1                       164   8e-45   
ref|XP_010644204.1|  PREDICTED: nicotinamide adenine dinucleotide...    164   1e-44   Vitis vinifera
ref|XP_007044249.1|  NAD+ transporter 2 isoform 2                       164   1e-44   
ref|XP_004238908.1|  PREDICTED: nicotinamide adenine dinucleotide...    164   1e-44   Solanum lycopersicum
gb|KCW86128.1|  hypothetical protein EUGRSUZ_B02821                     161   2e-44   Eucalyptus grandis [rose gum]
ref|XP_011022458.1|  PREDICTED: nicotinamide adenine dinucleotide...    164   2e-44   Populus euphratica
ref|XP_010046517.1|  PREDICTED: nicotinamide adenine dinucleotide...    162   2e-44   
gb|KDP29452.1|  hypothetical protein JCGZ_18373                         163   2e-44   Jatropha curcas
ref|XP_002311469.1|  mitochondrial substrate carrier family protein     163   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007153374.1|  hypothetical protein PHAVU_003G029900g             162   3e-44   Phaseolus vulgaris [French bean]
ref|XP_010922189.1|  PREDICTED: nicotinamide adenine dinucleotide...    161   4e-44   
ref|XP_011007410.1|  PREDICTED: nicotinamide adenine dinucleotide...    162   6e-44   Populus euphratica
ref|XP_004299043.1|  PREDICTED: nicotinamide adenine dinucleotide...    162   8e-44   Fragaria vesca subsp. vesca
gb|KHN47916.1|  Mitochondrial substrate carrier family protein W        160   2e-43   Glycine soja [wild soybean]
ref|XP_006587243.1|  PREDICTED: nicotinamide adenine dinucleotide...    160   2e-43   Glycine max [soybeans]
ref|XP_008467192.1|  PREDICTED: nicotinamide adenine dinucleotide...    160   3e-43   Cucumis melo [Oriental melon]
ref|XP_010681639.1|  PREDICTED: nicotinamide adenine dinucleotide...    159   4e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009407378.1|  PREDICTED: nicotinamide adenine dinucleotide...    157   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243273.1|  PREDICTED: nicotinamide adenine dinucleotide...    158   2e-42   Prunus mume [ume]
ref|XP_008797620.1|  PREDICTED: nicotinamide adenine dinucleotide...    156   3e-42   Phoenix dactylifera
ref|XP_009600753.1|  PREDICTED: nicotinamide adenine dinucleotide...    157   3e-42   Nicotiana tomentosiformis
ref|XP_009600754.1|  PREDICTED: nicotinamide adenine dinucleotide...    157   4e-42   Nicotiana tomentosiformis
ref|XP_003614555.1|  Mitochondrial substrate carrier family prote...    157   4e-42   Medicago truncatula
ref|XP_003553860.1|  PREDICTED: nicotinamide adenine dinucleotide...    157   4e-42   Glycine max [soybeans]
emb|CDP00658.1|  unnamed protein product                                157   5e-42   Coffea canephora [robusta coffee]
gb|KDO76915.1|  hypothetical protein CISIN_1g016968mg                   156   1e-41   Citrus sinensis [apfelsine]
ref|XP_006448416.1|  hypothetical protein CICLE_v10015617mg             156   1e-41   Citrus clementina [clementine]
ref|XP_008367006.1|  PREDICTED: nicotinamide adenine dinucleotide...    155   1e-41   
ref|XP_007223316.1|  hypothetical protein PRUPE_ppa007312mg             155   2e-41   
ref|XP_009767034.1|  PREDICTED: nicotinamide adenine dinucleotide...    155   2e-41   Nicotiana sylvestris
gb|KCW86299.1|  hypothetical protein EUGRSUZ_B02991                     154   2e-41   Eucalyptus grandis [rose gum]
ref|XP_009767035.1|  PREDICTED: nicotinamide adenine dinucleotide...    155   3e-41   Nicotiana sylvestris
ref|XP_009356235.1|  PREDICTED: nicotinamide adenine dinucleotide...    154   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_009357098.1|  PREDICTED: nicotinamide adenine dinucleotide...    154   5e-41   Pyrus x bretschneideri [bai li]
emb|CAN73681.1|  hypothetical protein VITISV_008039                     146   7e-41   Vitis vinifera
ref|XP_008339642.1|  PREDICTED: nicotinamide adenine dinucleotide...    154   7e-41   Malus domestica [apple tree]
ref|XP_009105386.1|  PREDICTED: nicotinamide adenine dinucleotide...    152   1e-40   Brassica rapa
ref|XP_010046584.1|  PREDICTED: uncharacterized protein LOC104435557    159   2e-40   
emb|CDY38578.1|  BnaC06g30010D                                          152   2e-40   Brassica napus [oilseed rape]
gb|EYU40785.1|  hypothetical protein MIMGU_mgv1a008842mg                150   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_009109874.1|  PREDICTED: nicotinamide adenine dinucleotide...    150   2e-39   Brassica rapa
emb|CDY24409.1|  BnaCnng04760D                                          150   2e-39   Brassica napus [oilseed rape]
ref|XP_006415866.1|  hypothetical protein EUTSA_v10007992mg             148   8e-39   Eutrema salsugineum [saltwater cress]
ref|XP_011076390.1|  PREDICTED: nicotinamide adenine dinucleotide...    148   9e-39   Sesamum indicum [beniseed]
emb|CDX84985.1|  BnaC05g20700D                                          148   9e-39   
ref|NP_564233.1|  NAD+ transporter 2                                    148   1e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76447.1|  hypothetical protein VITISV_010118                     149   1e-38   Vitis vinifera
gb|KFK41256.1|  hypothetical protein AALP_AA2G105900                    146   2e-38   Arabis alpina [alpine rockcress]
ref|XP_001772029.1|  predicted protein                                  146   3e-38   
ref|XP_009115307.1|  PREDICTED: nicotinamide adenine dinucleotide...    146   4e-38   Brassica rapa
ref|XP_010532254.1|  PREDICTED: nicotinamide adenine dinucleotide...    146   4e-38   Tarenaya hassleriana [spider flower]
ref|XP_010499117.1|  PREDICTED: nicotinamide adenine dinucleotide...    146   4e-38   Camelina sativa [gold-of-pleasure]
gb|KFK44519.1|  hypothetical protein AALP_AA1G267200                    146   5e-38   Arabis alpina [alpine rockcress]
ref|XP_010460390.1|  PREDICTED: nicotinamide adenine dinucleotide...    146   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006304969.1|  hypothetical protein CARUB_v10012042mg             146   5e-38   Capsella rubella
gb|ACN28655.1|  unknown                                                 146   8e-38   Zea mays [maize]
emb|CAI38581.1|  mitochondrial carrier like protein                     145   1e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96021.1|  BnaA07g27100D                                          143   3e-37   
ref|XP_010477935.1|  PREDICTED: nicotinamide adenine dinucleotide...    144   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010559229.1|  PREDICTED: nicotinamide adenine dinucleotide...    142   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_002893428.1|  mitochondrial substrate carrier family protein     142   1e-36   
gb|KFK43463.1|  hypothetical protein AALP_AA1G128600                    139   2e-36   Arabis alpina [alpine rockcress]
gb|EPS70095.1|  hypothetical protein M569_04665                         141   2e-36   Genlisea aurea
gb|AFW77703.1|  hypothetical protein ZEAMMB73_178914                    135   3e-36   
ref|XP_002987576.1|  hypothetical protein SELMODRAFT_46815              139   3e-36   
ref|XP_002978962.1|  hypothetical protein SELMODRAFT_109819             140   3e-36   
ref|XP_006645938.1|  PREDICTED: nicotinamide adenine dinucleotide...    140   4e-36   Oryza brachyantha
ref|XP_002992842.1|  hypothetical protein SELMODRAFT_46825              139   6e-36   
gb|KFK43464.1|  hypothetical protein AALP_AA1G128600                    139   2e-35   Arabis alpina [alpine rockcress]
ref|XP_004968826.1|  PREDICTED: nicotinamide adenine dinucleotide...    138   2e-35   Setaria italica
gb|AFW81644.1|  hypothetical protein ZEAMMB73_626020                    134   3e-35   
gb|AAG28807.1|AC079374_10  unknown protein                              139   3e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83064.1|  unnamed protein product                                135   4e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002457880.1|  hypothetical protein SORBIDRAFT_03g017840          135   4e-34   Sorghum bicolor [broomcorn]
ref|XP_010518452.1|  PREDICTED: nicotinamide adenine dinucleotide...    132   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_001754740.1|  predicted protein                                  129   5e-32   
dbj|BAD73080.1|  putative mitochondrial folate transporter              128   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70751.1|  hypothetical protein OsI_02162                          128   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010906995.1|  PREDICTED: nicotinamide adenine dinucleotide...    126   3e-31   
gb|KJB48098.1|  hypothetical protein B456_008G053500                    127   4e-31   Gossypium raimondii
gb|EMS54256.1|  hypothetical protein TRIUR3_07374                       127   8e-31   Triticum urartu
gb|KEH24420.1|  substrate carrier family protein                        124   1e-30   Medicago truncatula
gb|KDO87106.1|  hypothetical protein CISIN_1g021150mg                   123   2e-30   Citrus sinensis [apfelsine]
gb|KJB06735.1|  hypothetical protein B456_001G141500                    123   3e-30   Gossypium raimondii
gb|EMT02103.1|  Mitochondrial substrate carrier family protein W        126   3e-30   
ref|XP_010922181.1|  PREDICTED: nicotinamide adenine dinucleotide...    120   7e-29   Elaeis guineensis
ref|XP_001763122.1|  predicted protein                                  119   5e-28   
gb|KHN43485.1|  Mitochondrial substrate carrier family protein W        117   6e-28   Glycine soja [wild soybean]
ref|XP_010922172.1|  PREDICTED: nicotinamide adenine dinucleotide...    116   3e-27   Elaeis guineensis
ref|XP_010922203.1|  PREDICTED: nicotinamide adenine dinucleotide...    115   3e-27   
ref|XP_008797621.1|  PREDICTED: nicotinamide adenine dinucleotide...    113   2e-26   
ref|XP_010518453.1|  PREDICTED: nicotinamide adenine dinucleotide...    111   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_001701258.1|  hypothetical protein CHLREDRAFT_122344             110   4e-25   Chlamydomonas reinhardtii
gb|KIY99796.1|  putative carrier protein                                105   9e-24   Monoraphidium neglectum
ref|XP_002509046.1|  mitochondrial carrier family                       106   1e-23   Micromonas commoda
dbj|GAN03363.1|  mitochondrial NAD transporter                          104   4e-23   Mucor ambiguus
gb|AFK34832.1|  unknown                                                 104   4e-23   Lotus japonicus
gb|EPB89321.1|  hypothetical protein HMPREF1544_03830                   104   5e-23   Mucor circinelloides f. circinelloides 1006PhL
emb|CDY27484.1|  BnaC04g51250D                                          102   1e-22   Brassica napus [oilseed rape]
ref|XP_006604086.1|  PREDICTED: nicotinamide adenine dinucleotide...    102   2e-22   Glycine max [soybeans]
gb|KFH65804.1|  hypothetical protein MVEG_07907                         102   2e-22   Mortierella verticillata NRRL 6337
dbj|GAA95912.1|  hypothetical protein E5Q_02570                         103   3e-22   Mixia osmundae IAM 14324
emb|CEP14775.1|  hypothetical protein                                   102   4e-22   Parasitella parasitica
ref|XP_002418843.1|  mitochondrial NAD+ transporter, putative         99.8    4e-21   Candida dubliniensis CD36
ref|XP_007404089.1|  hypothetical protein MELLADRAFT_46330            99.0    6e-21   Melampsora larici-populina 98AG31
gb|KGR00544.1|  solute carrier family 25 (mitochondrial folate tr...  98.6    8e-21   Candida albicans GC75
emb|CDH57170.1|  mitochondrial nad transporter                        98.2    1e-20   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002952313.1|  hypothetical protein VOLCADRAFT_62332            97.8    1e-20   Volvox carteri f. nagariensis
ref|XP_714659.1|  likely mitochondrial carrier protein                98.2    1e-20   
gb|KGU29009.1|  solute carrier family 25 (mitochondrial folate tr...  98.2    1e-20   Candida albicans P34048
gb|KGU35528.1|  solute carrier family 25 (mitochondrial folate tr...  98.2    1e-20   Candida albicans P57055
ref|XP_714565.1|  likely mitochondrial carrier protein                98.2    1e-20   
ref|XP_001420486.1|  MC family transporter: folate                    97.4    2e-20   Ostreococcus lucimarinus CCE9901
ref|NP_001172375.1|  Os01g0513301                                     93.2    2e-20   
emb|CEI99166.1|  hypothetical protein RMCBS344292_13258               97.1    3e-20   Rhizopus microsporus
ref|XP_006957017.1|  mitochondrial NAD transporter                    96.7    3e-20   Wallemia mellicola CBS 633.66
emb|CEG79270.1|  hypothetical protein RMATCC62417_13755               96.7    3e-20   Rhizopus microsporus
emb|CDH58404.1|  mitochondrial nad transporter                        94.0    2e-19   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008601767.1|  folate transporter/carrier (mitochondrial)       94.7    2e-19   Beauveria bassiana ARSEF 2860
emb|CDS04125.1|  hypothetical protein LRAMOSA07080                    93.6    3e-19   Lichtheimia ramosa
ref|XP_005833561.1|  mitochondrial carrier protein                    93.6    5e-19   Guillardia theta CCMP2712
gb|KGQ04974.1|  nicotinamide adenine dinucleotide transporter 1       95.1    6e-19   Beauveria bassiana D1-5
gb|EJU03317.1|  mitochondrial carrier                                 93.6    6e-19   Dacryopinax primogenitus
ref|XP_011277308.1|  putative mitochondrial carrier                   93.6    6e-19   Wickerhamomyces ciferrii
ref|XP_002616917.1|  hypothetical protein CLUG_02361                  92.8    1e-18   Clavispora lusitaniae ATCC 42720
ref|XP_003712078.1|  solute carrier family 25 member 33               93.6    1e-18   Magnaporthe oryzae 70-15
ref|XP_002547687.1|  conserved hypothetical protein                   92.4    1e-18   Candida tropicalis MYA-3404
gb|KEZ38744.1|  Mitochondrial carrier protein                         92.4    1e-18   Scedosporium apiospermum
ref|XP_009105387.1|  PREDICTED: nicotinamide adenine dinucleotide...  91.7    1e-18   Brassica rapa
gb|EIE86128.1|  hypothetical protein RO3G_10839                       92.0    1e-18   Rhizopus delemar RA 99-880
ref|XP_457354.2|  DEHA2B09284p                                        92.4    1e-18   Debaryomyces hansenii CBS767
emb|CDS12517.1|  hypothetical protein LRAMOSA04711                    91.3    2e-18   Lichtheimia ramosa
gb|EPQ62397.1|  hypothetical protein BGT96224_A20515                  91.7    2e-18   Blumeria graminis f. sp. tritici 96224
emb|CCU78404.1|  mitochondrial folate transporter/carrier             90.9    3e-18   Blumeria graminis f. sp. hordei DH14
ref|XP_009267688.1|  Ribonucleoside-diphosphate reductase large c...  94.4    3e-18   Wallemia ichthyophaga EXF-994
emb|CEP60397.1|  LALA0S01e09824g1_1                                   91.3    4e-18   Lachancea lanzarotensis
emb|CCF32408.1|  hypothetical protein CH063_04804                     92.0    4e-18   Colletotrichum higginsianum
gb|EFQ32338.1|  hypothetical protein GLRG_07482                       91.3    7e-18   Colletotrichum graminicola M1.001
gb|KJB06734.1|  hypothetical protein B456_001G141500                  89.0    7e-18   Gossypium raimondii
gb|KDN71827.1|  hypothetical protein CSUB01_04228                     90.9    9e-18   Colletotrichum sublineola
gb|KFA52148.1|  hypothetical protein S40293_00468                     90.5    1e-17   Stachybotrys chartarum IBT 40293
gb|KEY72054.1|  hypothetical protein S7711_00071                      90.5    1e-17   Stachybotrys chartarum IBT 7711
ref|XP_005644233.1|  mitochondrial carrier                            89.0    2e-17   Coccomyxa subellipsoidea C-169
gb|ENH76893.1|  mitochondrial carrier protein                         89.4    2e-17   
gb|EER43542.1|  mitochondrial folate transporter/carrier              89.7    2e-17   Histoplasma capsulatum H143
ref|XP_003061718.1|  mitochondrial carrier family                     89.4    2e-17   Micromonas pusilla CCMP1545
gb|EEH08759.1|  mitochondrial folate transporter/carrier              89.7    2e-17   Histoplasma capsulatum G186AR
ref|XP_011398544.1|  Mitochondrial nicotinamide adenine dinucleot...  88.2    2e-17   Auxenochlorella protothecoides
ref|XP_007833533.1|  hypothetical protein PFICI_06761                 90.1    2e-17   Pestalotiopsis fici W106-1
gb|KFA61402.1|  hypothetical protein S40285_03606                     89.4    2e-17   Stachybotrys chlorohalonata IBT 40285
emb|CCA74771.1|  related to YIA6-Pvruvate transporter of the mito...  88.6    2e-17   Serendipita indica DSM 11827
emb|CEP18167.1|  hypothetical protein                                 88.2    2e-17   Parasitella parasitica
ref|XP_007281229.1|  mitochondrial carrier protein                    89.4    2e-17   
gb|KDE08552.1|  hypothetical protein MVLG_01329                       88.6    2e-17   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003050900.1|  hypothetical protein NECHADRAFT_40983            89.0    3e-17   [Nectria] haematococca mpVI 77-13-4
ref|XP_001384546.2|  mitochondrial carrier protein                    88.6    3e-17   Scheffersomyces stipitis CBS 6054
gb|ESA08977.1|  hypothetical protein GLOINDRAFT_81209                 88.2    3e-17   
ref|XP_007738192.1|  hypothetical protein A1O3_09911                  88.2    3e-17   Capronia epimyces CBS 606.96
ref|XP_002836831.1|  hypothetical protein                             87.8    3e-17   Tuber melanosporum Mel28
emb|CCE32082.1|  related to folate transporter/carrier (mitochond...  89.0    4e-17   Claviceps purpurea 20.1
ref|XP_006969666.1|  predicted protein                                88.2    4e-17   Trichoderma reesei QM6a
ref|XP_003649927.1|  hypothetical protein THITE_2109062               88.6    4e-17   Thielavia terrestris NRRL 8126
gb|EQB52551.1|  hypothetical protein CGLO_07823                       89.0    4e-17   Colletotrichum gloeosporioides Cg-14
gb|EHK25622.1|  hypothetical protein TRIVIDRAFT_177614                88.2    4e-17   Trichoderma virens Gv29-8
ref|XP_002315927.2|  hypothetical protein POPTR_0010s13120g           87.0    5e-17   
ref|XP_007591510.1|  hypothetical protein CFIO01_02361                88.6    6e-17   
ref|XP_009492592.1|  hypothetical protein H696_00462                  87.4    6e-17   Fonticula alba
emb|CEJ91629.1|  Putative Mitochondrial carrier protein               88.2    6e-17   Torrubiella hemipterigena
ref|XP_003330074.2|  hypothetical protein PGTG_10984                  88.2    7e-17   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EHK39592.1|  hypothetical protein TRIATDRAFT_91782                 87.8    8e-17   Trichoderma atroviride IMI 206040
ref|XP_003674253.1|  hypothetical protein NCAS_0A13150                87.4    8e-17   Naumovozyma castellii CBS 4309
gb|EDK38038.2|  hypothetical protein PGUG_02136                       87.4    8e-17   Meyerozyma guilliermondii ATCC 6260
gb|AGO11765.1|  AaceriADL009Wp                                        87.4    1e-16   Saccharomycetaceae sp. 'Ashbya aceri'
gb|EMG49369.1|  hypothetical protein G210_5869                        87.0    1e-16   Candida maltosa Xu316
ref|XP_001486465.1|  hypothetical protein PGUG_02136                  87.0    1e-16   Meyerozyma guilliermondii ATCC 6260
ref|XP_007003800.1|  hypothetical protein TREMEDRAFT_16119            87.0    1e-16   Tremella mesenterica DSM 1558
gb|KIX95254.1|  hypothetical protein Z520_09171                       87.4    1e-16   Fonsecaea multimorphosa CBS 102226
emb|CDR46065.1|  CYFA0S21e01970g1_1                                   86.7    1e-16   Cyberlindnera fabianii
ref|XP_003082002.1|  putative mitochondrial carrier protein (ISS)     87.4    1e-16   Ostreococcus tauri
ref|XP_447792.1|  hypothetical protein                                86.7    1e-16   [Candida] glabrata
ref|XP_001912114.1|  hypothetical protein                             87.8    1e-16   Podospora anserina S mat+
ref|XP_008463390.1|  PREDICTED: nicotinamide adenine dinucleotide...  82.8    1e-16   
gb|KGK35316.1|  hypothetical protein JL09_g5534                       85.1    1e-16   Pichia kudriavzevii
ref|XP_009156184.1|  MC family mitochondrial carrier protein          86.7    2e-16   Exophiala dermatitidis NIH/UT8656
ref|XP_504023.1|  YALI0E16478p                                        85.9    2e-16   Yarrowia lipolytica CLIB122
gb|KHJ35466.1|  putative mitochondrial nicotinamide adenine dinuc...  86.3    2e-16   Erysiphe necator
ref|XP_960808.1|  calcium-binding mitochondrial carrier protein A...  87.4    2e-16   Neurospora crassa OR74A
emb|CCK70612.1|  hypothetical protein KNAG_0E03550                    86.3    2e-16   
ref|XP_009847548.1|  hypothetical protein NEUTE1DRAFT_143675          87.4    2e-16   
gb|EGU82831.1|  hypothetical protein FOXB_06634                       86.7    2e-16   
gb|EWY90355.1|  hypothetical protein FOYG_07906                       86.7    2e-16   
ref|XP_006696660.1|  putative mitochondrial carrier protein           87.4    2e-16   
gb|EWZ36961.1|  hypothetical protein FOZG_10863                       86.7    2e-16   
ref|XP_003012122.1|  hypothetical protein ARB_01630                   87.0    2e-16   
emb|CCT68375.1|  related to folate transporter/carrier (mitochond...  86.7    2e-16   
ref|XP_003646350.1|  hypothetical protein Ecym_4494                   86.7    2e-16   
gb|EQK98507.1|  mitochondrial carrier protein                         86.3    2e-16   
gb|EZF28893.1|  hypothetical protein H101_07417                       86.7    2e-16   
gb|EGD93906.1|  mitochondrial carrier protein                         86.7    3e-16   
ref|XP_003022225.1|  hypothetical protein TRV_03628                   86.7    3e-16   
ref|XP_003232029.1|  mitochondrial carrier protein                    86.7    3e-16   
ref|XP_004177419.1|  hypothetical protein TBLA_0A01000                85.9    3e-16   
gb|EFX01094.1|  mitochondrial carrier protein                         87.0    4e-16   
gb|KFH43884.1|  Mitochondrial nicotinamide adenine dinucleotide t...  86.3    4e-16   
gb|EWG40741.1|  hypothetical protein FVEG_03025                       85.9    4e-16   
gb|EPB90832.1|  hypothetical protein HMPREF1544_02249                 87.4    4e-16   
ref|XP_003287851.1|  hypothetical protein DICPUDRAFT_87783            84.3    4e-16   
ref|XP_007292979.1|  hypothetical protein MBM_05090                   85.5    4e-16   
ref|XP_010259427.1|  PREDICTED: nicotinamide adenine dinucleotide...  84.0    5e-16   
gb|KDQ11095.1|  hypothetical protein BOTBODRAFT_163124                84.7    5e-16   
ref|XP_002625010.1|  mitochondrial carrier protein                    85.9    5e-16   
gb|AJR37672.1|  Yia6p                                                 85.1    5e-16   
ref|XP_008076789.1|  Mitochondrial carrier                            85.5    5e-16   
dbj|GAA24109.1|  K7_Yia6p                                             85.1    5e-16   
gb|EMS23248.1|  mitochondrial NAD+ transporter                        84.7    6e-16   
gb|AJR52079.1|  Yia6p                                                 85.1    6e-16   
gb|AJR43758.1|  Yia6p                                                 85.1    6e-16   
gb|EHN06538.1|  Yia6p                                                 85.1    6e-16   
ref|XP_003349254.1|  hypothetical protein SMAC_05538                  85.9    6e-16   
gb|AJR39940.1|  Yia6p                                                 85.1    6e-16   
gb|KHN96564.1|  mitochondrial carrier protein                         85.1    6e-16   
gb|AJR48713.1|  Yia6p                                                 85.1    6e-16   
gb|AJR39203.1|  Yia6p                                                 85.1    6e-16   
gb|AJR50180.1|  Yia6p                                                 84.7    6e-16   
gb|AJR44526.1|  Yia6p                                                 84.7    6e-16   
emb|CAY80506.1|  Yia6p                                                84.7    6e-16   
gb|AHY75991.1|  Yia6p                                                 84.7    6e-16   
gb|KDB14920.1|  mitochondrial carrier protein                         86.7    6e-16   
gb|EDZ71463.1|  YIL006Wp-like protein                                 84.7    6e-16   
ref|NP_012260.1|  Yia6p                                               84.7    6e-16   
ref|XP_002851124.1|  mitochondrial folate transporter/carrier         85.5    7e-16   
gb|AJR49803.1|  Yia6p                                                 84.7    7e-16   
gb|EWH17955.1|  Yia6p                                                 84.7    7e-16   
gb|KIO20317.1|  hypothetical protein M407DRAFT_245857                 84.3    8e-16   
gb|ETS62730.1|  hypothetical protein PaG_02468                        83.6    9e-16   
dbj|BAO41050.1|  uncharacterized mitochondrial carrier YIL006W        84.3    1e-15   
ref|NP_984088.1|  ADL009Wp                                            84.3    1e-15   
emb|CDO93899.1|  unnamed protein product                              84.7    1e-15   
ref|XP_011103950.1|  YIL006W                                          84.3    1e-15   
ref|XP_003177714.1|  mitochondrial folate transporter/carrier         84.7    1e-15   
ref|XP_003068276.1|  Mitochondrial carrier protein                    84.7    1e-15   
ref|XP_001525940.1|  conserved hypothetical protein                   84.7    1e-15   
ref|XP_009263773.1|  hypothetical protein FPSE_12381                  84.7    1e-15   
gb|KIV79610.1|  hypothetical protein PV11_07161                       84.3    1e-15   
gb|KID76153.1|  mitochondrial carrier protein                         84.0    1e-15   
ref|XP_006668859.1|  mitochondrial carrier protein                    84.0    1e-15   
ref|XP_002790374.1|  mitochondrial folate transporter/carrier         84.7    1e-15   
ref|XP_001244664.1|  hypothetical protein CIMG_04105                  84.7    1e-15   
gb|EEH21933.1|  hypothetical protein PABG_04144                       84.7    1e-15   
ref|XP_011319254.1|  hypothetical protein FGSG_10295                  84.3    1e-15   
ref|XP_010760019.1|  hypothetical protein PADG_04502                  84.3    1e-15   
ref|XP_003683366.1|  hypothetical protein TDEL_0H02960                83.6    2e-15   
ref|XP_007725598.1|  hypothetical protein A1O1_06530                  84.0    2e-15   
ref|XP_001642622.1|  hypothetical protein Kpol_312p2                  84.0    2e-15   
gb|KIX05087.1|  hypothetical protein Z518_05959                       84.0    2e-15   
gb|KID87937.1|  mitochondrial carrier protein                         83.6    2e-15   
gb|KIW52609.1|  hypothetical protein PV05_08239                       83.6    2e-15   
gb|KID99030.1|  mitochondrial carrier protein                         83.6    2e-15   
ref|XP_002341053.1|  mitochondrial carrier protein, putative          83.6    2e-15   
dbj|GAK63323.1|  mitochondrial NAD transporter                        82.4    3e-15   
gb|KIW31372.1|  hypothetical protein PV07_03025                       83.6    3e-15   
ref|XP_007813880.1|  mitochondrial carrier protein                    83.2    3e-15   
gb|KEQ86445.1|  mitochondrial carrier                                 82.8    3e-15   
ref|XP_001588131.1|  hypothetical protein SS1G_10577                  83.2    3e-15   
gb|KEH24421.1|  substrate carrier family protein                      81.3    4e-15   
ref|XP_003959601.1|  hypothetical protein KAFR_0K01110                82.4    4e-15   
ref|XP_009218764.1|  solute carrier family 25 member 33               83.6    4e-15   
gb|KIW91410.1|  hypothetical protein Z519_08306                       82.8    4e-15   
ref|XP_004343599.2|  substrate carrier family protein                 83.2    4e-15   
ref|XP_003868825.1|  Yia6 protein                                     82.4    5e-15   
gb|KEQ59088.1|  mitochondrial carrier protein                         82.0    5e-15   
gb|KIJ54845.1|  hypothetical protein M422DRAFT_24741                  82.0    5e-15   
ref|XP_007744222.1|  hypothetical protein A1O5_05431                  82.8    5e-15   
ref|XP_003668383.1|  hypothetical protein NDAI_0B01060                82.4    5e-15   
ref|XP_007787030.1|  hypothetical protein EPUS_04564                  82.8    5e-15   
ref|XP_002554746.1|  KLTH0F12804p                                     82.4    6e-15   
emb|CCG84512.1|  protein of unknown function                          81.6    6e-15   
ref|XP_003662314.1|  hypothetical protein MYCTH_114734                82.8    6e-15   
gb|KIW82595.1|  hypothetical protein Z517_05622                       82.4    7e-15   
gb|EJT41560.1|  YIA6-like protein                                     82.0    7e-15   
gb|EHN01863.1|  Yia6p                                                 82.0    7e-15   
gb|EMD39816.1|  hypothetical protein CERSUDRAFT_112079                81.3    7e-15   
ref|XP_007758640.1|  hypothetical protein A1O7_06448                  81.6    7e-15   
ref|XP_011387539.1|  hypothetical protein UMAG_01495                  81.6    8e-15   
ref|XP_007819334.1|  Mitochondrial substrate/solute carrier           82.0    8e-15   
ref|XP_008728631.1|  hypothetical protein G647_06084                  81.6    8e-15   
ref|XP_002584857.1|  conserved hypothetical protein                   82.4    8e-15   
gb|KIL96544.1|  hypothetical protein FAVG1_01288                      82.0    8e-15   
gb|KID71330.1|  mitochondrial carrier protein                         81.6    8e-15   
emb|CDM27919.1|  Mitochondrial carrier protein                        82.0    9e-15   
gb|KFY39132.1|  hypothetical protein V494_04105                       80.9    1e-14   
emb|CDF91625.1|  ZYBA0S12-03224g1_1                                   81.3    1e-14   
gb|ELR07679.1|  hypothetical protein GMDG_02701                       82.0    1e-14   
gb|KIW46264.1|  hypothetical protein PV06_01945                       81.6    1e-14   
gb|KIK04122.1|  hypothetical protein K443DRAFT_438070                 80.9    1e-14   
emb|CBQ71692.1|  related to YIA6-Pvruvate transporter of the mito...  80.9    1e-14   
gb|KIN06687.1|  hypothetical protein OIDMADRAFT_24973                 81.6    1e-14   
ref|XP_002476856.1|  predicted protein                                80.5    1e-14   
emb|CCX04874.1|  Similar to Mitochondrial nicotinamide adenine di...  81.6    1e-14   
ref|XP_007351079.1|  mitochondrial NAD transporter                    80.9    1e-14   
emb|CEI86331.1|  hypothetical protein RMCBS344292_00773               80.5    1e-14   
gb|KEF52658.1|  hypothetical protein A1O9_11075                       80.9    1e-14   
gb|EPS31180.1|  hypothetical protein PDE_06135                        81.6    1e-14   
gb|KFY48357.1|  hypothetical protein V496_10278                       81.3    1e-14   
ref|XP_002496835.1|  ZYRO0D09218p                                     80.9    1e-14   
gb|ESZ97535.1|  hypothetical protein SBOR_2082                        81.3    1e-14   
dbj|GAM82833.1|  hypothetical protein ANO11243_008190                 81.3    1e-14   
gb|KIW67618.1|  hypothetical protein PV04_06856                       81.3    2e-14   
ref|XP_011116288.1|  hypothetical protein H072_10872                  81.3    2e-14   
gb|KGK39362.1|  hypothetical protein JL09_g1458                       83.2    2e-14   
gb|KFY74566.1|  hypothetical protein V499_05408                       81.6    2e-14   
gb|EUC63233.1|  NAD transporter                                       80.1    2e-14   
emb|CDH11017.1|  probable Mitochondrial nicotinamide adenine dinu...  80.9    2e-14   
ref|XP_007374320.1|  hypothetical protein SPAPADRAFT_60150            80.9    2e-14   
gb|EJT42022.1|  YEA6-like protein                                     80.1    2e-14   
gb|KDQ62172.1|  hypothetical protein JAAARDRAFT_30075                 80.1    2e-14   
gb|EHN02815.1|  Yea6p                                                 80.1    2e-14   
ref|XP_002144482.1|  mitochondrial carrier protein, putative          80.9    2e-14   
gb|KIV88610.1|  hypothetical protein PV10_08277                       80.5    2e-14   
ref|XP_001550912.1|  hypothetical protein BC1G_10636                  80.9    2e-14   
gb|EME38547.1|  hypothetical protein DOTSEDRAFT_48731                 80.9    2e-14   
emb|CCD46842.1|  similar to mitochondrial folate transporter/carrier  80.9    2e-14   
gb|KIP08100.1|  hypothetical protein PHLGIDRAFT_392024                79.7    3e-14   
gb|KEQ98256.1|  hypothetical protein AUEXF2481DRAFT_475497            80.1    3e-14   
emb|CCE44804.1|  hypothetical protein CPAR2_406070                    80.1    3e-14   
emb|CEL62761.1|  Mitochondrial nicotinamide adenine dinucleotide ...  79.3    3e-14   
gb|KFY78087.1|  hypothetical protein V498_09194                       81.3    3e-14   
gb|KFZ17397.1|  hypothetical protein V501_01745                       81.3    4e-14   
gb|EGA58942.1|  Yea6p                                                 78.6    4e-14   
gb|KEQ75071.1|  mitochondrial carrier protein                         79.3    5e-14   
gb|EKV19593.1|  Mitochondrial carrier protein, putative               80.1    5e-14   
emb|CDK26468.1|  unnamed protein product                              79.0    5e-14   
gb|KGO68460.1|  Mitochondrial carrier protein                         79.7    5e-14   
ref|XP_002565699.1|  Pc22g17900                                       79.7    5e-14   
ref|XP_003835581.1|  similar to mitochondrial folate transporter/...  79.7    5e-14   
emb|CAK38576.1|  unnamed protein product                              79.7    5e-14   
gb|KFY22683.1|  hypothetical protein V493_06411                       79.7    5e-14   
ref|NP_010910.1|  Yea6p                                               79.0    6e-14   
ref|XP_007583292.1|  putative mitochondrial folate transporter ca...  79.3    6e-14   
gb|EGA87228.1|  Yea6p                                                 79.0    6e-14   
gb|KIW18631.1|  hypothetical protein PV08_02920                       79.3    6e-14   
ref|XP_001401484.2|  NAD+ transporter                                 79.7    6e-14   
ref|XP_007401594.1|  hypothetical protein PHACADRAFT_214085           78.6    6e-14   
ref|XP_008710782.1|  hypothetical protein HMPREF1541_00254            79.3    6e-14   
dbj|GAC96487.1|  mitochondrial carrier protein                        79.7    7e-14   
dbj|GAD95585.1|  mitochondrial carrier protein, putative              79.7    7e-14   
gb|KFX90562.1|  hypothetical protein O988_08133                       79.7    7e-14   
gb|EEU08684.1|  Yea6p                                                 78.6    7e-14   
gb|KIW05160.1|  hypothetical protein PV09_03711                       79.3    8e-14   
ref|XP_003687860.1|  hypothetical protein TPHA_0L00700                79.3    8e-14   
dbj|GAA82600.1|  mitochondrial carrier protein                        79.3    8e-14   
ref|XP_453688.1|  hypothetical protein                                79.3    8e-14   
ref|XP_009545893.1|  mitochondrial carrier protein                    78.2    9e-14   
ref|XP_007363709.1|  mitochondrial carrier                            77.8    9e-14   
ref|XP_007867010.1|  mitochondrial NAD transporter                    78.2    1e-13   
gb|KFZ19322.1|  hypothetical protein V502_03718                       79.0    1e-13   
gb|EKG21454.1|  Mitochondrial substrate/solute carrier                79.0    1e-13   
ref|XP_002952298.1|  mitochondrial substrate carrier                  77.8    1e-13   
gb|ELU42232.1|  NAD transporter                                       79.0    1e-13   
ref|XP_003305429.1|  hypothetical protein PTT_18266                   79.0    1e-13   
gb|KDR67684.1|  hypothetical protein GALMADRAFT_257946                78.2    1e-13   
gb|KFY87569.1|  hypothetical protein V500_06889                       79.0    1e-13   
ref|XP_001934732.1|  calcium-binding mitochondrial carrier protei...  79.0    1e-13   
gb|EKC98858.1|  pyruvate transporter                                  80.1    1e-13   
gb|KGO40076.1|  Mitochondrial carrier protein                         78.6    2e-13   
ref|XP_011125007.1|  hypothetical protein AOL_s00110g15               78.2    2e-13   
ref|XP_007778163.1|  hypothetical protein W97_02071                   78.2    2e-13   
ref|XP_002377184.1|  mitochondrial carrier protein, putative          78.2    2e-13   
gb|ERS98643.1|  hypothetical protein HMPREF1624_05430                 79.0    2e-13   
ref|XP_007509429.1|  predicted protein                                77.8    2e-13   
ref|XP_002491321.1|  Mitochondrial NAD+ transporter, involved in ...  77.4    2e-13   
ref|XP_002004239.1|  GI19815                                          77.0    3e-13   
ref|XP_007768692.1|  mitochondrial NAD transporter                    76.6    3e-13   
ref|XP_007924542.1|  hypothetical protein MYCFIDRAFT_202820           77.8    3e-13   
ref|XP_008037425.1|  mitochondrial NAD transporter                    76.6    3e-13   
ref|XP_002682488.1|  predicted protein                                76.3    3e-13   
gb|EYE97877.1|  putative mitochondrial carrier protein                77.4    3e-13   
dbj|BAD61073.1|  putative peroxisomal Ca-dependent solute carrier     76.3    3e-13   
gb|KIH87861.1|  hypothetical protein SPBR_04868                       78.2    4e-13   
ref|NP_001041995.1|  Os01g0143100                                     76.3    4e-13   
gb|KIR68934.1|  solute carrier family 25 (mitochondrial folate tr...  77.0    4e-13   
ref|XP_001875662.1|  mitochondrial NAD transporter                    76.3    4e-13   
emb|CCJ31162.1|  unnamed protein product                              76.3    5e-13   
ref|XP_002439631.1|  hypothetical protein SORBIDRAFT_09g017270        73.6    5e-13   
ref|XP_002175442.1|  NAD transporter                                  76.6    5e-13   
ref|XP_003034474.1|  hypothetical protein SCHCODRAFT_106998           75.9    5e-13   
gb|KIR35851.1|  solute carrier family 25 (mitochondrial folate tr...  76.6    6e-13   
gb|KIR45191.1|  solute carrier family 25 (mitochondrial folate tr...  76.6    6e-13   
dbj|BAE59403.1|  unnamed protein product                              77.0    6e-13   
ref|XP_006462362.1|  hypothetical protein AGABI2DRAFT_193528          76.3    6e-13   
gb|KIY62169.1|  mitochondrial NAD transporter                         75.9    6e-13   
ref|XP_001821405.2|  NAD+ transporter                                 76.6    6e-13   
gb|KIR30684.1|  solute carrier family 25 (mitochondrial folate tr...  76.6    6e-13   
ref|XP_007329834.1|  hypothetical protein AGABI1DRAFT_113700          76.3    6e-13   
gb|KIM30071.1|  hypothetical protein M408DRAFT_328477                 75.9    7e-13   
ref|XP_007304667.1|  mitochondrial NAD transporter                    75.9    7e-13   
gb|ESW98842.1|  Mitochondrial NAD+ transporter, involved in the t...  76.3    7e-13   
ref|XP_003191757.1|  pyruvate transporter of the mitochondrial in...  76.3    7e-13   
gb|KIR83769.1|  solute carrier family 25 (mitochondrial folate tr...  76.3    8e-13   
gb|KCW86298.1|  hypothetical protein EUGRSUZ_B02990                   72.4    8e-13   
ref|XP_001271568.1|  mitochondrial carrier protein, putative          76.6    8e-13   
gb|KIM89019.1|  hypothetical protein PILCRDRAFT_2330                  75.5    8e-13   
ref|XP_006643743.1|  PREDICTED: mitochondrial substrate carrier f...  74.3    1e-12   
ref|XP_007380149.1|  mitochondrial NAD transporter                    75.1    1e-12   
ref|XP_002910717.1|  mitochondrial NAD+ transporter                   75.9    1e-12   
gb|EMD96446.1|  hypothetical protein COCHEDRAFT_1220085               75.9    1e-12   
ref|XP_007712086.1|  hypothetical protein COCCADRAFT_95591            75.9    1e-12   
emb|CCM04921.1|  predicted protein                                    76.3    1e-12   



>ref|XP_009594055.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=315

 Score =   240 bits (613),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M AD HGP+PKGLLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKLGN N+RGSLIV
Sbjct  1    MAADTHGPTPKGLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLGNANVRGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL SDD  H+LSIGANML
Sbjct  61   GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLGSDDGSHQLSIGANML  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQG+RAG  PYRGTLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGIRAGLEPYRGTLSAL  162


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGI-RAGLEPYRGTL--SALRRIACEEGIRGLYSGLVP-ALAGVSHVAI  190

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L   D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  191  QFPTYEKIKIYLAKRDNTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  247



>ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Vitis vinifera]
 emb|CBI36905.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M A++H PSP+GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLP+LGN NI+GSLIV
Sbjct  1    MPAESHAPSPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPQLGNGNIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS+DE H+LSIGANM+
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSNDENHQLSIGANMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA GAGAATTIATNPLWVVKTRLQTQGMRAG VPY  TLSAL
Sbjct  121  AACGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYSSTLSAL  162


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G      +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RAGVVPYSSTL--SALRRIAYEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L S +     +L      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKMYLASRENTTMDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250



>ref|XP_009784346.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AHI58944.1| chloroplast nicotinamide adenine dinucleotide transporter 1 [Nicotiana 
tabacum]
Length=315

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M AD HGP+PKGLLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPK+G  N+RGSLIV
Sbjct  1    MAADTHGPTPKGLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKIGTANVRGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL SDD  H+LSIGANML
Sbjct  61   GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLGSDDGSHQLSIGANML  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGM+AG  PYRGTLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMKAGLEPYRGTLSAL  162


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-KAGLEPYRGTL--SALRRIACEEGIRGLYSGLVP-ALAGVSHVAI  190

Query  460  YFTIYEQLKSFLCSDDERH--ELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L   D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  191  QFPTYEKIKIYLAKRDNTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  247



>ref|XP_010559180.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559181.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559195.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559196.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
Length=315

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+ D+HGPSP GLLCNA AGAAAGVIAATFVCPLDVIKTRFQVHGLPKLG+ +++GSLIV
Sbjct  1    MSGDSHGPSPMGLLCNASAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLGDGSVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLE IF++EG+RG+YRGLSP+V+ALLPNWAVYFT+Y+QLKSFLCS+DE H+LS+GANM+
Sbjct  61   GSLEHIFKKEGMRGLYRGLSPSVMALLPNWAVYFTMYDQLKSFLCSNDEDHKLSVGANMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  162


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L    +    +LS     +A++ A    +  T P  VV+ RLQ QG  +
Sbjct  191  QFPTYEKIKIYLAKKGNTTTDKLSARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250



>ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Solanum tuberosum]
Length=316

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADA-HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M AD  HGP+PKG+LCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKLGN N+RGSLI
Sbjct  1    MVADTTHGPTPKGVLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLGNANVRGSLI  60

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            VG+LE IFQ+EGLRGMYRGLSPTVLALLPNWAVYFTIY+QLK FL SDD  H+L+IGANM
Sbjct  61   VGNLEHIFQKEGLRGMYRGLSPTVLALLPNWAVYFTIYDQLKRFLGSDDGSHQLTIGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            LAA+GAGAATTIATNPLWVVKTRLQTQGMR GF PYRGTLSAL
Sbjct  121  LAASGAGAATTIATNPLWVVKTRLQTQGMRTGFEPYRGTLSAL  163


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-RTGFEPYRGTL--SALRRIAYEEGIRGLYSGLVP-ALAGVSHVAI  191

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L   ++    +L      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKIYLAKRANTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251



>ref|XP_010103406.1| Mitochondrial substrate carrier family protein W [Morus notabilis]
 gb|EXB95725.1| Mitochondrial substrate carrier family protein W [Morus notabilis]
Length=315

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M ADAH P+PKG+L NAGAGAAAGVIAATFVCPLDVIKTRFQVHG+P L + NI+GSLIV
Sbjct  1    MAADAHSPTPKGVLRNAGAGAAAGVIAATFVCPLDVIKTRFQVHGIPTLNHGNIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EGLRGMYRGL+PTVLALLPNWAVYF++YEQLKS LCSDDE H+LS+GAN++
Sbjct  61   GSLEQIFRKEGLRGMYRGLAPTVLALLPNWAVYFSMYEQLKSLLCSDDEHHQLSVGANVI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+ AGAAT IATNPLWVVKTRLQTQGMR G VPYR TLSAL
Sbjct  121  AASCAGAATIIATNPLWVVKTRLQTQGMRPGVVPYRSTLSAL  162


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RPGVVPYRSTL--SALSRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L   +     +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYERIKLYLADRENTTMDKLSARDVAIASSISKIFASTLTYPHEVVRSRLQEQGHHS  250



>ref|XP_007051022.1| NAD+ transporter 1 [Theobroma cacao]
 gb|EOX95179.1| NAD+ transporter 1 [Theobroma cacao]
Length=308

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+ D+H P+ +GLLCNAGAGAAAGVIAA+FVCPLDVIKTRFQVHGLPKLGN  ++GSLIV
Sbjct  1    MSNDSHAPNSRGLLCNAGAGAAAGVIAASFVCPLDVIKTRFQVHGLPKLGNGAVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EGLRGMYRGLSPTVLALLPNWAVYFT+YEQLK FLCS++E H LSIGANML
Sbjct  61   GSLEQIFRKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKDFLCSNNENHHLSIGANML  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTI TNPLWVVKTRLQTQGMR G VPYR TLSAL
Sbjct  121  AASGAGAATTIFTNPLWVVKTRLQTQGMRVGVVPYRSTLSAL  162


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ ++G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  132  FTNPLWVVKTRLQTQGM-RVGVVPYRSTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  187

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L   D     +LS     +A++ +    +  T P  VV++RLQ QG
Sbjct  188  VAIQFPTYEKIKLYLADKDNTTMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  247

Query  625  MRA  633
              +
Sbjct  248  HHS  250



>gb|EYU46767.1| hypothetical protein MIMGU_mgv1a010350mg [Erythranthe guttata]
Length=315

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M AD HGPSP+GLLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLP++ N NI+GS+IV
Sbjct  1    MAADTHGPSPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPQIANANIKGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF +EGLRGMYRGL+PTVLALLPNWAVYFTIY+QLKS L +DD  H+LS+GANM+
Sbjct  61   GSLEQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTIYDQLKSSLAADDVNHQLSVGANMM  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGA TTI TNPLWVVKTR QTQGMR G VPY GTLSAL
Sbjct  121  AASGAGAVTTILTNPLWVVKTRFQTQGMRIGTVPYTGTLSAL  162


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ ++G     G+L   +L +I Q+EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQTQGM-RIGTVPYTGTL--SALRRIAQKEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L   D     +LS G   LA++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKCTLADRDNTTTDKLSAGHVALASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250



>ref|XP_002523136.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF39321.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=314

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+ D H P+P+GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKL N  I+GSLIV
Sbjct  1    MSTDTHAPNPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLDNGTIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQREGLRGMYRGL+PTVLALLPNWAVYFT+YEQ KSFL S+ E H LS+GANM+
Sbjct  61   GSLEQIFQREGLRGMYRGLAPTVLALLPNWAVYFTMYEQFKSFLSSNGENH-LSVGANMI  119

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTI TNPLWVVKTRLQTQGMR+G VPYRGTLSAL
Sbjct  120  AASGAGAATTIFTNPLWVVKTRLQTQGMRSGVVPYRGTLSAL  161


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  131  FTNPLWVVKTRLQTQGM-RSGVVPYRGTL--SALRRIAHVEGIRGLYSGLLP-ALAGISH  186

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +LS     +A++ +    +  T P  VV++RLQ QG
Sbjct  187  VAIQFPTYEKIKFYLANQDNTTMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  246

Query  625  MRA  633
              +
Sbjct  247  HHS  249



>ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Solanum lycopersicum]
Length=313

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M AD   P+PKG+LCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKLGN N+RGSLIV
Sbjct  1    MAADR--PTPKGVLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLGNANVRGSLIV  58

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            G+LE IFQ+EGLRGMYRGLSPTVLALLPNWAVYFTIY+QLK FL SDD  H+L+IGANML
Sbjct  59   GNLEHIFQKEGLRGMYRGLSPTVLALLPNWAVYFTIYDQLKRFLGSDDGSHQLTIGANML  118

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR GF PYRGTLSAL
Sbjct  119  AASGAGAATTIATNPLWVVKTRLQTQGMRTGFEPYRGTLSAL  160


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  133  PLWVVKTRLQTQGM-RTGFEPYRGTL--SALRRIAYEEGIRGLYSGLVP-ALAGVSHVAI  188

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L   ++    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  189  QFPTYEKIKIYLAKRANTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  245



>ref|XP_011082440.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
 ref|XP_011082441.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
Length=301

 Score =   222 bits (566),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M A+ HGPSPKGLLCNAGAGAAAG+IAATFVCPLDVIKTR QVHGLP+L + NI+GS+IV
Sbjct  1    MAANTHGPSPKGLLCNAGAGAAAGMIAATFVCPLDVIKTRLQVHGLPQLASANIKGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL +DD  H+LS+GANM+
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLGADD--HQLSVGANMM  118

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTI TNPLWVVKTRLQTQG+R   VPYR TLSAL
Sbjct  119  AASGAGAATTIVTNPLWVVKTRLQTQGIRRDVVPYRSTLSAL  160


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ +      R +L   +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  133  PLWVVKTRLQTQGIRR-DVVPYRSTL--SALQRIAHEEGIRGLYSGLVPA-LAGISHVAI  188

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L         +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  189  QFPTYEKIKCYLADQGNTTIDKLSASDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  248



>ref|XP_006294636.1| hypothetical protein CARUB_v10023674mg [Capsella rubella]
 gb|EOA27534.1| hypothetical protein CARUB_v10023674mg [Capsella rubella]
Length=314

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS+DE H LS+GAN+L
Sbjct  61   GSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSNDEHHRLSVGANVL  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+ TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMRVGVVPYKSTLSAL  162


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ ++G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RVGVVPYKSTL--SALRRIGYEEGIRGLYSGLVPA-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG  +
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250



>ref|XP_007200447.1| hypothetical protein PRUPE_ppa008929mg [Prunus persica]
 gb|EMJ01646.1| hypothetical protein PRUPE_ppa008929mg [Prunus persica]
Length=313

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  190  ADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS  369
            AD H P+PK  LCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLP+LGN N++GSLIVG 
Sbjct  4    ADTHAPNPKCHLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPRLGNGNVKGSLIVGY  63

Query  370  LEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaa  549
            LEQIF +EGLRGMYRGLSPTVLALLPNWAVYFTIY+QLK+FLCSDDE H L +GANMLAA
Sbjct  64   LEQIFHKEGLRGMYRGLSPTVLALLPNWAVYFTIYDQLKNFLCSDDENHHLPVGANMLAA  123

Query  550  agagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +GAGAATTIATNPLWVVKTRLQTQGMR G VPYR TLSAL
Sbjct  124  SGAGAATTIATNPLWVVKTRLQTQGMRPGVVPYRSTLSAL  163


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-RPGVVPYRSTL--SALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKFYLANRDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251



>gb|KDO87105.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=315

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+H P+ KG+LCNAGAGAAAG+IAATFVCPLDVIKTR QVHGLPKL N  ++GSLIV
Sbjct  1    MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFT+YEQLKSFLCS+D+ H LS+GAN++
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AAA AGAATTIATNPLWVVKTRLQTQGM+AG VPYR TLSAL
Sbjct  121  AAAVAGAATTIATNPLWVVKTRLQTQGMKAGVVPYRSTLSAL  162


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    R +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-KAGVVPYRSTL--SALSRIAQEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L    +    +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G     ++  R S +V  ++++FQ+EGL G YRG +  +L   P
Sbjct  231  TLTYPHEVVRSRLQEQG----HHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTP  286

Query  448  NWAVYFTIYEQLKSFLCS----DDERHEL  522
               + FT +E +  FL S    D + H L
Sbjct  287  AAVITFTSFEMIHRFLVSYFPPDPQPHTL  315



>gb|KJB06733.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=315

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            MT D+H P+ + LLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKLGN  IR SLIV
Sbjct  1    MTNDSHPPNSRSLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLGNATIRRSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLK  LCS+D +H+LS+GANML
Sbjct  61   GSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKDCLCSNDGKHQLSVGANML  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATT  TNPLWVVKTRLQTQGMRAG VPYRGT SAL
Sbjct  121  AASGAGAATTCFTNPLWVVKTRLQTQGMRAGVVPYRGTFSAL  162


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+    +L +I   EG+RG+Y GL P  LA + +
Sbjct  132  FTNPLWVVKTRLQTQGM-RAGVVPYRGTF--SALRRIAHEEGIRGLYSGLVP-ALAGISH  187

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  188  VAIQFPTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  247

Query  625  MRA  633
              +
Sbjct  248  HHS  250



>ref|XP_008807764.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Phoenix dactylifera]
Length=315

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H PS +GLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHGL  L N++++GSLI+
Sbjct  1    MSAESHSPSTRGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLASLKNSSVKGSLII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLKS LCSDD  H+LS+G NM+
Sbjct  61   GSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLCSDDGSHQLSVGHNMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTR QTQGMR G VPY+GTL+AL
Sbjct  121  AASGAGAATTIATNPLWVVKTRFQTQGMRGGVVPYQGTLNAL  162


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQTQGM-RGGVVPYQGTL--NALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D    + LS G   +A++ +  A +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKTYLAKRDNTTINSLSAGDVAVASSVSKIAASTLTYPHEVVRSRLQEQGFHS  250



>ref|XP_008235160.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Prunus mume]
Length=313

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  190  ADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS  369
            A+ H P+PK  LCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLP+LGN N++GSLIVG 
Sbjct  4    AETHAPNPKCHLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPRLGNGNVKGSLIVGY  63

Query  370  LEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaa  549
            LEQIF +EGLRGMYRGLSPTVLALLPNWAVYFTIY+QLK+FLCSDDE H L IGANMLAA
Sbjct  64   LEQIFHKEGLRGMYRGLSPTVLALLPNWAVYFTIYDQLKNFLCSDDESHHLPIGANMLAA  123

Query  550  agagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +GAGAATTIATNPLWVVKTRLQTQGMR G VPYR TLSAL
Sbjct  124  SGAGAATTIATNPLWVVKTRLQTQGMRPGVVPYRSTLSAL  163


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-RPGVVPYRSTL--SALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKFYLANQDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251



>gb|KDP28207.1| hypothetical protein JCGZ_13978 [Jatropha curcas]
Length=312

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 3/162 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+HGP+P+GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPK  + NI+GSLIV
Sbjct  1    MPTDSHGPNPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPK--HRNIKGSLIV  58

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF+REGLRGMYRGL PTVLALLPNWAVYF+IYEQLKSFL S+DE H LSIGAN++
Sbjct  59   GSLEQIFRREGLRGMYRGLGPTVLALLPNWAVYFSIYEQLKSFLSSNDENH-LSIGANVI  117

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTI TNPLWVVKTRLQTQGMR G VPYRGTLSAL
Sbjct  118  AASGAGAATTIFTNPLWVVKTRLQTQGMREGVVPYRGTLSAL  159


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  129  FTNPLWVVKTRLQTQGM-REGVVPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  184

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE +K +L + D     +LS     +A++ +    +  T P  VV++RLQ QG
Sbjct  185  VAIQFPAYETIKIYLANRDNTSADKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  244

Query  625  MRA  633
              +
Sbjct  245  HHS  247



>ref|XP_007163152.1| hypothetical protein PHAVU_001G210600g [Phaseolus vulgaris]
 gb|ESW35146.1| hypothetical protein PHAVU_001G210600g [Phaseolus vulgaris]
Length=318

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 151/165 (92%), Gaps = 3/165 (2%)
 Frame = +1

Query  184  MTADAH---GPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            M+ADAH     +PKGLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHG+P+L N +++GS
Sbjct  1    MSADAHPVNHINPKGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGVPQLTNGSVKGS  60

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IVGSLEQIF++EGLRGMYRGL+PTVLALLPNWAVYF+ YEQLKSFL SDD+ H LSIG+
Sbjct  61   IIVGSLEQIFRKEGLRGMYRGLAPTVLALLPNWAVYFSTYEQLKSFLHSDDDSHHLSIGS  120

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AA+GAGAATT+ TNPLWVVKTRLQTQG+R+G VPYRGTLSAL
Sbjct  121  NMIAASGAGAATTMFTNPLWVVKTRLQTQGIRSGVVPYRGTLSAL  165


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  135  FTNPLWVVKTRLQTQGI-RSGVVPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  190

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  191  VAIQFPTYETIKFYLANQDDTAMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  250

Query  625  MRA  633
              +
Sbjct  251  HHS  253



>gb|KHG29129.1| Mitochondrial nicotinamide adenine dinucleotide transporter 1 
[Gossypium arboreum]
Length=315

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            MT D+  P+ + LLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKLGN+ IR SLIV
Sbjct  1    MTNDSQPPNSRSLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLGNSTIRRSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLK  LCS+D +H+LS+GANML
Sbjct  61   GSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKDCLCSNDGKHQLSVGANML  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATT  TNPLWVVKTRLQTQGMRAG VPYRGT SAL
Sbjct  121  AASGAGAATTCFTNPLWVVKTRLQTQGMRAGVVPYRGTFSAL  162


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+    +L +I + EG+RG+Y GL P  LA + +
Sbjct  132  FTNPLWVVKTRLQTQGM-RAGVVPYRGTF--SALRRIAREEGIRGLYSGLVP-ALAGISH  187

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  188  VAIQFPTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  247



>ref|XP_010905689.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=305

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H PS +GLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHGLP L N+ ++GSLI+
Sbjct  1    MSAESHSPSTRGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPSLKNSTVKGSLII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLKS LCSDD    LS+G NM+
Sbjct  61   GSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLCSDDGSGRLSVGDNMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTR QTQGMR G VPY+GTL+AL
Sbjct  121  AASGAGAATTIATNPLWVVKTRFQTQGMRVGVVPYQGTLNAL  162



>ref|XP_010905688.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=315

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H PS +GLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHGLP L N+ ++GSLI+
Sbjct  1    MSAESHSPSTRGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPSLKNSTVKGSLII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLKS LCSDD    LS+G NM+
Sbjct  61   GSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLCSDDGSGRLSVGDNMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTR QTQGMR G VPY+GTL+AL
Sbjct  121  AASGAGAATTIATNPLWVVKTRFQTQGMRVGVVPYQGTLNAL  162


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ ++G    +G+L   +L +I   EG+RG+Y G+ P  LA + + A+
Sbjct  135  PLWVVKTRFQTQGM-RVGVVPYQGTL--NALRRIAHEEGIRGLYSGIVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D    + L  G   +A++ +  A +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKTYLAKRDNTTINSLGAGDVAVASSVSKIAASTLTYPHEVVRSRLQEQGFHS  250



>ref|XP_006480018.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Citrus sinensis]
Length=315

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+H P+ KG+LCNAGAGAAAG+IAATFVCPLDVIKTR QVHGLPKL N  ++GSLIV
Sbjct  1    MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFT+YEQLKSFLCS+D+ H LS+GAN++
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AAA AGAATTIATNPLWVVKTRLQTQGM+A  VPYR TLSAL
Sbjct  121  AAAVAGAATTIATNPLWVVKTRLQTQGMKAVVVPYRSTLSAL  162


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K      R +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-KAVVVPYRSTL--SALSRIAQEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L    +    +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G     ++  R S +V  ++++FQ+EGL G YRG +  +L   P
Sbjct  231  TLTYPHEVVRSRLQEQG----HHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTP  286

Query  448  NWAVYFTIYEQLKSFLCS----DDERHEL  522
               + FT +E +  FL S    D + H L
Sbjct  287  AAVITFTSFEMIHRFLVSYFPPDPQPHTL  315



>ref|XP_002880307.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56566.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 151/162 (93%), Gaps = 2/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV+AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVVAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF+REG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS+D  H+LS+GAN+L
Sbjct  61   GSLEQIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSND--HKLSVGANVL  118

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+ TLSAL
Sbjct  119  AASGAGAATTIATNPLWVVKTRLQTQGMRVGIVPYKSTLSAL  160


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ ++G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  133  PLWVVKTRLQTQGM-RVGIVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  188

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG  +
Sbjct  189  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  248



>ref|XP_010518450.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=314

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS D   +LS+GAN+L
Sbjct  61   GSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSKDVDRKLSVGANVL  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  162


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  247



>ref|XP_010507885.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=314

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS D   +LS+GAN+L
Sbjct  61   GSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSKDVDRKLSVGANVL  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  162


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  247



>emb|CDP17096.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADA-HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            MT D  H  S +GLLCNAGAGAAAGVIAATFVCPLDVIKTR QVHGLPKL   NI+GS+I
Sbjct  1    MTGDTTHLFSSRGLLCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLPKLAGANIKGSII  60

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            VGSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS LCSD   H+LSIGANM
Sbjct  61   VGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSLLCSDGVNHQLSIGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            LAA GAGAATTIATNPLWVVKTRLQTQGMR G +PYRGTLSAL
Sbjct  121  LAATGAGAATTIATNPLWVVKTRLQTQGMRNGVMPYRGTLSAL  163


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 66/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-RNGVMPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L + +     +L+     +A++ +    +  T P  VV++RLQ QG
Sbjct  192  QFPAYEKIKLYLANRENTTMDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  248



>gb|KDO87104.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=316

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+H P+ KG+LCNAGAGAAAG+IAATFVCPLDVIKTR QVHGLPKL N  ++GSLIV
Sbjct  1    MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWAVYFT+YEQLKSFLCS+D+ H LS+GAN++
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVI  120

Query  544  aaagagaattiatNPLWVVKTRL-QTQGMRAGFVPYRGTLSAL  669
            AAA AGAATTIATNPLWVVKTRL QTQGM+AG VPYR TLSAL
Sbjct  121  AAAVAGAATTIATNPLWVVKTRLQQTQGMKAGVVPYRSTLSAL  163


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 5/120 (4%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q     K G    R +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQQTQGMKAGVVPYRSTL--SALSRIAQEEGIRGLYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L    +    +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G     ++  R S +V  ++++FQ+EGL G YRG +  +L   P
Sbjct  232  TLTYPHEVVRSRLQEQG----HHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTP  287

Query  448  NWAVYFTIYEQLKSFLCS----DDERHEL  522
               + FT +E +  FL S    D + H L
Sbjct  288  AAVITFTSFEMIHRFLVSYFPPDPQPHTL  316



>ref|XP_010523970.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
Length=308

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M++ +HGPSP+GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLG+ + +GSLIV
Sbjct  1    MSSYSHGPSPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLGDGSTKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
             SLEQIF+REG+RG+YRGLSPTV+ALLPNWA+YFT+Y QLKSFLCS+DE  +LS+GANM+
Sbjct  61   RSLEQIFKREGMRGLYRGLSPTVMALLPNWAIYFTMYGQLKSFLCSNDEDRKLSVGANMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTR Q+QGMR   VPYR TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRFQSQGMRTAVVPYRSTLSAL  162


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ +      R +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQSQGM-RTAVVPYRSTL--SALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDERHE--LSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L    +R +  LS     +A++ A    +  T P  VV+ RLQ QG R+
Sbjct  191  QFPTYEKIKIYLAKKGDRTKDNLSAQDVAVASSIAKIFASTLTYPHEVVRARLQEQGHRS  250



>ref|XP_011041851.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=322

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 148/167 (89%), Gaps = 6/167 (4%)
 Frame = +1

Query  187  TADAHGPSPKG----LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPK--LGNTNIR  348
            T D+H  +P      LLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPK  +  ++I+
Sbjct  3    TTDSHAHAPTNPKQCLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKYDVATSSIK  62

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GSLIVGSLEQIF+REGLRGMYRGLSPTVLALLPNWAVYFTIYEQ KSFLCS+DE H LSI
Sbjct  63   GSLIVGSLEQIFRREGLRGMYRGLSPTVLALLPNWAVYFTIYEQFKSFLCSNDESHHLSI  122

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GANM+AA+GAGAATTI TNPLWVVKTRLQTQGMRAG VPYR TLSAL
Sbjct  123  GANMIAASGAGAATTIFTNPLWVVKTRLQTQGMRAGIVPYRSTLSAL  169


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  139  FTNPLWVVKTRLQTQGM-RAGIVPYRSTL--SALRRIAHEEGMRGLYSGLIP-ALAGVSH  194

Query  451  WAVYFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L +  +    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  195  VAIQFPTYEKIKMYLAARGNTTMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  254

Query  625  MRA  633
              +
Sbjct  255  FHS  257



>ref|NP_566102.1| NAD+ transporter 1 [Arabidopsis thaliana]
 sp|O22261.2|NDT1_ARATH RecName: Full=Nicotinamide adenine dinucleotide transporter 1, 
chloroplastic; Short=AtNDT1; AltName: Full=NAD(+) transporter 
1 [Arabidopsis thaliana]
 gb|AAK50096.1|AF372957_1 At2g47490/T30B22.21 [Arabidopsis thaliana]
 gb|AAL69531.1| At2g47490/T30B22.21 [Arabidopsis thaliana]
 gb|AAC62861.2| putative mitochondrial carrier protein [Arabidopsis thaliana]
 gb|AAM61452.1| putative mitochondrial carrier protein [Arabidopsis thaliana]
 emb|CAI38582.1| mitochondrial carrier like protein [Arabidopsis thaliana]
 dbj|BAH19521.1| AT2G47490 [Arabidopsis thaliana]
 emb|CAR70090.1| chloroplastic nicotinamide adenine dinucleotide transporter 1 
[Arabidopsis thaliana]
 gb|AEC10850.1| NAD+ transporter 1 [Arabidopsis thaliana]
Length=312

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 150/162 (93%), Gaps = 2/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV+AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVVAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF+REG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS+D  H+LS+GAN+L
Sbjct  61   GSLEQIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSND--HKLSVGANVL  118

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+ T SAL
Sbjct  119  AASGAGAATTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSAL  160



>ref|XP_002320327.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE98642.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=322

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 148/167 (89%), Gaps = 6/167 (4%)
 Frame = +1

Query  187  TADAHGPSPKG----LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPK--LGNTNIR  348
            T D+H  +P      LLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPK  +  ++I+
Sbjct  3    TTDSHAHAPTNPKQCLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKYDVATSSIK  62

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GSLIVGSLEQIF+REGLRGMYRGL+PTVLA+LPNWAVYFTIYEQ KSFLCS+DE H LSI
Sbjct  63   GSLIVGSLEQIFRREGLRGMYRGLAPTVLAMLPNWAVYFTIYEQFKSFLCSNDESHHLSI  122

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GANM+AA+GAGAATTI TNPLWVVKTRLQTQGMRAG VPYR TLSAL
Sbjct  123  GANMIAASGAGAATTIFTNPLWVVKTRLQTQGMRAGIVPYRSTLSAL  169


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  139  FTNPLWVVKTRLQTQGM-RAGIVPYRSTL--SALRRIAHEEGMRGLYSGLVP-ALAGVSH  194

Query  451  WAVYFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L +  +    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  195  VAIQFPTYEKIKMYLATRGNTTMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  254

Query  625  MRA  633
              +
Sbjct  255  FHS  257



>ref|XP_004495929.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Cicer arietinum]
Length=317

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +1

Query  184  MTADAHGPSP--KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            M+ D+H P+P  +GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHG  +L N  ++GSL
Sbjct  1    MSTDSHAPNPYPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGSLQLANGTVKGSL  60

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIgan  537
            IVGSLEQI+ +EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLKS LCSDD+ H LS+GAN
Sbjct  61   IVGSLEQIYHKEGLRGMYRGLAPTVLALLPNWAVYFTVYEQLKSLLCSDDKNHHLSVGAN  120

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAATT+ TNP WVVKTRLQTQGMR G VPYR TLSAL
Sbjct  121  VIAASGAGAATTVVTNPFWVVKTRLQTQGMRPGVVPYRNTLSAL  164



>ref|XP_010506785.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Camelina sativa]
Length=314

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKSVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS D   +LS+GAN+L
Sbjct  61   GSLEQISKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSKDVDRKLSVGANVL  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  162



>ref|XP_011079611.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
Length=317

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M AD HGPSPK LLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLP+L N  ++GS+IV
Sbjct  1    MAADTHGPSPKVLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPQLPNAKVKGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIFQ+EGLRGMYRGL+PTVLA+LPNWAVYFTIY+QLKS L +DD  H+L +GANM+
Sbjct  61   GSLEQIFQKEGLRGMYRGLAPTVLAMLPNWAVYFTIYDQLKSSLGADDVNHQLPLGANMM  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AAAGAGAATTIATNPLWV+KTRLQTQGMR G VPYR TLS L
Sbjct  121  AAAGAGAATTIATNPLWVIKTRLQTQGMRKGVVPYRSTLSGL  162


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL VIKTR Q  G+ K G    R +L    L++I   EG+RG+Y GL P  LA + +  +
Sbjct  135  PLWVIKTRLQTQGMRK-GVVPYRSTL--SGLKRIAHEEGIRGLYSGLVP-ALAGISHVGI  190

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++KS L   D     +LS     LA++ +    +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKSHLADRDNTTTDKLSASDVALASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250



>gb|KFK37525.1| hypothetical protein AALP_AA4G268400 [Arabis alpina]
Length=314

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H  + K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG  NI+GSLIV
Sbjct  1    MSANSHPHNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGPANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLE+IF+ EG RG+YRGLSPTV+ALL NWAVYFT+Y+Q KSFL S+DE H+LS+GAN++
Sbjct  61   GSLEKIFKEEGTRGLYRGLSPTVMALLSNWAVYFTLYDQFKSFLISNDEDHKLSVGANVM  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+GTLSAL
Sbjct  121  AASGAGAATTIATNPLWVVKTRLQTQGMREGIVPYKGTLSAL  162


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRLQTQGM-REGIVPYKGTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDERH--ELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE +K +L     +    L+     +A++ A    +  T P  VV+ RLQ QG  +
Sbjct  191  QFPTYEMIKIYLAKKGNKSIDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250



>ref|XP_010259426.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=315

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  ++HGP+ KGLLCNAGAGAAAG IAATFVCPLDVIKTRFQVHG+P LG    +GSLIV
Sbjct  1    MPGESHGPNTKGLLCNAGAGAAAGAIAATFVCPLDVIKTRFQVHGIPNLGGGTTKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
             SLEQIFQ+EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLK  L +DD  H+LS+GANM+
Sbjct  61   RSLEQIFQKEGVRGMYRGLSPTVLALLPNWAVYFTMYEQLKGLLYTDDGNHQLSVGANMI  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AAAGAGAATTIATNPLWVVKTR QTQG R G VPYRGTLSAL
Sbjct  121  AAAGAGAATTIATNPLWVVKTRFQTQGTRGGVVPYRGTLSAL  162


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G  + G    RG+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQTQGT-RGGVVPYRGTL--SALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K +L   D+     LS     +A++ +  A +  T P  VV++RLQ QG  +
Sbjct  191  QFPTYEKIKIYLAKRDKTTTDTLSARDVAVASSVSKIAASTLTYPHEVVRSRLQEQGHHS  250



>ref|XP_002302737.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE82010.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=322

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 146/167 (87%), Gaps = 6/167 (4%)
 Frame = +1

Query  187  TADAH---GPSPKG-LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKL--GNTNIR  348
            + D+H    P+PK  LLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKL     + +
Sbjct  3    STDSHVHPRPNPKQCLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLDVAANSFK  62

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GSLIV SLEQIF+REGLRGMYRGL+PTVLALLPNWAVYFTIYEQLKSFLCS+DE H LSI
Sbjct  63   GSLIVSSLEQIFRREGLRGMYRGLAPTVLALLPNWAVYFTIYEQLKSFLCSNDEGHHLSI  122

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GANM+AA+GAGA T I TNPLWVVKTRLQTQGMRAG VPYR TLSAL
Sbjct  123  GANMIAASGAGAVTAIFTNPLWVVKTRLQTQGMRAGVVPYRSTLSAL  169


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  139  FTNPLWVVKTRLQTQGM-RAGVVPYRSTL--SALRRIAYEEGIRGLYSGLVP-ALAGISH  194

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  195  VAIQFPTYEKIKMYLATRDNTAMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  254



>ref|XP_010507884.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=319

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 5/167 (3%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWA-----VYFTIYEQLKSFLCSDDERHELSI  528
            GSLEQIF++EG+RG+YRGLSPTV+ALL NWA     +YFT+Y+QLKSFLCS D   +LS+
Sbjct  61   GSLEQIFKKEGMRGLYRGLSPTVMALLSNWATYFLQIYFTMYDQLKSFLCSKDVDRKLSV  120

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAN+LAA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  121  GANVLAASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  167


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  140  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  195

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  196  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  252



>ref|XP_011007801.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=322

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 145/167 (87%), Gaps = 6/167 (4%)
 Frame = +1

Query  187  TADAHG---PSPKG-LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKL--GNTNIR  348
            + D+H    P+PK  LLCNAGAGAAAGVIAA FVCPLDVIKTRFQVHGLPKL     + +
Sbjct  3    STDSHAHPHPNPKQCLLCNAGAGAAAGVIAAAFVCPLDVIKTRFQVHGLPKLDVAANSFK  62

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GSLI+ SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS+DE H LSI
Sbjct  63   GSLIISSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSNDEGHHLSI  122

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GANM+AA+GAGA TTI TNPLWVVKTRLQTQGMR G VPYR TLSAL
Sbjct  123  GANMIAASGAGAVTTIFTNPLWVVKTRLQTQGMRVGVVPYRSTLSAL  169


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ ++G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  139  FTNPLWVVKTRLQTQGM-RVGVVPYRSTL--SALRRIAYEEGIRGLYSGLVP-ALAGISH  194

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L S D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  195  VAIQFPTYEKIKMYLASRDNTAMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  254

Query  625  MRA  633
              +
Sbjct  255  HHS  257



>ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide adenine dinucleotide 
transporter 1, chloroplastic-like [Cucumis melo]
Length=311

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 4/162 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M++D+H P+P+GLLCNAGAGAAAGV+AATFVCPLDVIKTRFQVHGLP +G    +GSLIV
Sbjct  1    MSSDSHAPTPRGLLCNAGAGAAAGVLAATFVCPLDVIKTRFQVHGLPNIG----KGSLIV  56

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSL+QIF +EGLRGMYRGL+PTVLALLPNWAVYFTIY QLK+FL SDDE  +LSIGANM+
Sbjct  57   GSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTIYGQLKTFLGSDDEHCQLSIGANMM  116

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGM++G +PYR T+SAL
Sbjct  117  AASGAGAATTIATNPLWVVKTRLQTQGMKSGVLPYRNTVSAL  158


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    R +  V +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  131  PLWVVKTRLQTQGM-KSGVLPYRNT--VSALKRIASEEGIRGLYSGLVP-ALAGVSHVAI  186

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE +KS+L S D     +L+     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  187  QFPTYEXIKSYLASRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHS  246



>ref|XP_003554533.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Glycine max]
Length=317

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  184  MTADAHGP---SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            MTAD H     +PKGLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHG+P+L + + +GS
Sbjct  1    MTADTHAAPNINPKGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGVPQLAHRSAKGS  60

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IV SLEQ+F +EGLRGMYRGL+PTVLALLPNWAVYF+ YEQLKS L SDD  H LSIGA
Sbjct  61   IIVASLEQVFHKEGLRGMYRGLAPTVLALLPNWAVYFSAYEQLKSLLQSDDS-HHLSIGA  119

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AA+GAGAATT+ TNPLWVVKTRLQTQGMR G VPYRGTLSAL
Sbjct  120  NMIAASGAGAATTMFTNPLWVVKTRLQTQGMRPGVVPYRGTLSAL  164


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  134  FTNPLWVVKTRLQTQGM-RPGVVPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  189

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  190  VAIQFPTYETIKFYLANQDDTAMEKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  249

Query  625  MRA  633
              +
Sbjct  250  HHS  252



>ref|XP_004136010.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 ref|XP_004162441.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 gb|KGN44980.1| hypothetical protein Csa_7G405860 [Cucumis sativus]
Length=311

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 148/162 (91%), Gaps = 4/162 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M++D+H P+P+GLLCNAGAGAAAGV+AATFVCPLDVIKTRFQVHGLP +G    +GSLIV
Sbjct  1    MSSDSHAPTPRGLLCNAGAGAAAGVLAATFVCPLDVIKTRFQVHGLPNIG----KGSLIV  56

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSL+QIF +EGLRGMYRGL+PTVLALLPNWAVYFTIY QLK+FL SD E  +LSIGANM+
Sbjct  57   GSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTIYGQLKTFLASDHEHCQLSIGANMM  116

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGM++G +PYR T+SAL
Sbjct  117  AASGAGAATTIATNPLWVVKTRLQTQGMKSGVLPYRNTVSAL  158


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    R +  V +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  131  PLWVVKTRLQTQGM-KSGVLPYRNT--VSALKRIASEEGIRGLYSGLVP-ALAGVSHVAI  186

Query  460  YFTIYEQLKSFLCSDDE--RHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++KS+L   D     +L+     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  187  QFPTYEKIKSYLARRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHS  246



>ref|XP_003521580.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Glycine max]
 gb|KHN20379.1| Mitochondrial nicotinamide adenine dinucleotide transporter 2 
[Glycine soja]
Length=317

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +1

Query  184  MTADAHGP---SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            MTAD H     +PKGLLCNA AGA+AGVIAATFVCPLDVIKTRFQVHG+P+L + +++GS
Sbjct  1    MTADTHAAPNINPKGLLCNAAAGASAGVIAATFVCPLDVIKTRFQVHGVPQLAHGSVKGS  60

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IV SLEQIF +EGLRGMYRGL+PTVLALLPNWAVYF+ YEQLKS L SDD  H L IGA
Sbjct  61   IIVASLEQIFHKEGLRGMYRGLAPTVLALLPNWAVYFSAYEQLKSLLHSDDS-HHLPIGA  119

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            N++AA+GAGAATT+ TNPLWVVKTRLQTQG+R G VPYRGTLSAL
Sbjct  120  NVIAASGAGAATTMFTNPLWVVKTRLQTQGIRPGVVPYRGTLSAL  164


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  134  FTNPLWVVKTRLQTQGI-RPGVVPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  189

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  190  VAIQFPTYETIKFYLANQDDAAMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  249

Query  625  MRA  633
              +
Sbjct  250  HHS  252



>ref|XP_009414905.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            MTA++H P+ +GLLC+A AGA+AG IAATFVCPLDVIKTRFQVHGLPK+ +  ++GS+I+
Sbjct  1    MTAESHSPTTRGLLCHAAAGASAGAIAATFVCPLDVIKTRFQVHGLPKICSNGVKGSVII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLKSFL S+D  H+LSIGANM 
Sbjct  61   GSLEQILKKEGVRGMYRGLSPTVLALLPNWAVYFTVYEQLKSFLSSNDGNHQLSIGANMF  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTR Q Q +R G VPY+GTL++L
Sbjct  121  AASGAGAATTIATNPLWVVKTRFQAQELRVGTVPYQGTLNSL  162


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ   L ++G    +G+L   SL +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQAQEL-RVGTVPYQGTL--NSLRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++KS+L   D      L+     +A++ +    +  T P  VV+++LQ QG  A
Sbjct  191  QFPTYEKIKSYLAEQDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFHA  250

Query  634  GFVPYRGTLSAL  669
              + Y+G +  +
Sbjct  251  E-MRYKGVIDCI  261



>ref|XP_006397944.1| hypothetical protein EUTSA_v10001547mg [Eutrema salsugineum]
 gb|ESQ39397.1| hypothetical protein EUTSA_v10001547mg [Eutrema salsugineum]
Length=326

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIVGSLEQIF++EG+RG+YRGLSPTV+ALL 
Sbjct  41   TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGVRGLYRGLSPTVMALLS  100

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYFT+Y+QLKSFL S+D+ H+LS+GAN++AA+GAGAATTIATNPLWVVKTRLQTQGM
Sbjct  101  NWAVYFTMYDQLKSFLSSNDKDHKLSVGANVMAASGAGAATTIATNPLWVVKTRLQTQGM  160

Query  628  RAGFVPYRGTLSAL  669
            RAG VPY+ TLSAL
Sbjct  161  RAGVVPYKSTLSAL  174


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  147  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  202

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  203  QFPTYEMIKIYLAKKGDKSIDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  259



>gb|AES61717.2| substrate carrier family protein [Medicago truncatula]
Length=312

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHGPS--PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            M+ D+H P+   KGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHG P+L N ++RGSL
Sbjct  1    MSTDSHPPNLYAKGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGTPQLANGSVRGSL  60

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIgan  537
            IVGSL QI+ +EG+RGMYRGL+PTVLALLPNWA+YFT+YEQLK  L S+DE H LS+GAN
Sbjct  61   IVGSLGQIYHKEGMRGMYRGLAPTVLALLPNWAIYFTMYEQLKRLL-SNDESHHLSVGAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAATT+ TNP WVVKTRLQTQGMR G VPYR TLSAL
Sbjct  120  VVAASGAGAATTMVTNPFWVVKTRLQTQGMRPGVVPYRSTLSAL  163


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P  V+KTR Q  G+ + G    R +L   +L++I   EG+RGMY GL P  LA + + A+
Sbjct  136  PFWVVKTRLQTQGM-RPGVVPYRSTL--SALKRIAHEEGIRGMYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L + D     +L      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKFHLANQDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251



>ref|NP_001055296.1| Os05g0357200 [Oryza sativa Japonica Group]
 gb|AAV43843.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 gb|AAV43947.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 dbj|BAF17210.1| Os05g0357200 [Oryza sativa Japonica Group]
 dbj|BAG88995.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79050.1| hypothetical protein OsI_19613 [Oryza sativa Indica Group]
Length=336

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  199  HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            H  S +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  23   HATSARGLLCHAAAGASAGVVAATFVCPLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQ  82

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPT+LALLPNWAVYFT+YEQLKS L S+D  H LS+GAN++AA+ A
Sbjct  83   IAQREGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSLLSSNDRSHHLSLGANVIAASCA  142

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            G ATTIATNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  143  GGATTIATNPLWVVKTRFQTQGIRAGVIPYKGTLAAL  179


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  152  PLWVVKTRFQTQGI-RAGVIPYKGTL--AALKRIAHEEGIRGLYSGLVP-ALAGISHVAI  207

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  208  QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAHS  267



>ref|XP_009414904.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=316

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIR-GSLI  360
            MTA++H P+ +GLLC+A AGA+AG IAATFVCPLDVIKTRFQVHGLPK+ +  ++ GS+I
Sbjct  1    MTAESHSPTTRGLLCHAAAGASAGAIAATFVCPLDVIKTRFQVHGLPKICSNGVKAGSVI  60

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            +GSLEQI ++EG+RGMYRGLSPTVLALLPNWAVYFT+YEQLKSFL S+D  H+LSIGANM
Sbjct  61   IGSLEQILKKEGVRGMYRGLSPTVLALLPNWAVYFTVYEQLKSFLSSNDGNHQLSIGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             AA+GAGAATTIATNPLWVVKTR Q Q +R G VPY+GTL++L
Sbjct  121  FAASGAGAATTIATNPLWVVKTRFQAQELRVGTVPYQGTLNSL  163


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ   L ++G    +G+L   SL +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRFQAQEL-RVGTVPYQGTL--NSLRRIAHEEGIRGLYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++KS+L   D      L+     +A++ +    +  T P  VV+++LQ QG  A
Sbjct  192  QFPTYEKIKSYLAEQDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFHA  251

Query  634  GFVPYRGTLSAL  669
              + Y+G +  +
Sbjct  252  E-MRYKGVIDCI  262



>gb|EEE63395.1| hypothetical protein OsJ_18207 [Oryza sativa Japonica Group]
Length=336

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  199  HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            H  S +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  23   HATSARGLLCHAAAGASAGVVAATFVCPLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQ  82

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPT+LALLPNWAVYFT+YEQLKS L S+D  H LS+GAN++AA+ A
Sbjct  83   IAQREGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSLLSSNDRSHHLSLGANVIAASCA  142

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            G ATTIATNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  143  GGATTIATNPLWVVKTRFQTQGIRAGVIPYKGTLAAL  179


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  152  PLWVVKTRFQTQGI-RAGVIPYKGTL--AALKRIAHEEGIRGLYSGLVP-ALAGISHVAI  207

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  208  QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAHS  267



>gb|KJB06737.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=317

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFV--CPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            MT D+H P+ + LLCNAGAGAAAG    + +   P  VIKTR QVHGLPKLGN  IR SL
Sbjct  1    MTNDSHPPNSRSLLCNAGAGAAAGTSIISCLLPSPTYVIKTRLQVHGLPKLGNATIRRSL  60

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIgan  537
            IVGSLEQIFQ+EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLK  LCS+D +H+LS+GAN
Sbjct  61   IVGSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKDCLCSNDGKHQLSVGAN  120

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            MLAA+GAGAATT  TNPLWVVKTRLQTQGMRAG VPYRGT SAL
Sbjct  121  MLAASGAGAATTCFTNPLWVVKTRLQTQGMRAGVVPYRGTFSAL  164


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+    +L +I   EG+RG+Y GL P  LA + +
Sbjct  134  FTNPLWVVKTRLQTQGM-RAGVVPYRGTF--SALRRIAHEEGIRGLYSGLVP-ALAGISH  189

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  190  VAIQFPTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  249

Query  625  MRA  633
              +
Sbjct  250  HHS  252



>ref|XP_009142527.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Brassica rapa]
 emb|CDX80110.1| BnaA05g00460D [Brassica napus]
Length=306

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H  +   +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKL + NI+GS+IV
Sbjct  1    MSANSHPTT--NVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLAHPNIKGSIIV  58

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSL+QIF++EG+RG+YRGLSPTV+ALL NWAVYFT+Y+QLKSFL S+D+ H+ S+GAN++
Sbjct  59   GSLKQIFKQEGMRGLYRGLSPTVMALLSNWAVYFTMYDQLKSFLISNDKDHKFSVGANVM  118

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+ TLSAL
Sbjct  119  AASGAGAATTIATNPLWVVKTRLQTQGMREGVVPYKSTLSAL  160



>ref|XP_004962357.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Setaria italica]
Length=340

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GP-SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP S +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKLG   I GS+I+GSL+Q
Sbjct  27   GPTSARGLLCHAVAGASAGVVAATFVCPLDVIKTRFQVHGWPKLGTGTIGGSVIIGSLQQ  86

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPTVLALLPNWAVYFT+YEQLKS L S+D  H+LS+GAN++AA+ A
Sbjct  87   IAQREGFRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASCA  146

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAAT+I TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  147  GAATSIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAAL  183


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  156  PLWVVKTRFQTQGI-RAGPIPYKGTL--AALSRIAHEEGIRGLYSGLVP-ALAGVSHVAI  211

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  212  QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTMTYPHEVVRSRLQDQGAHS  271



>ref|XP_006444424.1| hypothetical protein CICLE_v10024227mg [Citrus clementina]
 gb|ESR57664.1| hypothetical protein CICLE_v10024227mg [Citrus clementina]
Length=319

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+H P+ KG+LCNAGAGAAAG+IAATFVCPLDVIKTR QVHGLPKL N  ++GSLIV
Sbjct  1    MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAV----YFTIYEQLKSFLCSDDERHELSIg  531
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWA+          +LKSFLCS+D+ H LS+G
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWAIAELFILQCTSRLKSFLCSEDKNHHLSVG  120

Query  532  anmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AN++AAA AGAATTIATNPLWVVKTRLQTQGM+AG VPYR TLSAL
Sbjct  121  ANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAGVVPYRSTLSAL  166


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    R +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  139  PLWVVKTRLQTQGM-KAGVVPYRSTL--SALSRIAQEEGIRGLYSGLVP-ALAGISHVAI  194

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L    +    +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  195  QFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  254


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G     ++  R S +V  ++++FQ+EGL G YRG +  +L   P
Sbjct  235  TLTYPHEVVRSRLQEQG----HHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTP  290

Query  448  NWAVYFTIYEQLKSFLCS----DDERHEL  522
               + FT +E +  FL S    D + H L
Sbjct  291  AAVITFTSFEMIHRFLVSYFPPDPQPHTL  319



>gb|KEH24418.1| substrate carrier family protein [Medicago truncatula]
Length=319

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 143/165 (87%), Gaps = 5/165 (3%)
 Frame = +1

Query  187  TADAHGP----SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            ++DAH      +PK +L NA +GA+AGVIAATFVCPLDVIKTRFQV G+P+L N  ++GS
Sbjct  3    SSDAHTAPTNINPKCILFNAASGASAGVIAATFVCPLDVIKTRFQV-GVPQLANGTVKGS  61

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IV SL+QIF +EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLKS L SDDE H LS+G+
Sbjct  62   VIVASLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKSLLHSDDESHHLSVGS  121

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGAATT+ TNPLWVVKTRLQTQGMR+G VPYR TLSAL
Sbjct  122  NMVAAAGAGAATTLFTNPLWVVKTRLQTQGMRSGVVPYRSTLSAL  166


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  136  FTNPLWVVKTRLQTQGM-RSGVVPYRSTL--SALRRIASEEGIRGLYSGLVPA-LAGISH  191

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F +YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  192  VAIQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  251

Query  625  MRA  633
              +
Sbjct  252  HHS  254



>emb|CDY57720.1| BnaC04g51920D [Brassica napus]
Length=309

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAH-GPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M+A++H   +   +LCNA AGAAAGVIAATFVCPLDVIKTRFQVHGLPKL + NI+GS+I
Sbjct  1    MSANSHPTTNSTNVLCNAAAGAAAGVIAATFVCPLDVIKTRFQVHGLPKLAHPNIKGSII  60

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            VGSL+QIF++EG RG+YRGLSPTV+ALL NWAVYFT+Y+QLKSF  S+D+ H+ S+GAN+
Sbjct  61   VGSLKQIFKQEGTRGLYRGLSPTVMALLSNWAVYFTMYDQLKSFSISNDKDHKFSVGANV  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AA+GAGAATTIATNPLWVVKTRLQTQGMR G VPY+ TLSAL
Sbjct  121  MAASGAGAATTIATNPLWVVKTRLQTQGMREGVVPYKSTLSAL  163


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-REGVVPYKSTL--SALRRIAYEEGIRGLYSGLVP-ALAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE +K++L +  ++   +L+     +A++ A    +  T P  VV+ RLQ QG  +
Sbjct  192  QFPTYEMVKTYLANKGDKSIDDLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  251



>gb|AFW81643.1| hypothetical protein ZEAMMB73_626020 [Zea mays]
Length=224

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAVAGASAGVVAATFVCPLDVIKTRFQVHGWPKLTTGTIGGSVIIGSLQQ  86

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPTVLALLPNWAVYFT+YEQLKS L S+D  H+LS+GAN++AA+ A
Sbjct  87   IAQREGFRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASCA  146

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAATT  TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  147  GAATTTVTNPLWVVKTRFQTQGIRAGPMPYKGTLAAL  183



>ref|XP_006654293.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like, 
partial [Oryza brachyantha]
Length=324

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  199  HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            H  S +GLLC+AGAGA+AGV+AATFVCPLDVIKTRFQVHG PK+      GS+I+GSL+Q
Sbjct  11   HATSARGLLCHAGAGASAGVVAATFVCPLDVIKTRFQVHGWPKITTGTFGGSVIIGSLQQ  70

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPT+LALLPNWAVYFT+YEQLKS L SDD  H+LS+GAN++AA+ A
Sbjct  71   IAQREGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSLLSSDDGSHQLSLGANVIAASCA  130

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            G ATTIATNPLWVVKTR QTQG+RAG +PY+ TLSAL
Sbjct  131  GGATTIATNPLWVVKTRFQTQGIRAGVIPYKSTLSAL  167


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 7/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    + +L   +L++I   EG+RG+Y GL P  LA + + A+
Sbjct  140  PLWVVKTRFQTQGI-RAGVIPYKSTL--SALKRIAHEEGIRGLYSGLVP-ALAGISHVAI  195

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  196  QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAHS  255

Query  634  GFVPYRGTL  660
                Y+G +
Sbjct  256  E-ARYKGVM  263



>ref|XP_004494928.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like, 
partial [Cicer arietinum]
Length=312

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  193  DAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL  372
            D H  + K LL NA +GA+AGVIAATFVCPLDVIKTRFQVHG+P+ GN +++GS+IV SL
Sbjct  1    DPHAAT-KCLLFNAASGASAGVIAATFVCPLDVIKTRFQVHGVPQFGNRSVKGSIIVASL  59

Query  373  EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDE-RHELSIganmlaa  549
            +QIF +EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLKS L SDDE  H LS+GANM+AA
Sbjct  60   KQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKSLLHSDDESHHHLSVGANMVAA  119

Query  550  agagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +GAGAATT+ TNPLWVVKTRLQTQGMR G VPYR TL+AL
Sbjct  120  SGAGAATTLFTNPLWVVKTRLQTQGMRPGIVPYRSTLTAL  159


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  129  FTNPLWVVKTRLQTQGM-RPGIVPYRSTLT--ALRRIAHEEGIRGLYSGLVPA-LAGISH  184

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F +YE++K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  185  VAIQFPMYEKIKFYLANQDDTAVDKLGARDVAIASSVSKIFASTMTYPHEVVRSRLQEQG  244

Query  625  MRA  633
              +
Sbjct  245  HHS  247



>ref|XP_002439632.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor]
 gb|EES18062.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor]
Length=340

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAVAGASAGVVAATFVCPLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQ  86

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPTVLALLPNWAVYFT+YEQLKS L S+D  H+LS+GAN++AA+ A
Sbjct  87   IAQREGFRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASCA  146

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAATTI TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  147  GAATTIVTNPLWVVKTRFQTQGIRAGSIPYKGTLAAL  183


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G+   +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  156  PLWVVKTRFQTQGI-RAGSIPYKGTL--AALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  211

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
             F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ Q
Sbjct  212  QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQ  267



>gb|EPS67920.1| hypothetical protein M569_06852 [Genlisea aurea]
Length=316

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTAD-AHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M AD  HG S + LLCNAGAGAAAGVIAA+FVCPLDVIKTR QVHGLP+L N NI+GS+I
Sbjct  1    MAADHTHGHSSRTLLCNAGAGAAAGVIAASFVCPLDVIKTRLQVHGLPQLTNANIKGSII  60

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            +GSLEQI Q+EG RGMYRGLSPT++ALLPNWAVYFT+Y+QLKS+L +DD  H+L +GANM
Sbjct  61   LGSLEQIVQKEGFRGMYRGLSPTIIALLPNWAVYFTVYDQLKSYLGADDINHQLPVGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AA+GAGAATT+ TNPLWVVKTRLQTQG+  G V YR TLSAL
Sbjct  121  IAASGAGAATTLVTNPLWVVKTRLQTQGLIEGVVRYRSTLSAL  163


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  GL + G    R +L   +L +I + EG RG+Y G+ P  LA + + A+
Sbjct  136  PLWVVKTRLQTQGLIE-GVVRYRSTL--SALRRIVREEGFRGLYSGIIPA-LAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K++L   D     +LS G   LA++ +    +  T P  VV++RLQ QG  +
Sbjct  192  QFPTYEKIKTYLAHRDNTTMDKLSAGDVALASSVSKIFASTLTYPHEVVRSRLQAQGQHS  251



>ref|XP_006855345.1| hypothetical protein AMTR_s00057p00101290 [Amborella trichopoda]
 gb|ERN16812.1| hypothetical protein AMTR_s00057p00101290 [Amborella trichopoda]
Length=316

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D+  PS +G+LCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLP+L N   +GSLI+
Sbjct  1    MVLDSQRPSTRGILCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPEL-NGRRKGSLIL  59

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQI ++EG+RGMYRGL+PTVLALLPNWAVYFT+YEQ KS L S D+ ++LSIGANM+
Sbjct  60   GSLEQIARKEGVRGMYRGLAPTVLALLPNWAVYFTMYEQFKSLLHSPDDNNQLSIGANMI  119

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+ AGAATTI TNPLWVVKTR QTQGMRAG +PYR TLSAL
Sbjct  120  AASAAGAATTIVTNPLWVVKTRFQTQGMRAGVMPYRSTLSAL  161


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  134  PLWVVKTRFQTQGM-RAGVMPYRSTL--SALRRIAHEEGIRGLYSGLLP-ALAGISHVAI  189

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L  +       LS     LA++ +  A +  T P  VV++RLQ QG
Sbjct  190  QFPTYEKIKDYLAREGNTTPDALSAADVALASSVSKIAASTLTYPHEVVRSRLQEQG  246



>ref|XP_010684596.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=312

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S   +LCNAGAGAAAGVIAATFVCPLDVIKTR QVHGL  LGN   +G +IV SL QIF 
Sbjct  6    SHNSILCNAGAGAAAGVIAATFVCPLDVIKTRLQVHGLSSLGNGAAKGGVIVSSLNQIFH  65

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            +EGLRGMYRGLSPTVLALLPNWAVYFT+YEQLKS L SDD RH+LS+GAN++AA+GAGAA
Sbjct  66   KEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSLLGSDDGRHQLSVGANVIAASGAGAA  125

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T I TNPLWVVKTR QTQGMR G VPY+ TLSAL
Sbjct  126  TVIVTNPLWVVKTRFQTQGMRKGVVPYKSTLSAL  159


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ K G    + +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  132  PLWVVKTRFQTQGMRK-GVVPYKSTL--SALRRIAQEEGIRGLYSGLVPA-LAGISHVAI  187

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F IYEQ+KS+L + DE    ++      +A++ +    +  T P  VV++RLQ QG  +
Sbjct  188  QFPIYEQVKSYLANKDETAIDKIPARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  247



>ref|XP_008647348.1| PREDICTED: uncharacterized protein LOC100192773 isoform X1 [Zea 
mays]
Length=340

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+AGAGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAGAGASAGVVAATFVCPLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQ  86

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I Q+EG RGMYRGLSPT+LALLPNWAVYFT+YEQLKSFL S+D  H+LS+GAN++AA+ A
Sbjct  87   IAQQEGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSFLSSNDGSHQLSLGANVVAASCA  146

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAATTI TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  147  GAATTIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAAL  183


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  156  PLWVVKTRFQTQGI-RAGPIPYKGTL--AALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  211

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ Q
Sbjct  212  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQ  267



>ref|XP_010518451.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=306

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 141/162 (87%), Gaps = 8/162 (5%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+A++H P+ K +LCNA AGAAAGV AATFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct  1    MSANSHPPNSKNVLCNAAAGAAAGVFAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
            GSLEQIF++EG+RG+YRGLSPTV+ALL NWA        LKSFLCS D   +LS+GAN+L
Sbjct  61   GSLEQIFKKEGMRGLYRGLSPTVMALLSNWA--------LKSFLCSKDVDRKLSVGANVL  112

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  113  AASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  154


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  127  PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  182

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  183  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  239



>ref|NP_001146478.1| uncharacterized protein LOC100280066 [Zea mays]
 gb|ACL54103.1| unknown [Zea mays]
 gb|AFW81642.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_626020 [Zea 
mays]
Length=340

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+A AGA+AGV+AATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAVAGASAGVVAATFVCPLDVIKTRFQVHGWPKLTTGTIGGSVIIGSLQQ  86

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I QREG RGMYRGLSPTVLALLPNWAVYFT+YEQLKS L S+D  H+LS+GAN++AA+ A
Sbjct  87   IAQREGFRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASCA  146

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAATT  TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  147  GAATTTVTNPLWVVKTRFQTQGIRAGPMPYKGTLAAL  183


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 6/120 (5%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + 
Sbjct  152  TVTNPLWVVKTRFQTQGI-RAGPMPYKGTL--AALRRIAHEEGIRGLYSGLVP-ALAGIS  207

Query  448  NWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + A+ F  YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ Q
Sbjct  208  HVAIQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQ  267



>ref|NP_001131441.1| uncharacterized protein LOC100192773 [Zea mays]
 gb|ACF79846.1| unknown [Zea mays]
 gb|ACG42192.1| mitochondrial carrier YEL006W [Zea mays]
 gb|ACN33438.1| unknown [Zea mays]
 gb|AFW77704.1| carrier YEL006W [Zea mays]
Length=336

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 5/157 (3%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+AGAGA+AGV+AATFVCPLDVIKTRFQVHG PKL      GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAGAGASAGVVAATFVCPLDVIKTRFQVHGWPKLAT----GSVIIGSLQQ  82

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I Q+EG RGMYRGLSPT+LALLPNWAVYFT+YEQLKSFL S+D  H+LS+GAN++AA+ A
Sbjct  83   IAQQEGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSFLSSNDGSHQLSLGANVVAASCA  142

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAATTI TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  143  GAATTIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAAL  179


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  152  PLWVVKTRFQTQGI-RAGPIPYKGTL--AALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  207

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ Q
Sbjct  208  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQ  263



>ref|XP_009383545.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  + H  + +GLLC+A AGA+AG IAATFVCPLDVIKTR QVHGLPK+ +   +GS+I+
Sbjct  1    MATETHSHTTRGLLCHAAAGASAGAIAATFVCPLDVIKTRLQVHGLPKIDSNGAKGSIII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
             SLEQI +REG+ GMYRGLSPTVLALLPNWAVYFT+YEQ KS L S+D  H+LSIGANM 
Sbjct  61   RSLEQIVKREGVLGMYRGLSPTVLALLPNWAVYFTVYEQSKSLLSSNDGNHQLSIGANMF  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAG ATTI TNPLWVVKTR Q Q +R G VPY+GTL++L
Sbjct  121  AASGAGVATTIVTNPLWVVKTRFQAQELRVGMVPYQGTLNSL  162


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 16/130 (12%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ   L ++G    +G+L   SL +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQAQEL-RVGMVPYQGTL--NSLRRIAHEEGIRGLYSGLVPA-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAGF  639
             F  YE++K   C   ER   S        + +    +  T P  VV+++LQ QG  A  
Sbjct  191  QFPAYEKIK---CCLAERAVAS--------SISKIVASTLTYPHEVVRSKLQEQGFHAE-  238

Query  640  VPYRGTLSAL  669
            + Y+G +  +
Sbjct  239  MQYKGVIDCI  248



>ref|XP_009383544.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  + H  + +GLLC+A AGA+AG IAATFVCPLDVIKTR QVHGLPK+ +   +GS+I+
Sbjct  1    MATETHSHTTRGLLCHAAAGASAGAIAATFVCPLDVIKTRLQVHGLPKIDSNGAKGSIII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
             SLEQI +REG+ GMYRGLSPTVLALLPNWAVYFT+YEQ KS L S+D  H+LSIGANM 
Sbjct  61   RSLEQIVKREGVLGMYRGLSPTVLALLPNWAVYFTVYEQSKSLLSSNDGNHQLSIGANMF  120

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAG ATTI TNPLWVVKTR Q Q +R G VPY+GTL++L
Sbjct  121  AASGAGVATTIVTNPLWVVKTRFQAQELRVGMVPYQGTLNSL  162


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 7/132 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ   L ++G    +G+L   SL +I   EG+RG+Y GL P  LA + + A+
Sbjct  135  PLWVVKTRFQAQEL-RVGMVPYQGTL--NSLRRIAHEEGIRGLYSGLVP-ALAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L   D      L+     +A++ +    +  T P  VV+++LQ QG  A
Sbjct  191  QFPAYEKIKCCLAERDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFHA  250

Query  634  GFVPYRGTLSAL  669
              + Y+G +  +
Sbjct  251  E-MQYKGVIDCI  261



>ref|XP_008782321.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Phoenix dactylifera]
Length=360

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+ + HGPS + LL NA AGA+AG+IAATFVCPLDVIKTR QVHGLP L ++  RGSLIV
Sbjct  1    MSQEFHGPSTRDLLRNACAGASAGMIAATFVCPLDVIKTRLQVHGLPSLPSSARRGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganm  540
             SLEQI + EG RGMYRGLSPT+LALLPNWAVYFT+Y++LK  L S  D  ++LSIGAN+
Sbjct  61   SSLEQIIKTEGFRGMYRGLSPTILALLPNWAVYFTVYDKLKGKLLSHADINNQLSIGANI  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AA+GAGAAT IATNPLWVVKTRLQTQGMR G VPYR  +SAL
Sbjct  121  IAASGAGAATAIATNPLWVVKTRLQTQGMRPGVVPYRSIMSAL  163


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R   I+ +L++I   EG+RG+Y GL P ++  + + A+
Sbjct  136  PLWVVKTRLQTQGM-RPGVVPYRS--IMSALKRISHEEGIRGLYSGLLPALVG-VSHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE++KS+L   D     +LS G   +A++ +    +  T P  VV++RLQ QG  R
Sbjct  192  QFPAYEKIKSYLARRDNTTVDKLSAGNVAIASSLSKILASTMTYPHEVVRSRLQEQGHAR  251

Query  631  AGFVPYRGTL  660
            +    Y G L
Sbjct  252  SAVNHYAGAL  261


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G  +    +  G+L     +++FQ++G+RG YRG +  +L   P
Sbjct  232  TMTYPHEVVRSRLQEQGHARSAVNHYAGAL--DCTKKVFQKDGIRGFYRGCATNLLRTTP  289

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE ++ FL
Sbjct  290  AAVITFTSYEMIQRFL  305



>ref|XP_003568632.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Brachypodium distachyon]
Length=340

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +1

Query  223  LCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLR  402
            L NA AGA+AGVIAATFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+QI +REG R
Sbjct  34   LSNAVAGASAGVIAATFVCPLDVIKTRFQVHGWPKLAPGTIGGSVIIGSLQQITRREGFR  93

Query  403  GMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiat  582
            G+YRGLSPTVLALLPNWAVYFT+YEQLKS L SD+  H+LS+GAN++AA+ AGAATTI T
Sbjct  94   GLYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSDEGSHQLSVGANVIAASCAGAATTIVT  153

Query  583  NPLWVVKTRLQTQGMRAG-FVPYRGTLSAL  669
            NPLWVVKTR QTQG+R+G  +PY+GT+ AL
Sbjct  154  NPLWVVKTRFQTQGIRSGVMIPYKGTVGAL  183


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+        +G+  VG+L +I + EG+RG+Y GL P  LA + + A+
Sbjct  155  PLWVVKTRFQTQGIRSGVMIPYKGT--VGALTRIAREEGIRGLYSGLVPA-LAGITHVAI  211

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  212  QFPVYEKMKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGAHS  271

Query  634  GFVPYRGTL  660
                YRG +
Sbjct  272  E-ARYRGVI  279



>dbj|BAJ85199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTRFQVHG PKL    I GS+IVGSL+QI +REG RG+YRGLSPT+LALLP
Sbjct  51   TFVCPLDVIKTRFQVHGWPKLAPGTIGGSVIVGSLQQIARREGFRGLYRGLSPTILALLP  110

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYFT+YEQLKS L S++  H+LS+GAN++AA+ AGAATTIATNPLWVVKTR QTQG+
Sbjct  111  NWAVYFTVYEQLKSMLASNEGSHQLSLGANVIAASCAGAATTIATNPLWVVKTRFQTQGV  170

Query  628  RAGF-VPYRGTLSAL  669
            RAG  +PY+GT++AL
Sbjct  171  RAGATIPYKGTVAAL  185


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 6/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+        +G+  V +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  157  PLWVVKTRFQTQGVRAGATIPYKGT--VAALTRIAHEEGIRGLYSGLVP-ALAGITHVAI  213

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  214  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQDQGAHS  273

Query  634  GFVPYRGTL  660
                YRG +
Sbjct  274  E-ARYRGVI  281



>dbj|BAJ89038.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTRFQVHG PKL    I GS+IVGSL+QI +REG RG+YRGLSPT+LALLP
Sbjct  51   TFVCPLDVIKTRFQVHGWPKLAPGTIGGSVIVGSLQQIARREGFRGLYRGLSPTILALLP  110

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYFT+YEQLKS L S++  H+LS+GAN++AA+ AGAATTIATNPLWVVKTR QTQG+
Sbjct  111  NWAVYFTVYEQLKSMLASNEGSHQLSLGANVIAASCAGAATTIATNPLWVVKTRFQTQGV  170

Query  628  RAGF-VPYRGTLSAL  669
            RAG  +PY+GT++AL
Sbjct  171  RAGATIPYKGTVAAL  185


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 6/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+        +G+  V +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  157  PLWVVKTRFQTQGVRAGATIPYKGT--VAALTRIAHEEGIRGLYSGLVP-ALAGITHVAI  213

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  214  QFPVYEKIKAYLAERDNTTVEALSSGDVAVASSLAKLAASTLTYPHEVVRSRLQDQGAHS  273

Query  634  GFVPYRGTL  660
                YRG +
Sbjct  274  E-ARYRGVI  281



>gb|ACU15209.1| unknown [Glycine max]
Length=147

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = +1

Query  184  MTADAHGP---SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            MTAD H     +PKGLLCNA AGA+AGVIAATFVC LDVIKTRFQVHG+P+L + +++GS
Sbjct  1    MTADTHAAPNINPKGLLCNAAAGASAGVIAATFVCLLDVIKTRFQVHGVPQLAHGSVKGS  60

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IV SLEQIF +EGLRGMYRGL+PTVLALLPNWAVYF+ YEQLKS L SDD  H L IGA
Sbjct  61   IIVASLEQIFHKEGLRGMYRGLAPTVLALLPNWAVYFSAYEQLKSLLHSDDS-HHLPIGA  119

Query  535  nmlaaagagaattiatNPLWVVKTRLQT  618
            N++AA+GAGAATT+ TNPLWVVKTRLQT
Sbjct  120  NVIAASGAGAATTMFTNPLWVVKTRLQT  147



>gb|KEH24419.1| substrate carrier family protein [Medicago truncatula]
Length=312

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 12/165 (7%)
 Frame = +1

Query  187  TADAHGP----SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            ++DAH      +PK +L NA +GA+AGVIAATFVCPLDVIKTRFQV G+P+L N  ++GS
Sbjct  3    SSDAHTAPTNINPKCILFNAASGASAGVIAATFVCPLDVIKTRFQV-GVPQLANGTVKGS  61

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIga  534
            +IV SL+QIF +EGLRGMYRGL+PTVLALLPNWAVYFT+YEQLKS L SDDE H LS+G+
Sbjct  62   VIVASLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTMYEQLKSLLHSDDESHHLSVGS  121

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGAATT+ TNPLW       TQGMR+G VPYR TLSAL
Sbjct  122  NMVAAAGAGAATTLFTNPLW-------TQGMRSGVVPYRSTLSAL  159



>ref|XP_009409783.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=333

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M  D HGPS + LLCNA AGA+AG+IAATFVCPLDV+KTR QVHGLP L  ++ RGSLI+
Sbjct  1    MPGDLHGPSLRDLLCNACAGASAGIIAATFVCPLDVVKTRLQVHGLPNLPQSSRRGSLII  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDER---HELSIga  534
             SLEQI ++EG +GMY GLSPT+LALLPNWAVYFT+Y++LK  L S D     ++LS+GA
Sbjct  61   SSLEQIIRKEGFKGMYHGLSPTILALLPNWAVYFTVYDKLKGLLHSHDATKVDNQLSVGA  120

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            N+LAA+GAGAAT + TNPLWVVKTRLQTQ +R G VPY+  +SAL
Sbjct  121  NVLAASGAGAATAVVTNPLWVVKTRLQTQRIRPGVVPYKSVMSAL  165



>ref|XP_006842368.1| hypothetical protein AMTR_s00079p00187170 [Amborella trichopoda]
 gb|ERN04043.1| hypothetical protein AMTR_s00079p00187170 [Amborella trichopoda]
Length=345

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M +D+ GPS + LLCNA AGA AG IAATFVCPLDVIKTR QVHGLPK       GSLIV
Sbjct  1    MGSDSGGPSTRDLLCNAVAGAGAGAIAATFVCPLDVIKTRLQVHGLPKHAQG---GSLIV  57

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDE-RHELSIganm  540
             SL+QI + EG+RG+YRGLSPTVLALLPNWAVYFTIYEQ+K  L S D   ++LSIG +M
Sbjct  58   ASLKQIVKTEGVRGLYRGLSPTVLALLPNWAVYFTIYEQVKGLLQSHDRGNNQLSIGKHM  117

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            LAA+ AGAAT + TNPLWVVKTRLQTQGMR+G VPY   LS+L
Sbjct  118  LAASCAGAATALTTNPLWVVKTRLQTQGMRSGVVPYGSILSSL  160


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+         GS I+ SL +I   EG+RG+Y GL P  LA + + A+
Sbjct  133  PLWVVKTRLQTQGMRS--GVVPYGS-ILSSLRRIAHEEGIRGLYSGLLP-ALAGVSHVAI  188

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F +YE+LK++L + +     +LS G   +A++ +    +  T P  VV++RLQ QG
Sbjct  189  QFPVYEKLKAYLAARENTTPDKLSAGNVAIASSVSKVLASTMTYPHEVVRSRLQEQG  245



>ref|XP_002527012.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF35384.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=372

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +1

Query  193  DAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL  372
             +H PSP+ L+C+AGAGAAAG IAATFVCPLDVIKTR QVHGLP   N+   GS+IV S 
Sbjct  7    SSHNPSPRELICHAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPTTSNSGRPGSIIVTSF  66

Query  373  EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaa  552
            + I + EGL+G+YRGLSPT++ALLPNWAVYFT+YEQLK  L   DE  EL++GANM+AAA
Sbjct  67   QNIIKTEGLKGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLSHGDEHSELAVGANMVAAA  126

Query  553  gagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAGAAT IATNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  127  GAGAATAIATNPLWVVKTRLQTQGMRPDVVPYKSILSAL  165


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    I+ +L +I + EG+RG+Y G+ P+ LA + + A
Sbjct  138  PLWVVKTRLQTQGMRPDV----VPYKSILSALGRIIREEGIRGLYSGVLPS-LAGISHVA  192

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-M  627
            + F  YE++KS++     R    LS G   +A++ A    ++ T P  VV++RLQ QG +
Sbjct  193  IQFPAYEKIKSYMAKKSSRTVDNLSTGDVAIASSVAKVLASVLTYPHEVVRSRLQEQGQV  252

Query  628  RAGFVPYRGTL  660
            R   V Y G +
Sbjct  253  RNSGVHYAGVV  263


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  ++ N+ +  + +V  ++++FQ+EG  G YRG +  ++   P+  +
Sbjct  238  PHEVVRSRLQEQG--QVRNSGVHYAGVVDCVKKVFQKEGFPGFYRGCATNLMRTTPSAVI  295

Query  460  YFTIYEQLKSFL---CSDDERH  516
             FT YE +  FL      D++H
Sbjct  296  TFTSYEMIHRFLDRVLPPDKKH  317



>ref|XP_010264768.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Nelumbo nucifera]
Length=365

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  202  GPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQI  381
            GP+   LLCNA AGAAAG IAATFVCPLDVIKTR QVHGLP + ++  RGSLIV SL+ I
Sbjct  8    GPTTTDLLCNACAGAAAGAIAATFVCPLDVIKTRLQVHGLPNVPHSGNRGSLIVSSLQNI  67

Query  382  FQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaaga  558
             + EG+RGMYRGLSPT+LALLPNWAVYFT+Y +LK+ L S  DE ++L+IGANM+AA+GA
Sbjct  68   IKNEGVRGMYRGLSPTILALLPNWAVYFTVYGKLKALLHSYVDEDNQLTIGANMIAASGA  127

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            G AT I+TNPLWVVKTRLQTQGMR+G VPY+  LSAL
Sbjct  128  GTATAISTNPLWVVKTRLQTQGMRSGVVPYKSILSAL  164


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +   I+ +L +I   EG+RG+Y GL P ++  + + A+
Sbjct  137  PLWVVKTRLQTQGM-RSGVVPYKS--ILSALRRISHEEGIRGLYSGLLPALVG-VSHVAI  192

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE +K++L   +     +L+ G   +A++ +    +  T P  VV++RLQ QG  R
Sbjct  193  QFPAYENMKAYLARRENTTVDKLTPGHFAIASSVSKILASTMTYPHEVVRSRLQEQGQAR  252

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  253  NPEVHYAGVI  262



>ref|XP_010279335.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Nelumbo nucifera]
Length=370

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +1

Query  193  DAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL  372
             + GP+ + LLCNAGAGAAAG IAATFVCPLDVIKTR QVHGLP L ++  RGSLI+ SL
Sbjct  5    SSEGPTTRDLLCNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPNLPHSGSRGSLIITSL  64

Query  373  EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaa  549
            + I + EG++GMYRGLSPT+LALLPNWAVYFT+YE+LK  L S  D  ++L++GANM+AA
Sbjct  65   QNIIKNEGMKGMYRGLSPTILALLPNWAVYFTVYEKLKGLLHSHVDRDNQLTVGANMVAA  124

Query  550  agagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             GAGAAT IATNPLWVVKTRLQTQG+R+G VPY+  LSAL
Sbjct  125  TGAGAATAIATNPLWVVKTRLQTQGVRSGVVPYKSILSAL  164


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 70/128 (55%), Gaps = 7/128 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +   I+ +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  137  PLWVVKTRLQTQGV-RSGVVPYKS--ILSALRRISHEEGIRGLYSGLLP-ALAGVSHVAI  192

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F +YE++K++L   +      LS G   +A++ +    +  T P  VV++RLQ QG  R
Sbjct  193  QFPVYEKMKAYLARRENTTVDNLSPGHVAIASSVSKILASTMTYPHEVVRSRLQEQGQAR  252

Query  631  AGFVPYRG  654
               V Y G
Sbjct  253  NPEVHYAG  260



>ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Medicago truncatula]
Length=379

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 3/148 (2%)
 Frame = +1

Query  184  MTADAHGPS--PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            M+ D+H P+   KGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHG P+L N ++RGSL
Sbjct  1    MSTDSHPPNLYAKGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGTPQLANGSVRGSL  60

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIgan  537
            IVGSL QI+ +EG+RGMYRGL+PTVLALLPNWA+YFT+YEQLK  L S+DE H LS+GAN
Sbjct  61   IVGSLGQIYHKEGMRGMYRGLAPTVLALLPNWAIYFTMYEQLKRLL-SNDESHHLSVGAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQ  621
            ++AA+GAGAATT+ TNP WVVKTRLQT+
Sbjct  120  VVAASGAGAATTMVTNPFWVVKTRLQTR  147



>ref|XP_010925998.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Elaeis guineensis]
Length=360

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M+ + HGPS + LL NA AGA+AG+IAATFVCPLDVIKTR QVHGLP L  +   GSLIV
Sbjct  1    MSEEFHGPSTRDLLRNACAGASAGMIAATFVCPLDVIKTRLQVHGLPNLPPSARGGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganm  540
             SL+QI + EG RGMYRGLSPT+LALLPNWAVYFT+Y++LK  L S  D  ++LSIGAN+
Sbjct  61   SSLKQIIKTEGFRGMYRGLSPTILALLPNWAVYFTVYDKLKGQLLSHADINNQLSIGANV  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AA+GAGAAT IATNPLWVVKTRLQTQG+R G VPYR  +SAL
Sbjct  121  IAASGAGAATAIATNPLWVVKTRLQTQGVRLGVVPYRSIMSAL  163


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ +LG    R   I+ +L++I   EG+RG+Y GL P ++  + +  +
Sbjct  136  PLWVVKTRLQTQGV-RLGVVPYRS--IMSALKRISHEEGIRGLYSGLLPALVG-VSHVTI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE +KS+L   D     +LS G   +A++ +    +  T P  VV++RLQ QG  R
Sbjct  192  QFPAYEMIKSYLARRDNTTVDKLSAGNVAIASSLSKILASTMTYPHEVVRSRLQEQGHAR  251

Query  631  AGFVPYRGTL  660
                 Y G L
Sbjct  252  NSVNHYAGAL  261



>gb|KJB48099.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=246

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +1

Query  220  LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL  399
            L+C+A +GA AG IAATFVCPLDVIKTR QVHGLP    T +R S+I+ SL+ I + EGL
Sbjct  20   LICHACSGATAGAIAATFVCPLDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTEGL  79

Query  400  RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaatti  576
            +G+YRGLSPT++ALLPNWAVYFT+YEQLK  L S D+   +L+IG NM+AAAGAGAAT I
Sbjct  80   KGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLASHDNNSAQLTIGENMVAAAGAGAATAI  139

Query  577  atNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             TNPLWVVKTRLQTQGMR G VPY G LSAL
Sbjct  140  VTNPLWVVKTRLQTQGMRTGVVPYTGVLSAL  170


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  143  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  198

Query  460  YFTIYEQLKSFLCSD  504
             F  YE++KS++   
Sbjct  199  QFPAYEKIKSYMAKK  213



>gb|KJB48097.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
 gb|KJB48100.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=359

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+C+A +GA AG IAATFVCPLDVIKTR QVHGLP    T +R S+I+ SL+ I + E
Sbjct  18   RELICHACSGATAGAIAATFVCPLDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTE  77

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaat  570
            GL+G+YRGLSPT++ALLPNWAVYFT+YEQLK  L S D+   +L+IG NM+AAAGAGAAT
Sbjct  78   GLKGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLASHDNNSAQLTIGENMVAAAGAGAAT  137

Query  571  tiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             I TNPLWVVKTRLQTQGMR G VPY G LSAL
Sbjct  138  AIVTNPLWVVKTRLQTQGMRTGVVPYTGVLSAL  170


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  143  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  198

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++KS++          LS     +A++ +    +I T P  V+++RLQ QG  R
Sbjct  199  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  258

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  259  HTEVQYAGVV  268


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  +  +T ++ + +V  + ++F++EG+ G YRG +  +L   P+  +
Sbjct  243  PHEVIRSRLQEQGQAR--HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVI  300

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  301  TFTSYEMIHRFL  312



>ref|XP_010906994.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=284

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M  +++G P+ + LL NA AGA+AG IAATFVCPLDVIKTRFQVHGLPK+   + R S+I
Sbjct  1    MPGESNGRPTIRDLLFNAVAGASAGAIAATFVCPLDVIKTRFQVHGLPKMP-PSARRSVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIgan  537
            + SLEQI + EG++G+YRGLSPT+ ALLPNWAVYFT+Y QLK  L S +D  ++LSI AN
Sbjct  60   ISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYFTVYNQLKGLLHSHEDGNNQLSISAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAAT +ATNPLWVVKTRLQTQGMR G VPYR  LSA 
Sbjct  120  IIAASGAGAATAVATNPLWVVKTRLQTQGMRPGVVPYRNMLSAF  163


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G  +  +T  + + +V  ++++FQ+EGL G YRG    +L   P
Sbjct  205  TMTYPHEVVRSRLQEQGQAR--DTANQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTP  262

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE ++ FL
Sbjct  263  TAVITFTSYEMIQRFL  278



>ref|XP_010906993.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=311

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M  +++G P+ + LL NA AGA+AG IAATFVCPLDVIKTRFQVHGLPK+   + R S+I
Sbjct  1    MPGESNGRPTIRDLLFNAVAGASAGAIAATFVCPLDVIKTRFQVHGLPKMP-PSARRSVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIgan  537
            + SLEQI + EG++G+YRGLSPT+ ALLPNWAVYFT+Y QLK  L S +D  ++LSI AN
Sbjct  60   ISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYFTVYNQLKGLLHSHEDGNNQLSISAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAAT +ATNPLWVVKTRLQTQGMR G VPYR  LSA 
Sbjct  120  IIAASGAGAATAVATNPLWVVKTRLQTQGMRPGVVPYRNMLSAF  163


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R  L   +  +I   EG+RG+Y GL P+ LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-RPGVVPYRNML--SAFRRIVHEEGVRGLYSGLLPS-LAGVSHVAI  191

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L   D     +LS G+  +A++ +    +  T P  VV++RLQ QG
Sbjct  192  QFPAYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQG  248


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G  +  +T  + + +V  ++++FQ+EGL G YRG    +L   P
Sbjct  232  TMTYPHEVVRSRLQEQGQAR--DTANQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTP  289

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE ++ FL
Sbjct  290  TAVITFTSYEMIQRFL  305



>ref|XP_010922196.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X4 [Elaeis guineensis]
Length=310

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M+ ++HG P+ + L+ NA AGA+AG IAATFVCPLDVIKTRFQVHGLP++  +  R S+I
Sbjct  1    MSRESHGRPAARDLIFNAAAGASAGAIAATFVCPLDVIKTRFQVHGLPEMPPSAQR-SVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            + SLEQI + EG++G+YRGLSPT+ ALLP WAVYFT+Y QLK  L S D  ++LSIGAN+
Sbjct  60   ISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHDGNNQLSIGANI  119

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            LAA+GAGAAT I TNPLWVVKTRLQTQ +R G VPYR  LSAL
Sbjct  120  LAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSAL  162



>gb|KHG03180.1| Mitochondrial substrate carrier family protein W [Gossypium arboreum]
Length=359

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+C+A AGA AG IAATFVCPLDVIKTR QVHGLP    T +R S+I+ SL+ I + E
Sbjct  18   RELICHACAGATAGAIAATFVCPLDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTE  77

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLC-SDDERHELSIganmlaaagagaat  570
            GL+G+YRGLSPT++ALLPNWAVYFT+YEQLK  L   D+   +L+IG NM+AAAGAGAAT
Sbjct  78   GLKGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLTPHDNNSAQLTIGENMVAAAGAGAAT  137

Query  571  tiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             I TNPLWVVKTRLQTQGMR G VPY G LSAL
Sbjct  138  AITTNPLWVVKTRLQTQGMRTGVVPYTGVLSAL  170


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  143  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  198

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++KS++          L+     +A++ +    +I T P  V+++RLQ QG  R
Sbjct  199  QFPAYEKIKSYMAKKGNTTVDRLTPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  258

Query  631  AGFVPYRGTLSAL  669
               V Y G +  +
Sbjct  259  HTEVQYAGVVDCI  271


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  +  +T ++ + +V  + ++F++EG+ G YRG +  +L   P+  +
Sbjct  243  PHEVIRSRLQEQGQAR--HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVI  300

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  301  TFTSYEMIHRFL  312



>ref|XP_006344160.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Solanum tuberosum]
Length=363

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +G++C AGAGA+AG IAATF+CPLDVIKTR QVHGLP++  +  +GS+IV SL+ I +
Sbjct  9    SVRGIICEAGAGASAGAIAATFMCPLDVIKTRLQVHGLPQVSQSGRQGSVIVTSLQNILR  68

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagaga  564
             EG RG+YRGLSPT+ ALLPNWAVYFT+Y  LK  L S  D   EL+IGANMLAAAGAGA
Sbjct  69   TEGFRGLYRGLSPTLTALLPNWAVYFTVYRHLKDSLHSHVDSSGELTIGANMLAAAGAGA  128

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT+I TNPLWVVKTRLQTQGMR G VPY+G +SAL
Sbjct  129  ATSITTNPLWVVKTRLQTQGMREGVVPYKGIMSAL  163


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 75/130 (58%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G  I+ +L +I   EG+RG+Y GL P+ LA + + A+
Sbjct  136  PLWVVKTRLQTQGM-REGVVPYKG--IMSALIRITHEEGIRGLYSGLLPS-LAGISHVAI  191

Query  460  YFTIYEQLKSFLCSDDERH--ELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L     +H  EL+ G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  192  QFPAYEKLKSYLAKRANKHTNELNPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQVR  251

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  252  NSEKAYNGVV  261



>ref|XP_008792834.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Phoenix dactylifera]
 ref|XP_008778231.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Phoenix dactylifera]
Length=311

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 131/164 (80%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M  ++ G P+   LL NA AGA+AG IAATFVCPLDVIKTRFQVHGLPK+  +  R S+I
Sbjct  1    MPGESDGRPATWDLLFNAFAGASAGAIAATFVCPLDVIKTRFQVHGLPKMPPSAQR-SVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIgan  537
            + SLEQI + EG++G+YRGLSPT+ ALLPNWAVYFT+Y QLK  L S +D  ++LSI AN
Sbjct  60   ISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYFTVYNQLKGLLHSHEDGNNQLSIRAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAAT +ATNPLWVVKTRLQTQGMR G VPYR  LSA 
Sbjct  120  IIAASGAGAATAVATNPLWVVKTRLQTQGMRPGVVPYRNMLSAF  163



>ref|XP_004516758.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Cicer arietinum]
Length=363

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            +GL+ NAGAGAAAG IAATFVCPLDVIKTR QVHGLP +     +GS+IV SL+ I + E
Sbjct  15   RGLISNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPPVQ----KGSVIVTSLQNIVRTE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RGMYRGLSPT+LALLPNWAVYFT YEQLK  L S D  HEL+   N++AAAGAGAAT+
Sbjct  71   GFRGMYRGLSPTILALLPNWAVYFTCYEQLKGLLRSHDGCHELTTIGNIIAAAGAGAATS  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  L+AL
Sbjct  131  ISTNPLWVVKTRLQTQGMRPDVVPYKSVLAAL  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (55%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EGLRG+Y G+ P+ LA + + A
Sbjct  135  PLWVVKTRLQTQGMRPDV----VPYKSVLAALTRITHEEGLRGLYSGIVPS-LAGVSHVA  189

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-  627
            + F  YE++K ++   D     +LS G   +A++ +    ++ T P  V+++RLQ QG  
Sbjct  190  IQFPAYEKIKLYMAKKDNTTVDKLSPGNVAIASSISKVTASVMTYPHEVIRSRLQEQGQA  249

Query  628  RAGFVPYRGTL  660
            +   V Y G +
Sbjct  250  KNSGVQYAGVI  260


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N+ ++ + ++   +++FQ+EG+ G YRG +  +L   P+  +
Sbjct  235  PHEVIRSRLQEQGQAK--NSGVQYAGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVI  292

Query  460  YFTIYEQLKSFLCSD  504
             FT YE +  FL  +
Sbjct  293  TFTSYEMIHRFLMRN  307



>ref|XP_004147114.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 ref|XP_004167306.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 gb|KGN51541.1| hypothetical protein Csa_5G576830 [Cucumis sativus]
Length=371

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 131/165 (79%), Gaps = 6/165 (4%)
 Frame = +1

Query  184  MTADAHGPS--PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            M+  A G S   + L+CNAGAGAAAG IAATFVCPLDVIKTR QVHGLP  G +   GS+
Sbjct  1    MSGGAGGTSRSTRDLICNAGAGAAAGSIAATFVCPLDVIKTRLQVHGLPS-GQSG--GSI  57

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIga  534
            I+ SL+ I + EG RGMYRGLSPT++ALLPNWAVYFT+YE LK  L SD D+ H+LS GA
Sbjct  58   IITSLQSIMRSEGFRGMYRGLSPTIVALLPNWAVYFTVYEHLKGLLHSDGDDGHQLSFGA  117

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NMLAAAGAGA+T IATNPLWVVKTRLQTQGMR G VPY G +SA 
Sbjct  118  NMLAAAGAGASTAIATNPLWVVKTRLQTQGMRPGVVPYTGMVSAF  162


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 73/133 (55%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  +V +  +I + EG+RG+Y G+ P+++  + + A+
Sbjct  135  PLWVVKTRLQTQGM-RPGVVPYTG--MVSAFTRIVREEGIRGLYSGIIPSLVG-ISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE+LKS++   +     +LS G   +A++ +    ++ T P  VV++RLQ QG   
Sbjct  191  QFPAYERLKSYIAKRENTTVDKLSPGHLAIASSLSKVTASVMTYPHEVVRSRLQEQGQAR  250

Query  634  GFVP-YRGTLSAL  669
               P Y G +  +
Sbjct  251  NIAPQYSGVMDCI  263



>ref|XP_007044248.1| NAD+ transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY00080.1| NAD+ transporter 2 isoform 1 [Theobroma cacao]
Length=365

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F+CPLDVIKTR QVHGLP+   +  RGS+I+ SL+ I + +GL+G+YRGLSPT+LALLPN
Sbjct  37   FMCPLDVIKTRLQVHGLPEASQSGARGSVIITSLQHIIKNDGLKGLYRGLSPTILALLPN  96

Query  451  WAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            WAVYFT+YEQLK  L S +D   +L+IGANM+AAAGAGAAT I TNPLWVVKTRLQTQGM
Sbjct  97   WAVYFTLYEQLKGLLTSHEDNGGQLTIGANMVAAAGAGAATAITTNPLWVVKTRLQTQGM  156

Query  628  RAGFVPYRGTLSAL  669
            R G VPY G LSAL
Sbjct  157  RTGVVPYTGVLSAL  170


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 73/133 (55%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  143  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  198

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE++KS++   +      LS     +A++ +    +I T P  V+++RLQ QG +R
Sbjct  199  QFPAYEKIKSYMAKKENTTVDHLSPADVAIASSISKVLASIMTYPHEVIRSRLQEQGQVR  258

Query  631  AGFVPYRGTLSAL  669
               V Y G +  +
Sbjct  259  NSEVHYAGVVDCI  271


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  ++ N+ +  + +V  + ++FQ+EGL G YRG +  +L   P+  +
Sbjct  243  PHEVIRSRLQEQG--QVRNSEVHYAGVVDCIRKVFQKEGLPGFYRGCATNLLRTTPSAVI  300

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  301  TFTSYEMIHRFL  312



>ref|XP_010644204.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Vitis vinifera]
 emb|CBI26982.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QVHGLP++ ++ +RGS+I+ SLE I + EGL+GMYRGLSPT+LALLP
Sbjct  32   TFVCPLDVIKTRLQVHGLPEVRHSGVRGSVIITSLENIIRTEGLKGMYRGLSPTILALLP  91

Query  448  NWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            NWAVYFT+Y++LK  L S  D   +L+IGAN++AA+GAGAAT I TNPLWVVKTRLQTQ 
Sbjct  92   NWAVYFTVYQKLKDVLHSHVDSSSQLTIGANVIAASGAGAATAITTNPLWVVKTRLQTQT  151

Query  625  MRAGFVPYRGTLSAL  669
            MR   VPY+G  SAL
Sbjct  152  MRPNVVPYKGIFSAL  166


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 73/133 (55%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q   + +      +G  I  +L++I Q EG+RG+Y GL P+ LA + + A+
Sbjct  139  PLWVVKTRLQTQTM-RPNVVPYKG--IFSALKRIAQEEGIRGLYSGLLPS-LAGITHVAI  194

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YEQ+KS+L    D    EL  G   +A++ +    ++ T P  V+++RLQ QG +R
Sbjct  195  QFPAYEQMKSYLAKMGDTTVDELGPGNFAIASSFSKVLASVMTYPHEVIRSRLQEQGQVR  254

Query  631  AGFVPYRGTLSAL  669
                 Y G +  +
Sbjct  255  NSEKHYSGVIDCI  267



>ref|XP_007044249.1| NAD+ transporter 2 isoform 2, partial [Theobroma cacao]
 gb|EOY00081.1| NAD+ transporter 2 isoform 2, partial [Theobroma cacao]
Length=352

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +  +C+ GAGA AG IAATF+CPLDVIKTR QVHGLP+   +  RGS+I+ SL+ I +
Sbjct  16   SIREFICHGGAGATAGAIAATFMCPLDVIKTRLQVHGLPEASQSGARGSVIITSLQHIIK  75

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagaga  564
             +GL+G+YRGLSPT+LALLPNWAVYFT+YEQLK  L S +D   +L+IGANM+AAAGAGA
Sbjct  76   NDGLKGLYRGLSPTILALLPNWAVYFTLYEQLKGLLTSHEDNGGQLTIGANMVAAAGAGA  135

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT I TNPLWVVKTRLQTQGMR G VPY G LSAL
Sbjct  136  ATAITTNPLWVVKTRLQTQGMRTGVVPYTGVLSAL  170


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  143  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  198

Query  460  YFTIYEQLKSFLCSDDE  510
             F  YE++KS++   + 
Sbjct  199  QFPAYEKIKSYMAKKEN  215



>ref|XP_004238908.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Solanum lycopersicum]
Length=365

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +G++C  GAGA+AG IAATF+CPLDVIKTR QVHGLP++  +  +GS+IV SL+ I +
Sbjct  11   SVRGIICEVGAGASAGAIAATFMCPLDVIKTRLQVHGLPQVSQSARQGSVIVTSLQNILR  70

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagaga  564
             EG RG+YRGLSPT+ ALLPNWAVYFT+YE LK  L S  D   +L+IGANMLAAAGAGA
Sbjct  71   TEGFRGLYRGLSPTLTALLPNWAVYFTVYEHLKDSLHSHVDSSGQLTIGANMLAAAGAGA  130

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT+I TNPLWVVKTRL TQGMR G VPY+G LSAL
Sbjct  131  ATSITTNPLWVVKTRLMTQGMREGVVPYKGILSAL  165


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR    G+ + G    +G  I+ +L +I   EG+RG+Y GL P+ LA + + A+
Sbjct  138  PLWVVKTRLMTQGM-REGVVPYKG--ILSALIRITHEEGIRGLYSGLLPS-LAGISHVAI  193

Query  460  YFTIYEQLKSFLCSDDERH--ELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L     +H  EL+ G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  194  QFPAYEKLKSYLAKRANKHTNELNSGEVAIASSMAKILASVMTYPHEVVRSKLQEQGQVR  253

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  254  NSEKAYNGVV  263



>gb|KCW86128.1| hypothetical protein EUGRSUZ_B02821, partial [Eucalyptus grandis]
Length=281

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 5/159 (3%)
 Frame = +1

Query  196  AHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE  375
            AHG S + +LC+A AGAAAG IAATFVCPLDVIKTR QVHG+P    +  +GS+I+ SL 
Sbjct  52   AHGSSTRDILCHAAAGAAAGAIAATFVCPLDVIKTRLQVHGVP----SGHKGSIIITSLR  107

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaa  552
             I ++EG++G+YRGLSPT+LALLPNWAVYFT+YE+LK  + S DD  +++S GANMLAA 
Sbjct  108  NIVRQEGVKGLYRGLSPTILALLPNWAVYFTVYERLKGLVHSHDDNGNQVSTGANMLAAV  167

Query  553  gagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAGAAT+I TNPLWVVKTRLQTQGMR   VPY G  SAL
Sbjct  168  GAGAATSITTNPLWVVKTRLQTQGMRPDVVPYAGVPSAL  206



>ref|XP_011022458.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=369

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +1

Query  196  AHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE  375
            +H  SP+ L+C+AGAGA+AG IAATF+CPLDVIKTR QVHGLP   N+   G +I+ SL+
Sbjct  8    SHKRSPRELVCHAGAGASAGAIAATFMCPLDVIKTRLQVHGLPP--NSVQGGGVIISSLQ  65

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaag  555
             I + EG RG+YRGLSPT++ALLPNWAVYFT+YEQLK  L   D   +LSI ANM+AAAG
Sbjct  66   HIVKTEGFRGLYRGLSPTIMALLPNWAVYFTVYEQLKGILSDVDGDRQLSISANMVAAAG  125

Query  556  agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAAT   TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  126  AGAATATVTNPLWVVKTRLQTQGMRPDLVPYKNVLSAL  163


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P L    +    ++ +L +I Q EG+RG+Y G+ P+ LA + + A
Sbjct  136  PLWVVKTRLQTQGMRPDL----VPYKNVLSALRRITQEEGMRGLYSGVLPS-LAGISHVA  190

Query  457  VYFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-M  627
            + F  YE++K ++    +     LS     +A++ A    ++ T P  VV++RLQ QG +
Sbjct  191  IQFPAYEKIKFYMAKRGNTTVDNLSHADVAIASSVAKILASVLTYPHEVVRSRLQEQGCL  250

Query  628  RAGFVPYRGTLSAL  669
            R   V Y G +  +
Sbjct  251  RNSEVRYAGVVDCI  264



>ref|XP_010046517.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Eucalyptus grandis]
Length=326

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 5/159 (3%)
 Frame = +1

Query  196  AHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE  375
            AHG S + +LC+A AGAAAG IAATFVCPLDVIKTR QVHG+P    +  +GS+I+ SL 
Sbjct  8    AHGSSTRDILCHAAAGAAAGAIAATFVCPLDVIKTRLQVHGVP----SGHKGSIIITSLR  63

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaa  552
             I ++EG++G+YRGLSPT+LALLPNWAVYFT+YE+LK  + S DD  +++S GANMLAA 
Sbjct  64   NIVRQEGVKGLYRGLSPTILALLPNWAVYFTVYERLKGLVHSHDDNGNQVSTGANMLAAV  123

Query  553  gagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAGAAT+I TNPLWVVKTRLQTQGMR   VPY G  SAL
Sbjct  124  GAGAATSITTNPLWVVKTRLQTQGMRPDVVPYAGVPSAL  162



>gb|KDP29452.1| hypothetical protein JCGZ_18373 [Jatropha curcas]
Length=370

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  193  DAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL  372
             +H  +P+ L+C+AGAGAAAG IAATFVCPLDVIKTR QVHGLP   N+   GS+I+ SL
Sbjct  7    SSHNRTPRELICHAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPVTPNSGRAGSVIITSL  66

Query  373  EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaa  549
            + I + EG +G+YRGLSPT++ALLPNWAVYFT YE LK  L S  D  +EL+IG NM+AA
Sbjct  67   QNIIRTEGFKGLYRGLSPTIIALLPNWAVYFTTYELLKGLLLSHGDANNELTIGTNMVAA  126

Query  550  agagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAGAAT I TNPLWVVKTRLQTQGMR G VPY+  +S L
Sbjct  127  AGAGAATAITTNPLWVVKTRLQTQGMRPGVVPYKSIISGL  166


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  + GN+ +R S +V  ++++FQ+EG  G YRG +  +L   P+  +
Sbjct  239  PHEVVRSRLQEQG--QAGNSEVRYSGLVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAII  296

Query  460  YFTIYEQLKSFL  495
             FT YE ++ FL
Sbjct  297  TFTSYETMRRFL  308


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +   I+  L +I   EG+RG+Y G+ P+ LA + + A+
Sbjct  139  PLWVVKTRLQTQGM-RPGVVPYKS--IISGLRRIVHEEGIRGLYSGILPS-LAGISHVAI  194

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F +YE++KS++   +      LS G   +A++ A    ++ T P  VV++RLQ QG
Sbjct  195  QFPVYEKIKSYVAEKNNTTVDNLSPGDVAIASSTAKVVASVLTYPHEVVRSRLQEQG  251



>ref|XP_002311469.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE88836.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=369

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = +1

Query  196  AHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE  375
            +H  SP+ L+C+AGAGA+AG IAATF+CPLDVIKTR QVHGLP   N+   GS+I+ SL+
Sbjct  8    SHKRSPRELVCHAGAGASAGAIAATFMCPLDVIKTRLQVHGLPP--NSVQGGSIIISSLQ  65

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaag  555
             I + EG +G+YRGLSPT++ALLPNWAVYFT+YEQLK  L   D   +LS+ ANM+AAAG
Sbjct  66   HIVKTEGFKGLYRGLSPTIMALLPNWAVYFTVYEQLKGILSDVDGDGQLSVSANMVAAAG  125

Query  556  agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAAT   TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  126  AGAATATVTNPLWVVKTRLQTQGMRPDLVPYKNVLSAL  163


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P L    +    ++ +L +I Q EG+RG+Y G+ P+ LA + + A
Sbjct  136  PLWVVKTRLQTQGMRPDL----VPYKNVLSALRRITQEEGIRGLYSGVLPS-LAGISHVA  190

Query  457  VYFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-M  627
            + F  YE++K ++    +     LS G   +A++ A    ++ T P  VV++RLQ QG +
Sbjct  191  IQFPAYEKIKFYMAKRGNTTVDNLSHGDVAIASSVAKILASVLTYPHEVVRSRLQEQGRL  250

Query  628  RAGFVPYRGTLSAL  669
            R   V Y G +  +
Sbjct  251  RNSEVHYAGVVDCI  264



>ref|XP_007153374.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
 gb|ESW25368.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
Length=355

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+CNA AGA+AG IAATFVCPLDVIKTR QVHGLP       +G++IV SL+ I ++E
Sbjct  15   RALMCNAAAGASAGAIAATFVCPLDVIKTRLQVHGLPH----GQKGNVIVTSLQNIVKKE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RGMYRGLSPT+LALLPNWAVYFT YEQ+K  L S D   EL+   NM+AAA AGAAT 
Sbjct  71   GFRGMYRGLSPTILALLPNWAVYFTSYEQVKGLLRSHDGCQELTTIENMIAAASAGAATA  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  131  ISTNPLWVVKTRLQTQGMRTDVVPYKSVLSAL  162


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 73/130 (56%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+       +    ++ +L +I + EG+RG+Y G+ P+ LA + + A+
Sbjct  135  PLWVVKTRLQTQGMR---TDVVPYKSVLSALTRITREEGIRGLYSGIIPS-LAGISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++KS++   D     +LS G+  +A++ +    ++ T P  V+++RLQ QG  +
Sbjct  191  QFPAYEKMKSYMAEKDNTTVDKLSPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQAK  250

Query  631  AGFVPYRGTL  660
               + Y G +
Sbjct  251  NNVIRYAGVI  260


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N  IR + ++    ++F++EG+ G YRG +  +L   P+  +
Sbjct  235  PHEVIRSRLQEQGQAK--NNVIRYAGVIDCTRKVFEKEGIPGFYRGCATNLLRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE ++ FL
Sbjct  293  TFTSYEMIRRFL  304



>ref|XP_010922189.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=311

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M+ ++HG P+ + L+ NA AGA+AG IAATFVCPLDVIKTRFQVHGLP++  +  R S+I
Sbjct  1    MSRESHGRPAARDLIFNAAAGASAGAIAATFVCPLDVIKTRFQVHGLPEMPPSAQR-SVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIgan  537
            + SLEQI + EG++G+YRGLSPT+ ALLP WAVYFT+Y QLK  L S  D  ++LSIGAN
Sbjct  60   ISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHVDGNNQLSIGAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +LAA+GAGAAT I TNPLWVVKTRLQTQ +R G VPYR  LSAL
Sbjct  120  ILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSAL  163



>ref|XP_011007410.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=368

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = +1

Query  199  HGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            H  SP+ L C+AGAGA+AGVI+ATF+CPLDVIKTR QVH LP   N+   GS+I+ SL+ 
Sbjct  9    HKRSPRELACHAGAGASAGVISATFMCPLDVIKTRLQVHALPP--NSGQGGSIIISSLQH  66

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaaga  558
            I + EG +G+YRGLSPT++ALLPNWAV FT+YEQLK  L + D   +LS+GANM+AAAG+
Sbjct  67   IVKTEGFKGLYRGLSPTIMALLPNWAVCFTVYEQLKGILSNGDGDSQLSVGANMVAAAGS  126

Query  559  gaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAAT+I TNPLWVVKTRLQTQGMR G VPY+  LSAL
Sbjct  127  GAATSIVTNPLWVVKTRLQTQGMRPGVVPYKSVLSAL  163


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  +L N+    + +V  ++++FQ+EG RG YRG +  ++   P+  +
Sbjct  236  PHEVVRSRLQEQG--QLRNSEAHYAGVVDCIKKVFQKEGFRGFYRGCATNLMRTTPSAVI  293

Query  460  YFTIYEQLKSFL  495
             FT YE +  F 
Sbjct  294  TFTSYEMIHKFF  305



>ref|XP_004299043.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=368

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            + + + C+A AGA+AG +AA FVCPLDVIKTR QVHG+P    T  RGS+IV SL+ I +
Sbjct  13   AARDIFCHAVAGASAGSMAAAFVCPLDVIKTRLQVHGMP----TGQRGSIIVTSLQNILK  68

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
             EG+RGMYRGLSPT+LALLPNWAVYFT+YEQLK  L S ++  E SIG NM+AAAGAGAA
Sbjct  69   TEGIRGMYRGLSPTILALLPNWAVYFTVYEQLKGLLQSHEDGSERSIGENMIAAAGAGAA  128

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T I+TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  129  TAISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  162


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 15/137 (11%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR----EGLRGMYRGLSPTVLALLP  447
            PL V+KTR Q  G+         G +   S+   F R    EGLRG+Y G+ P+ LA + 
Sbjct  135  PLWVVKTRLQTQGMRP-------GVIPYKSMRSAFTRIATEEGLRGLYSGIIPS-LAGIS  186

Query  448  NWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + A+ F  YE++KS +  +D     +L  G   +A++ +    ++ T P  V+++RLQ Q
Sbjct  187  HVAIQFPAYEKIKSIMAKEDSTTVDKLKPGRVAVASSISKILASVITYPHEVIRSRLQEQ  246

Query  622  GMRAGFVP-YRGTLSAL  669
            G      P Y G +  +
Sbjct  247  GQARHIQPKYAGVIDCI  263



>gb|KHN47916.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=336

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+CNA AGA+AG IAATFVCPLDVIKTR QVHGLP       +GS+I+ SL+ I + E
Sbjct  15   RALICNAAAGASAGAIAATFVCPLDVIKTRLQVHGLPH----GQKGSVIITSLQNIVRNE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RGMYRGLSPT++ALLPNWAVYFT YEQLK  L S D   EL+   N++AAAGAGAAT 
Sbjct  71   GFRGMYRGLSPTIVALLPNWAVYFTSYEQLKGLLRSRDGCDELTTIGNIIAAAGAGAATA  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  131  ISTNPLWVVKTRLQTQGMRPDVVPYKSVLSAL  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EG+RG+Y G+ P+ LA + + A
Sbjct  135  PLWVVKTRLQTQGMRPDV----VPYKSVLSALTRITHEEGIRGLYSGIVPS-LAGVSHVA  189

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            + F  YE++KS++   D     +L+ G+  +A++ +    ++ T P  V+++RLQ QG  
Sbjct  190  IQFPAYEKIKSYMAEKDNTTVDKLTPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQA  249

Query  631  AGF-VPYRGTL  660
                V Y G +
Sbjct  250  KNIGVQYTGVI  260


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N  ++ + ++   +++FQ+EG+ G YRG +  +L   P+  +
Sbjct  235  PHEVIRSRLQEQGQAK--NIGVQYTGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  293  TFTSYEMIHRFL  304



>ref|XP_006587243.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Glycine max]
Length=365

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+CNA AGA+AG IAATFVCPLDVIKTR QVHGLP       +GS+I+ SL+ I + E
Sbjct  15   RALICNAAAGASAGAIAATFVCPLDVIKTRLQVHGLPH----GQKGSVIITSLQNIVRNE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RGMYRGLSPT++ALLPNWAVYFT YEQLK  L S D   EL+   N++AAAGAGAAT 
Sbjct  71   GFRGMYRGLSPTIVALLPNWAVYFTSYEQLKGLLRSRDGCDELTTIGNIIAAAGAGAATA  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  131  ISTNPLWVVKTRLQTQGMRPDVVPYKSVLSAL  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EG+RG+Y G+ P+ LA + + A
Sbjct  135  PLWVVKTRLQTQGMRPDV----VPYKSVLSALTRITHEEGIRGLYSGIVPS-LAGVSHVA  189

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            + F  YE++KS++   D     +L+ G+  +A++ +    ++ T P  V+++RLQ QG  
Sbjct  190  IQFPAYEKIKSYMAEKDNTTVDKLTPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQA  249

Query  631  AGF-VPYRGTL  660
                V Y G +
Sbjct  250  KNIGVQYTGVI  260


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N  ++ + ++   +++FQ+EG+ G YRG +  +L   P+  +
Sbjct  235  PHEVIRSRLQEQGQAK--NIGVQYTGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  293  TFTSYEMIHRFL  304



>ref|XP_008467192.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Cucumis melo]
Length=371

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  184  MTADAHGPS--PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL  357
            M+  A G S   + L+CNAGAGAAAG IAATFVCPLDVIKTR QVHGLP   +    GS+
Sbjct  1    MSGGAGGTSRSTRDLICNAGAGAAAGSIAATFVCPLDVIKTRLQVHGLP---SGQRGGSI  57

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIga  534
            IV SL+ I + EG RG+YRGLSPT++ALLPNWAVYFT+YE LK  L SD D  H+LS GA
Sbjct  58   IVTSLQGIMRSEGFRGLYRGLSPTIVALLPNWAVYFTVYEHLKGLLHSDGDVGHQLSFGA  117

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGA+T IATNPLWVVKTRLQTQGMR G VPY G +SA 
Sbjct  118  NMVAAAGAGASTAIATNPLWVVKTRLQTQGMRPGVVPYTGMVSAF  162


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  +V +  +I   EG RG+Y G+ P+++  + + A+
Sbjct  135  PLWVVKTRLQTQGM-RPGVVPYTG--MVSAFTRIVHEEGFRGLYSGIIPSLVG-ISHVAI  190

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE+LKS++   D     +LS G   +A++ +    ++ T P  VV++RLQ QG   
Sbjct  191  QFPAYERLKSYIAKRDNTTVDKLSPGHLAIASSLSKVTASVMTYPHEVVRSRLQEQGQAR  250

Query  634  GFVP-YRGTLSAL  669
               P Y G +  +
Sbjct  251  NIAPQYSGVMDCI  263



>ref|XP_010681639.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=354

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = +1

Query  211  PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR  390
            PK   C+A AGA+AG IAATFVCPLDVIKTR QVHGLP + +T+ +GS+I+ SL+ I ++
Sbjct  15   PKNFFCDAAAGASAGAIAATFVCPLDVIKTRLQVHGLP-VTSTSTKGSIIITSLQDIVKK  73

Query  391  EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHE-LSIganmlaaagagaa  567
            EG RG+YRGLSPT+LALLP WAVYF +YE LK  L  DD   E L+I  NM+AA GAGAA
Sbjct  74   EGFRGLYRGLSPTILALLPTWAVYFPVYEHLKGLLQKDDHGTEQLTIVKNMIAAGGAGAA  133

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T +ATNPLWVVKTRLQTQGMR   +PY+  LSAL
Sbjct  134  TAVATNPLWVVKTRLQTQGMRTDVIPYKSILSAL  167


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 83/162 (51%), Gaps = 7/162 (4%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            +  D HG     ++ N  A   AG   A    PL V+KTR Q  G+       I    I+
Sbjct  108  LQKDDHGTEQLTIVKNMIAAGGAGAATAVATNPLWVVKTRLQTQGM---RTDVIPYKSIL  164

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDER--HELSIgan  537
             +L +I + EG+ G+Y GL P+ LA + + A+ F  YE++K +L   +     ELS G+ 
Sbjct  165  SALRRITREEGIPGLYSGLLPS-LAGISHVAIQFPAYERIKLYLAKTENTTVDELSAGSV  223

Query  538  mlaaagagaattiatNPLWVVKTRLQTQG-MRAGFVPYRGTL  660
             +A++ +    +I T P  V+++RLQ QG +R   V Y G +
Sbjct  224  AIASSLSKIVASIMTYPHEVIRSRLQEQGQVRNREVHYSGVV  265


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  ++ N  +  S +V  + ++FQ EGL G YRG +  ++  +PN  +
Sbjct  240  PHEVIRSRLQEQG--QVRNREVHYSGVVDCVRKVFQAEGLAGFYRGCATNLMRTVPNSVI  297

Query  460  YFTIYEQLKSFL  495
             FT YE +   L
Sbjct  298  TFTSYEMILRLL  309



>ref|XP_009407378.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=309

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M   +   + + +LC+A AGA+AG IAATFVCPLDVIKTR QVHGLP++  ++ R  +IV
Sbjct  1    MAGRSDSKTAREILCDALAGASAGAIAATFVCPLDVIKTRLQVHGLPEMSPSSSRRCIIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganml  543
             SL+QI + EG+ G+YRGL+PTV ALLPNWAVYFT+Y QLKS L   D+ +EL  GANML
Sbjct  61   SSLKQILRNEGISGLYRGLTPTVTALLPNWAVYFTVYNQLKSLL-HVDKSNELPFGANML  119

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAAT I TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  120  AASGAGAATAITTNPLWVVKTRLQTQGMRPEVVPYKSMLSAL  161


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P++    +    ++ +L +I   EG RG+Y GL P+ LA + + A
Sbjct  134  PLWVVKTRLQTQGMRPEV----VPYKSMLSALRRIALEEGRRGLYSGLLPS-LAGVSHVA  188

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            + F  YEQ+KS+L   D     +L+ G    A++ +    +  T P  V++ RLQ QG
Sbjct  189  IQFPAYEQIKSYLARRDNTTVDKLNPGNVATASSLSKIIASTLTYPHEVIRARLQEQG  246



>ref|XP_008243273.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Prunus mume]
Length=369

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 128/164 (78%), Gaps = 7/164 (4%)
 Frame = +1

Query  181  AMTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            A ++D H  + +  +C+AGAGAAAG +AATFVCPLDVIKTR QVHG+P       RGS+I
Sbjct  6    AQSSDRH--TVRDGICHAGAGAAAGAMAATFVCPLDVIKTRLQVHGMPP----GQRGSII  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIgan  537
            + SL+ I + EGL+GMYRGLSPT+LALLPNWAVYFT+YEQLK  L S  D   EL+IGAN
Sbjct  60   ITSLQNILKTEGLKGMYRGLSPTILALLPNWAVYFTVYEQLKGLLQSHVDGSSELTIGAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            M+AAAGAGAAT I TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  120  MIAAAGAGAATAITTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  163



>ref|XP_008797620.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=311

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 128/164 (78%), Gaps = 3/164 (2%)
 Frame = +1

Query  184  MTADAHG-PSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            M+ ++HG  S + L+ NA AGA+AG IAATFVCPLDVIKTRFQVHGLPK+     R S+I
Sbjct  1    MSRESHGRSSTRDLIFNAVAGASAGAIAATFVCPLDVIKTRFQVHGLPKM-PPPARRSVI  59

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIgan  537
            + SLE + + EG++G+YRGLSPT+ ALLP WAVYFT+Y+QLK  L S  D  +  SIGAN
Sbjct  60   ISSLEHVIKNEGVKGLYRGLSPTITALLPTWAVYFTVYDQLKGLLQSHVDGNNHFSIGAN  119

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ++AA+GAGAAT+I TNPLWVVKTRLQTQ MR G VPYR  LSA 
Sbjct  120  IIAASGAGAATSIVTNPLWVVKTRLQTQAMRPGVVPYRSLLSAF  163



>ref|XP_009600753.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=366

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M   A+  S + ++C+AGAGA+AG IAATF+CPLDVIKTR QVHGLP++  +  +GS+IV
Sbjct  1    MATAANHRSVRDIICDAGAGASAGAIAATFMCPLDVIKTRLQVHGLPQISQSGRQGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERH---ELSIga  534
             SL+ I + EG +G+YRGLSPT+ ALLPNWAVYFT+Y  LK  L S D      +L+IGA
Sbjct  61   TSLQNIIRTEGFKGLYRGLSPTLAALLPNWAVYFTVYGHLKDSLHSHDAVDSCGQLTIGA  120

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGAAT I TNPLWVVKTRLQTQG+R G VPY+G LSAL
Sbjct  121  NMIAAAGAGAATAITTNPLWVVKTRLQTQGIREGVVPYKGILSAL  165


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 76/130 (58%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G  I+ +L +I   EG+RG Y GL P+ LA + + A+
Sbjct  138  PLWVVKTRLQTQGI-REGVVPYKG--ILSALIRIAHEEGIRGWYSGLLPS-LAGISHVAI  193

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L   ++ + +ELS G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  194  QFPAYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQIR  253

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  254  NSEKAYNGVV  263



>ref|XP_009600754.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=364

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M   A+  S + ++C+AGAGA+AG IAATF+CPLDVIKTR QVHGLP++  +  +GS+IV
Sbjct  1    MATAANHRSVRDIICDAGAGASAGAIAATFMCPLDVIKTRLQVHGLPQISQSGRQGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganm  540
             SL+ I + EG +G+YRGLSPT+ ALLPNWAVYFT+Y  LK  L S  D   +L+IGANM
Sbjct  61   TSLQNIIRTEGFKGLYRGLSPTLAALLPNWAVYFTVYGHLKDSLHSHVDSCGQLTIGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AAAGAGAAT I TNPLWVVKTRLQTQG+R G VPY+G LSAL
Sbjct  121  IAAAGAGAATAITTNPLWVVKTRLQTQGIREGVVPYKGILSAL  163


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 76/130 (58%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G  I+ +L +I   EG+RG Y GL P+ LA + + A+
Sbjct  136  PLWVVKTRLQTQGI-REGVVPYKG--ILSALIRIAHEEGIRGWYSGLLPS-LAGISHVAI  191

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L   ++ + +ELS G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  192  QFPAYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQIR  251

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  252  NSEKAYNGVV  261



>ref|XP_003614555.1| Mitochondrial substrate carrier family protein W [Medicago truncatula]
 gb|AES97513.1| substrate carrier family protein [Medicago truncatula]
Length=354

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            +GL+ NAGAGAAAG IAATFVCPLDVIKTR QVHGLP +     +GS+IV SL+ I + E
Sbjct  15   RGLISNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPPVQ----KGSVIVTSLQNIVRTE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RG+YRGLSPT+LALLPNWAVYFT YEQ+K  L + +  +EL+   N++AAAGAGAAT 
Sbjct  71   GFRGLYRGLSPTILALLPNWAVYFTCYEQIKGLLRTHEGCNELTTIGNIIAAAGAGAATA  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  131  ISTNPLWVVKTRLQTQGMRPNVVPYKSVLSAL  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  ++ ++ + ++   +++FQ+EG+RG YRG +  +L   P+  +
Sbjct  235  PHEVIRSRLQEQGQAK-NSSGVQYAGVIDCTKKVFQKEGIRGFYRGCATNLLRTTPSAVI  293

Query  460  YFTIYEQLKSFLCSDDERHE  519
             FT YE +  FL     ++E
Sbjct  294  TFTSYEMIHRFLTRTIPQNE  313


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EGLRG+Y G+ P+ LA + + A
Sbjct  135  PLWVVKTRLQTQGMRPNV----VPYKSVLSALTRITHEEGLRGLYSGILPS-LAGVSHVA  189

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-  627
            + F  YE++K ++   D     +L+ G+  +A++ +    ++ T P  V+++RLQ QG  
Sbjct  190  IQFPAYEKIKLYMAKKDNTTVDKLNPGSVAIASSISKVTASVMTYPHEVIRSRLQEQGQA  249

Query  628  -RAGFVPYRGTL  660
              +  V Y G +
Sbjct  250  KNSSGVQYAGVI  261



>ref|XP_003553860.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Glycine max]
 gb|KHN07803.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=363

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + L+CNA +GAAAG IAATFV PLDVIKTR QVHGLP       +GS+I+ SL+ I + E
Sbjct  15   RALICNAASGAAAGAIAATFVSPLDVIKTRLQVHGLPH----GQKGSIIITSLQNIVRNE  70

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RGMYRGLSPT++ALLPNWAVYFT YEQLK  L S D  +EL+   +++AAAGAGAAT 
Sbjct  71   GFRGMYRGLSPTIVALLPNWAVYFTSYEQLKGLLRSRDGCNELTTIGSIIAAAGAGAATA  130

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I+TNPLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  131  ISTNPLWVVKTRLQTQGMRPDVVPYKSVLSAL  162


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EG+RG+Y G+ P+ LA + + A
Sbjct  135  PLWVVKTRLQTQGMRPDV----VPYKSVLSALTRITHEEGIRGLYSGIVPS-LAGVSHVA  189

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            + F  YE++KS++   D     +L+ G+  +A++ +    ++ T P  V+++RLQ QG  
Sbjct  190  IQFPAYEKIKSYIAEKDNTTVDKLTPGSVAVASSISKVFASVMTYPHEVIRSRLQEQGQA  249

Query  631  AGF-VPYRGTL  660
                V Y G +
Sbjct  250  KNIGVQYAGVI  260


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N  ++ + ++   +++FQ+EG+ G YRG +  +    P+  +
Sbjct  235  PHEVIRSRLQEQGQAK--NIGVQYAGVIDCTKKVFQKEGIPGFYRGCATNLFRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  293  TFTSYEMIHRFL  304



>emb|CDP00658.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + ++C+AGAGAAAG IAATFVCPLDVIKTR QV+GLP++  +  RGS+I+ SL+ I +
Sbjct  12   SYREIICDAGAGAAAGAIAATFVCPLDVIKTRLQVYGLPEMARSGHRGSVIITSLQNIVR  71

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagaga  564
             EG RG+YRGLSPT+ ALLPNWAVYF++Y  LKS L S  D   +L+I AN++AA+GAGA
Sbjct  72   NEGFRGLYRGLSPTLAALLPNWAVYFSVYGHLKSLLHSHVDSSGQLTIAANVIAASGAGA  131

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT +A NPLWVVKTRLQTQ MR G VPY G LSAL
Sbjct  132  ATAVAANPLWVVKTRLQTQRMRQGVVPYHGILSAL  166


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 72/130 (55%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q   + + G     G  I+ +L +I   EG+RG Y GL P+ LA + + A+
Sbjct  139  PLWVVKTRLQTQRM-RQGVVPYHG--ILSALRRIAHEEGIRGWYSGLLPS-LAGISHVAI  194

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE LK++L   + +  +EL  G   +A++ +    ++ T P  VV++RLQ QG +R
Sbjct  195  QFPAYEHLKAYLAKRNSKKINELRPGEVAIASSMSKVVASLMTYPHEVVRSRLQEQGRLR  254

Query  631  AGFVPYRGTL  660
               + Y G +
Sbjct  255  NPEIHYAGVI  264


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  +L N  I  + ++  +++IF REGL G YRG +  +L   P+  +
Sbjct  239  PHEVVRSRLQEQG--RLRNPEIHYAGVIDCIKKIFLREGLPGFYRGCATNLLRTTPSAVI  296

Query  460  YFTIYEQLKSFLCS  501
             FT YE +  FL S
Sbjct  297  TFTSYEMIHRFLQS  310



>gb|KDO76915.1| hypothetical protein CISIN_1g016968mg [Citrus sinensis]
Length=379

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TF+CPLDVIKTR QVHGLP+  ++  RGS+I+ SL+ I + EGL+G+YRGLSPT+LALLP
Sbjct  39   TFMCPLDVIKTRLQVHGLPEGTHSGRRGSIIIISLQNILKNEGLKGLYRGLSPTLLALLP  98

Query  448  NWAVYFTIYEQLKSFL-CSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            NWAVYF +YE+LK  L    D   +LS+G NM+AAAGAGAAT I TNPLWVVKTRLQTQG
Sbjct  99   NWAVYFAVYERLKGLLRTHGDGNSQLSVGKNMIAAAGAGAATAITTNPLWVVKTRLQTQG  158

Query  625  MRAGFVPYRGTLSAL  669
            MR+  VPY+  LSAL
Sbjct  159  MRSNVVPYKSILSAL  173


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+    +  +    I+ +L +I   EG+RG+Y G+ P+ LA + + A+
Sbjct  146  PLWVVKTRLQTQGMR---SNVVPYKSILSALRRISHEEGMRGLYSGILPS-LAGVSHVAI  201

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++K ++   D+    +L+ G+ M+A++ A    ++ T P  VV++RLQ QG  R
Sbjct  202  QFPAYERIKHYMAKKDDTDVDKLNPGSIMIASSIAKVLASVITYPHEVVRSRLQEQGQNR  261

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  262  KVDVQYAGVV  271



>ref|XP_006448416.1| hypothetical protein CICLE_v10015617mg [Citrus clementina]
 ref|XP_006468740.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Citrus sinensis]
 gb|ESR61656.1| hypothetical protein CICLE_v10015617mg [Citrus clementina]
Length=379

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TF+CPLDVIKTR QVHGLP+  ++  RGS+I+ SL+ I + EGL+G+YRGLSPT+LALLP
Sbjct  39   TFMCPLDVIKTRLQVHGLPEGTHSGRRGSIIIISLQNILKNEGLKGLYRGLSPTLLALLP  98

Query  448  NWAVYFTIYEQLKSFL-CSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            NWAVYF +YE+LK  L    D   +LS+G NM+AAAGAGAAT I TNPLWVVKTRLQTQG
Sbjct  99   NWAVYFAVYERLKGLLRTHGDGNSQLSVGKNMIAAAGAGAATAITTNPLWVVKTRLQTQG  158

Query  625  MRAGFVPYRGTLSAL  669
            MR+  VPY+  LSAL
Sbjct  159  MRSNVVPYKSILSAL  173


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+    +  +    I+ +L +I   EG+RG+Y G+ P+ LA + + A+
Sbjct  146  PLWVVKTRLQTQGMR---SNVVPYKSILSALRRISHEEGMRGLYSGILPS-LAGVSHVAI  201

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++K ++   D+    +L+ G+ M+A++ A    ++ T P  VV++RLQ QG  R
Sbjct  202  QFPAYERIKHYMAKKDDTDVDKLNPGSVMIASSIAKVLASVMTYPHEVVRSRLQEQGQNR  261

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  262  KVDVQYAGVV  271



>ref|XP_008367006.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Malus domestica]
Length=374

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + ++C+AGAGA+AG +AATFVCPLDVIKTR QVHG+P    +  RGS+IV SL++I +
Sbjct  12   SIRDVICHAGAGASAGAMAATFVCPLDVIKTRLQVHGMP----SGQRGSIIVTSLQKILK  67

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagaga  564
             EG++GMYRGLSPT+LALLPNWAVYFT+YEQLK  L S      EL+IG NM+AAAGAGA
Sbjct  68   TEGVKGMYRGLSPTILALLPNWAVYFTVYEQLKGLLHSHVHGSGELTIGENMIAAAGAGA  127

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT I+TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  128  ATAISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  162


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  +   T   G  ++  ++++FQ+EGLRG Y G +  ++   P+  +
Sbjct  235  PHEVVRSRLQEQGQARHIGTQYAG--VIDCIKKVFQKEGLRGFYNGCATNLIRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  293  TFTSYEMIDRFL  304



>ref|XP_007223316.1| hypothetical protein PRUPE_ppa007312mg [Prunus persica]
 gb|EMJ24515.1| hypothetical protein PRUPE_ppa007312mg [Prunus persica]
Length=373

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +1

Query  181  AMTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS-L  357
            A ++D H  + +  +C+AGAGAAAG +AATFVCPLDVIKTR QVHG+P  G   +RG+ +
Sbjct  6    AQSSDRH--TVRDGICHAGAGAAAGAMAATFVCPLDVIKTRLQVHGMPP-GQRVVRGNGI  62

Query  358  IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIga  534
            I+ SL+ I + EGL+GMYRGLSPT+LALLPNWAVYFT+YEQLK  L S  D   EL+IGA
Sbjct  63   IITSLQNILKTEGLKGMYRGLSPTILALLPNWAVYFTVYEQLKGLLQSHVDGSSELTIGA  122

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGAAT I TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  123  NMIAAAGAGAATAITTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  167


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 15/134 (11%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR----EGLRGMYRGLSPTVLALLP  447
            PL V+KTR Q  G+         G +   S+   F R    EG+RG+Y G+ P+ LA + 
Sbjct  140  PLWVVKTRLQTQGMRP-------GVIPYKSMRSAFTRIATEEGMRGLYSGILPS-LAGIS  191

Query  448  NWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + A+ F  YE++KSF+   D     +L+ G   +A++ +    ++ T P  VV++RLQ Q
Sbjct  192  HVAIQFPAYEKIKSFMAKRDNTTVDKLNPGNVAIASSISKVIASVITYPHEVVRSRLQEQ  251

Query  622  GMRAGFVP-YRGTL  660
            G      P Y G +
Sbjct  252  GQARHIEPQYAGVI  265



>ref|XP_009767034.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=366

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M   A+  S + ++C+AGAGA+AG IAATF+CPLDVIKTR  +HGLP++  +  +GS+IV
Sbjct  1    MATAANHRSVRDIICDAGAGASAGAIAATFMCPLDVIKTRLIIHGLPQMSQSGRQGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERH---ELSIga  534
             SL+ I + EG RG+YRGLSPT+ ALLPNWAVYFT+Y  LK  L S D      +L+IGA
Sbjct  61   TSLQNILRTEGFRGLYRGLSPTLAALLPNWAVYFTVYGHLKDSLHSHDAVDSCGQLTIGA  120

Query  535  nmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NM+AAAGAGAAT I TNPLWVVKTRLQTQG+R G VPY+G LSAL
Sbjct  121  NMIAAAGAGAATAITTNPLWVVKTRLQTQGIREGVVPYKGILSAL  165


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 75/130 (58%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G  I+ +L +I   EG+RG Y GL P+ LA + +  +
Sbjct  138  PLWVVKTRLQTQGI-REGVVPYKG--ILSALIRIAHEEGIRGWYSGLLPS-LAGISHVTI  193

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L   ++ + +ELS G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  194  QFPAYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQVR  253

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  254  NSEKAYNGVV  263



>gb|KCW86299.1| hypothetical protein EUGRSUZ_B02991, partial [Eucalyptus grandis]
Length=337

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + +LC+A AGAAAG +AATFVCPLDVIKTR QVHG+P    +  +GS+I+ SL  I +
Sbjct  1    STRDILCHAAAGAAAGAVAATFVCPLDVIKTRLQVHGVP----SGHKGSIIITSLRNIVR  56

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagaga  564
            +EG++G+YRGLSPT+LALLPNWAVYFT+YE+LK  + S DD  +++S GANMLAA GAGA
Sbjct  57   QEGVKGLYRGLSPTILALLPNWAVYFTVYERLKGLVHSHDDNGNQVSTGANMLAAVGAGA  116

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT+I TNPLWVVKTRLQTQGMR   VPY G  SAL
Sbjct  117  ATSITTNPLWVVKTRLQTQGMRPDVVPYAGVPSAL  151


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 7/85 (8%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G        +R   +V  + ++F++EG+ G YRG +  ++  +P+  +
Sbjct  224  PHEVVRSRLQEQG----HGAKVRYVGVVDCVRKVFRKEGIPGFYRGCATNLIRTIPSAVI  279

Query  460  YFTIYEQLKSFLCS---DDERHELS  525
             FT YE +  FL      DERH  S
Sbjct  280  TFTSYEMIHRFLAQVLLPDERHSQS  304



>ref|XP_009767035.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=364

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M   A+  S + ++C+AGAGA+AG IAATF+CPLDVIKTR  +HGLP++  +  +GS+IV
Sbjct  1    MATAANHRSVRDIICDAGAGASAGAIAATFMCPLDVIKTRLIIHGLPQMSQSGRQGSVIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganm  540
             SL+ I + EG RG+YRGLSPT+ ALLPNWAVYFT+Y  LK  L S  D   +L+IGANM
Sbjct  61   TSLQNILRTEGFRGLYRGLSPTLAALLPNWAVYFTVYGHLKDSLHSHVDSCGQLTIGANM  120

Query  541  laaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +AAAGAGAAT I TNPLWVVKTRLQTQG+R G VPY+G LSAL
Sbjct  121  IAAAGAGAATAITTNPLWVVKTRLQTQGIREGVVPYKGILSAL  163


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 75/130 (58%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    +G  I+ +L +I   EG+RG Y GL P+ LA + +  +
Sbjct  136  PLWVVKTRLQTQGI-REGVVPYKG--ILSALIRIAHEEGIRGWYSGLLPS-LAGISHVTI  191

Query  460  YFTIYEQLKSFLC--SDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE+LKS+L   ++ + +ELS G   +A++ A    ++ T P  VV+++LQ QG +R
Sbjct  192  QFPAYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQVR  251

Query  631  AGFVPYRGTL  660
                 Y G +
Sbjct  252  NSEKAYNGVV  261



>ref|XP_009356235.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=374

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + ++C+AGAGA+AG +AATFVCPLDVIKTR QVHG+P    +  RGS+IV SL++I +
Sbjct  12   SIRDVICHAGAGASAGAMAATFVCPLDVIKTRLQVHGMP----SGQRGSIIVTSLQKILK  67

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagaga  564
             EG++GMYRGLSPT+LALLPNWAVYFT+YEQLK  L S      EL+IG NM+AAAGAGA
Sbjct  68   TEGVKGMYRGLSPTILALLPNWAVYFTVYEQLKGRLHSHVHGSGELTIGENMIAAAGAGA  127

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT I+TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  128  ATAISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  162


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G  +   T   G  ++  ++++FQ+EGLRG Y G +  ++   P+  +
Sbjct  235  PHEVVRSRLQEQGQARHIGTQYAG--VIDCIKKVFQKEGLRGFYNGCATNLIRTTPSAVI  292

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  293  TFTSYEMIDRFL  304



>ref|XP_009357098.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=368

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + ++C+AGAGA+AG IAATFVCPLDVIKTR QVHG+P    +  RGS+IV SL++I + E
Sbjct  14   RDVICHAGAGASAGAIAATFVCPLDVIKTRLQVHGMP----SGQRGSIIVTSLQKIVKTE  69

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagagaat  570
            G++GMYRGLSPT+LALLPNWAVYFT+YEQLK  L +      EL+IG NM+AAAGAGAAT
Sbjct  70   GVKGMYRGLSPTILALLPNWAVYFTVYEQLKGLLHTHVHGSGELTIGENMIAAAGAGAAT  129

Query  571  tiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             I+TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  130  AISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  162


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (50%), Gaps = 15/137 (11%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR----EGLRGMYRGLSPTVLALLP  447
            PL V+KTR Q  G+         G +   S+   F R    EGLRG+Y G+ P+ LA + 
Sbjct  135  PLWVVKTRLQTQGMRP-------GVIPYKSMRSAFSRIATEEGLRGLYSGILPS-LAGIS  186

Query  448  NWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + A+ F  YE++KSF+   D+    +L       A++ +    ++ T P  VV++RLQ Q
Sbjct  187  HVAIQFPAYEKIKSFMAKRDDTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQ  246

Query  622  GMRAGFVP-YRGTLSAL  669
            G      P Y G +  +
Sbjct  247  GQARHIEPQYAGVIDCM  263



>emb|CAN73681.1| hypothetical protein VITISV_008039 [Vitis vinifera]
Length=99

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +1

Query  184  MTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV  363
            M A++H PSP+GLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLP+LGN NI+GSLIV
Sbjct  1    MPAESHAPSPRGLLCNAGAGAAAGVIAATFVCPLDVIKTRFQVHGLPQLGNGNIKGSLIV  60

Query  364  GSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            GSLEQIFQ+EGLRGMYRGLSPTVLALLPNWA
Sbjct  61   GSLEQIFQKEGLRGMYRGLSPTVLALLPNWA  91



>ref|XP_008339642.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Malus domestica]
Length=368

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            + ++C+AGAGA+AG IAATFVCPLDVIKTR QVHG+P    +  RGS+IV SL++I + E
Sbjct  14   RDVICHAGAGASAGAIAATFVCPLDVIKTRLQVHGMP----SGQRGSIIVTSLQKILKTE  69

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDER-HELSIganmlaaagagaat  570
            G++GMYRGLSPT+LALLPNWAVYFT+YEQLK  L +      EL+IG NM+AAAGAGAAT
Sbjct  70   GVKGMYRGLSPTILALLPNWAVYFTVYEQLKGLLHTHVHGIGELTIGENMIAAAGAGAAT  129

Query  571  tiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
             I+TNPLWVVKTRLQTQGMR G +PY+   SA 
Sbjct  130  AISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAF  162


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (49%), Gaps = 15/137 (11%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR----EGLRGMYRGLSPTVLALLP  447
            PL V+KTR Q  G+         G +   S+   F R    EGLRG+Y G+ P+ LA + 
Sbjct  135  PLWVVKTRLQTQGMRP-------GVIPYKSMRSAFSRIATEEGLRGLYSGILPS-LAGIS  186

Query  448  NWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + A+ F  YE++KSF+   D     +L       A++ +    ++ T P  VV++RLQ Q
Sbjct  187  HVAIQFPAYEKIKSFMAKRDNTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQ  246

Query  622  GMRAGFVP-YRGTLSAL  669
            G      P Y G +  +
Sbjct  247  GQARHIEPQYAGVIDCM  263



>ref|XP_009105386.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Brassica rapa]
Length=313

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 6/154 (4%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +  +CNAGAGAAAG IAATFVCPLDVIKTR QVHGLP+      RGS+I+ SL  I +
Sbjct  14   SIRDTICNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPE----TRRGSVIITSLGNILK  69

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            +EG+RGMYRGLSPT++ LLPNWAVYF++Y +LK  L S D +  LSIGANM+AA GAGA+
Sbjct  70   KEGVRGMYRGLSPTIIVLLPNWAVYFSVYGKLKDLLQSSDGK--LSIGANMVAAGGAGAS  127

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T+IATNPLWVVKTRL TQGMR   +PY+  LSA 
Sbjct  128  TSIATNPLWVVKTRLMTQGMRPDVIPYKSMLSAF  161



>ref|XP_010046584.1| PREDICTED: uncharacterized protein LOC104435557 [Eucalyptus grandis]
Length=1027

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +1

Query  175  DLAMTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGS  354
            +L  +  AHG S + +LC+A AGAAAG +AATFVCPLDVIKTR QVHG+P    +  +GS
Sbjct  680  ELDASHAAHGSSTRDILCHAAAGAAAGAVAATFVCPLDVIKTRLQVHGVP----SGHKGS  735

Query  355  LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIg  531
            +I+ SL  I ++EG++G+YRGLSPT+LALLPNWAVYFT+YE+LK  + S DD  +++S G
Sbjct  736  IIITSLRNIVRQEGVKGLYRGLSPTILALLPNWAVYFTVYERLKGLVHSHDDNGNQVSTG  795

Query  532  anmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ANMLAA GAGAAT+I TNPLWVVKTRLQTQGMR   VPY G  SAL
Sbjct  796  ANMLAAVGAGAATSITTNPLWVVKTRLQTQGMRPDVVPYAGVPSAL  841


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 7/85 (8%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V+++R Q  G        +R   +V  + ++F++EG+ G YRG +  ++  +P+  +
Sbjct  914  PHEVVRSRLQEQG----HGAKVRYVGVVDCVRKVFRKEGIPGFYRGCATNLIRTIPSAVI  969

Query  460  YFTIYEQLKSFLCS---DDERHELS  525
             FT YE +  FL      DERH  S
Sbjct  970  TFTSYEMIHRFLAQVLLPDERHSQS  994



>emb|CDY38578.1| BnaC06g30010D [Brassica napus]
Length=334

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QVHGLP+      RGS+I+ SL  I ++EG+RGMYRGLSPT++ALLP
Sbjct  55   TFVCPLDVIKTRLQVHGLPE----TRRGSVIITSLGNILKKEGIRGMYRGLSPTIIALLP  110

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIGANM+AAAGAGA+T+IATNPLWVVKTRL TQGM
Sbjct  111  NWAVYFSVYGKLKDLLQSSDGK--LSIGANMVAAAGAGASTSIATNPLWVVKTRLMTQGM  168

Query  628  RAGFVPYRGTLSAL  669
            R   VPY+  LSA 
Sbjct  169  RPDVVPYKSMLSAF  182



>gb|EYU40785.1| hypothetical protein MIMGU_mgv1a008842mg [Erythranthe guttata]
Length=360

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = +1

Query  181  AMTADAHGPSPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            A  A     SPK +  +  AGAAAG IAATFVCPLDVIKTR QV GLP++  +  RGS+I
Sbjct  3    AAAASGDHRSPKDIFYDTSAGAAAGAIAATFVCPLDVIKTRLQVRGLPEMQPSGRRGSVI  62

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIgan  537
            + SL+ I + EG++G+YRGL+PT+ ALLPNWAVYFT+Y  LK  L S +  + +LSI +N
Sbjct  63   LVSLQSIVRNEGVKGLYRGLTPTLTALLPNWAVYFTVYGHLKEVLHSYEGSKDQLSISSN  122

Query  538  mlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            M+AAAGAGAAT IATNPLWVVKTRLQTQGMR   VPY+   SAL
Sbjct  123  MIAAAGAGAATAIATNPLWVVKTRLQTQGMRQDVVPYKNIFSAL  166


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  ++ N  ++ + +V  ++++F++EG+ G YRG +  +L   P+  +
Sbjct  239  PHEVIRSRLQEQG--QVRNCELQYAGVVDCVKKVFRKEGIPGFYRGCATNLLRTTPSAVI  296

Query  460  YFTIYEQLKSFL---CSDDERH  516
             FT YE ++ FL    S++++H
Sbjct  297  TFTSYEMIRRFLLRVSSEEKKH  318



>ref|XP_009109874.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Brassica rapa]
 emb|CDY36114.1| BnaA08g19340D [Brassica napus]
Length=360

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I + EG RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D    LS+GANM+AAAGAGA+T+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKEVLQSSD--GTLSVGANMVAAAGAGASTSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R G VPY+  +SA 
Sbjct  151  RPGVVPYKSVMSAF  164



>emb|CDY24409.1| BnaCnng04760D [Brassica napus]
Length=360

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I + EG RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D    LS+GANM+AAAGAGA+T+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSD--GTLSVGANMVAAAGAGASTSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R G VPY+  +SA 
Sbjct  151  RPGVVPYKSVMSAF  164



>ref|XP_006415866.1| hypothetical protein EUTSA_v10007992mg [Eutrema salsugineum]
 gb|ESQ34219.1| hypothetical protein EUTSA_v10007992mg [Eutrema salsugineum]
Length=365

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I + EG RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPETPTSGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIGANM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGANMVAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R   +PY+  +SA 
Sbjct  151  RPDVIPYKSVMSAF  164



>ref|XP_011076390.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Sesamum indicum]
Length=367

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTRFQVHGLP++  +   GS+I+ SL+ I + EGL+G+YRGL+PT+ ALLP
Sbjct  29   TFVCPLDVIKTRFQVHGLPEMHPSGRGGSVILVSLQNIVRNEGLKGLYRGLTPTLAALLP  88

Query  448  NWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            NWAVYFT+Y  LK  L S +  + +L+I +NM+AAAGAGAAT +ATNPLWVVKTRLQTQG
Sbjct  89   NWAVYFTVYGHLKEILHSYEGGKGQLTIASNMIAAAGAGAATAVATNPLWVVKTRLQTQG  148

Query  625  MRAGFVPYRGTLSAL  669
            MR   VPY+   SAL
Sbjct  149  MRQDVVPYKNIFSAL  163



>emb|CDX84985.1| BnaC05g20700D [Brassica napus]
Length=376

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + + CNA AGA AG IAATFVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I +
Sbjct  28   SIREVACNAAAGATAGAIAATFVCPLDVIKTRLQVVGLPEAPVSGKRGSVIITSLQDIVK  87

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            ++GLRGMYRGLSPT++ALLPNWAVYF++Y +LK  L S D +  LS+GANM+AAAGAGAA
Sbjct  88   KDGLRGMYRGLSPTIIALLPNWAVYFSVYGKLKDVLQSSDGK--LSVGANMVAAAGAGAA  145

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T+IATNPLWVVKTRL TQG+R   VPY+  +SA 
Sbjct  146  TSIATNPLWVVKTRLMTQGIRTDVVPYKSIMSAF  179



>ref|NP_564233.1| NAD+ transporter 2 [Arabidopsis thaliana]
 sp|Q8RWA5.1|NDT2_ARATH RecName: Full=Nicotinamide adenine dinucleotide transporter 2, 
mitochondrial; Short=AtNDT2; AltName: Full=NAD(+) transporter 
2 [Arabidopsis thaliana]
 gb|AAM13231.1| unknown protein [Arabidopsis thaliana]
 gb|AAP42759.1| At1g25380 [Arabidopsis thaliana]
 emb|CAR70089.1| mitochondrial nicotinamide adenine dinucleotide transporter 2 
[Arabidopsis thaliana]
 gb|AEE30615.1| NAD+ transporter 2 [Arabidopsis thaliana]
Length=363

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R G VPY+  +SA 
Sbjct  151  RPGVVPYKSVMSAF  164



>emb|CAN76447.1| hypothetical protein VITISV_010118 [Vitis vinifera]
Length=410

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 112/162 (69%), Gaps = 28/162 (17%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRG---------------------------SLIVG  366
            TFVCPLDVIKTR QVHGLP++ ++ +RG                           S+I+ 
Sbjct  32   TFVCPLDVIKTRLQVHGLPEVRHSGVRGKLYLYKFGIGLLTKYMNFMPMNVEELGSVIIT  91

Query  367  SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganml  543
            SLE I + EGL+GMYRGLSPT+LALLPNWAVYFT+Y++LK  L S  D   +L+IGAN++
Sbjct  92   SLENIIRTEGLKGMYRGLSPTILALLPNWAVYFTVYQKLKDVLHSHVDSSSQLTIGANVI  151

Query  544  aaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AA+GAGAAT I TNPLWVVKTRLQTQ MR   VPY+G  SAL
Sbjct  152  AASGAGAATAITTNPLWVVKTRLQTQTMRPNVVPYKGIFSAL  193



>gb|KFK41256.1| hypothetical protein AALP_AA2G105900 [Arabis alpina]
Length=306

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 119/154 (77%), Gaps = 2/154 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +  +CNAGAGAAAG I+ATFVCPLDVIKTR QV GLP+   +  +GS+I+ SL  I +
Sbjct  7    SIRDTICNAGAGAAAGAISATFVCPLDVIKTRLQVLGLPQTPTSGHKGSVIITSLGNIVK  66

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
             EG RGMYRGLSPT++ALLPNWAVYF++Y +LK  L S+D    LSIGANM+AAAGAG +
Sbjct  67   NEGFRGMYRGLSPTIIALLPNWAVYFSVYGKLKDLLQSND--GNLSIGANMVAAAGAGTS  124

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T IATNPLWVVKTRL  QGMR   VPY+  LSA 
Sbjct  125  TAIATNPLWVVKTRLIMQGMRPDVVPYKSLLSAF  158



>ref|XP_001772029.1| predicted protein [Physcomitrella patens]
 gb|EDQ63110.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 8/141 (6%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDV+KTR QV+  P +    ++G LI+GSL  IF+ EG+RG+YRGLSPT++ALLP
Sbjct  24   TFVCPLDVVKTRLQVYR-PTVSEVGLKGGLIIGSLSTIFREEGVRGLYRGLSPTMVALLP  82

Query  448  NWAVYFTIYEQLKSFLCSDDER-------HELSIganmlaaagagaattiatNPLWVVKT  606
            NWAVYFT YEQLK  L S+          H+++  A++ AAAGAG AT + TNPLWVVKT
Sbjct  83   NWAVYFTTYEQLKRILQSEAHHNLAHTSDHKMTPAAHVAAAAGAGTATILVTNPLWVVKT  142

Query  607  RLQTQGMRAGFVPYRGTLSAL  669
            RLQTQ +R   VPY+GT SAL
Sbjct  143  RLQTQRLRTDIVPYKGTFSAL  163


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 66/133 (50%), Gaps = 13/133 (10%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNI---RGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            PL V+KTR Q   L     T+I   +G+    +L +I   EG RG+Y G+ P  LA + +
Sbjct  136  PLWVVKTRLQTQRL----RTDIVPYKGTF--SALNRILAEEGFRGLYSGIVP-ALAGISH  188

Query  451  WAVYFTIYEQLKSFLCSDD--ERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F +YE LK +    D      LS     +A++ +    +  T P  VV++RLQ QG
Sbjct  189  VAIQFPVYEYLKEYFAQKDGTTVEALSTRNVAIASSLSKVTASTLTYPHEVVRSRLQEQG  248

Query  625  MRAG-FVPYRGTL  660
               G  + Y G +
Sbjct  249  YSKGVHIRYTGVV  261



>ref|XP_009115307.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Brassica rapa]
 emb|CDY42111.1| BnaA09g28490D [Brassica napus]
Length=361

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S + + CNA AGA AG IAATFVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I +
Sbjct  13   SIREVACNAAAGATAGAIAATFVCPLDVIKTRLQVVGLPEAPASGKRGSVIITSLQGIVK  72

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            ++G RGMYRGLSPT++ALLPNWAVYF++Y +LK  L S D +  LS+GANM+AAAGAGAA
Sbjct  73   KDGFRGMYRGLSPTIIALLPNWAVYFSVYGKLKDVLQSSDGK--LSVGANMVAAAGAGAA  130

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T+IATNPLWVVKTRL TQG+R   VPY+  +SA 
Sbjct  131  TSIATNPLWVVKTRLMTQGIRTDVVPYKSIISAF  164



>ref|XP_010532254.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=363

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +1

Query  214  KGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE  393
            +G++CNAGAGAAAG IAATFVCPLDVIKTR QV GLP+      RG +IV SL+ I + E
Sbjct  15   RGVICNAGAGAAAGAIAATFVCPLDVIKTRLQVLGLPET-PAGQRGGVIVTSLQSIIKNE  73

Query  394  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaatt  573
            G RG+YRGLSPT++ALLPNWAVYFT+Y +LK  L S D +  LS+GANM+AAAGAGA+T 
Sbjct  74   GFRGLYRGLSPTIIALLPNWAVYFTVYGKLKDLLQSSDGK--LSVGANMIAAAGAGASTA  131

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            IATNP WVVKTRL TQGMR   VPY+  LSA 
Sbjct  132  IATNPFWVVKTRLMTQGMRPDVVPYKSILSAF  163



>ref|XP_010499117.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Camelina sativa]
Length=363

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG+RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIVKNEGIRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R   VPY+  +SA 
Sbjct  151  RPDVVPYKSVMSAF  164



>gb|KFK44519.1| hypothetical protein AALP_AA1G267200 [Arabis alpina]
Length=366

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            FVCPLDVIKTR QV GLP+   +  RGS+I+ SL+ I + EG RGMYRGLSPT++ALLPN
Sbjct  36   FVCPLDVIKTRLQVLGLPEAPASGQRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLPN  95

Query  451  WAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            WAVYF++Y +LK  L S D +  LSIGANM+AAAGAGAAT+IATNPLWVVKTRL TQG+R
Sbjct  96   WAVYFSVYGKLKEVLQSSDGK--LSIGANMVAAAGAGAATSIATNPLWVVKTRLMTQGIR  153

Query  631  AGFVPYRGTLSAL  669
               VPY+  +SA 
Sbjct  154  PDVVPYKSVMSAF  166



>ref|XP_010460390.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Camelina sativa]
Length=363

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG+RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKSIVKNEGIRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R   VPY+  +SA 
Sbjct  151  RPDVVPYKSVMSAF  164



>ref|XP_006304969.1| hypothetical protein CARUB_v10012042mg [Capsella rubella]
 gb|EOA37867.1| hypothetical protein CARUB_v10012042mg [Capsella rubella]
Length=363

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 107/134 (80%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG+RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIVKNEGIRGMYRGLSPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R   VPY+  +SA 
Sbjct  151  RPDVVPYKSVMSAF  164



>gb|ACN28655.1| unknown [Zea mays]
 gb|AFW77702.1| hypothetical protein ZEAMMB73_178914 [Zea mays]
Length=394

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIg  531
            S+I+GSL+QI Q+EG RGMYRGLSPT+LALLPNWAVYFT+YEQLKSFL S+D  H+LS+G
Sbjct  132  SVIIGSLQQIAQQEGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSFLSSNDGSHQLSLG  191

Query  532  anmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AN++AA+ AGAATTI TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  192  ANVVAASCAGAATTIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAAL  237


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+ + G    +G+L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  210  PLWVVKTRFQTQGI-RAGPIPYKGTL--AALRRIAHEEGIRGLYSGLVP-ALAGISHVAI  265

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ Q
Sbjct  266  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQ  321



>emb|CAI38581.1| mitochondrial carrier like protein [Arabidopsis thaliana]
Length=363

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG RGMYRGL PT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLLPTIIALLP  92

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NWAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+
Sbjct  93   NWAVYFSVYGKLKDVLQSSDGK--LSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGI  150

Query  628  RAGFVPYRGTLSAL  669
            R G VPY+  +SA 
Sbjct  151  RPGVVPYKSVMSAF  164



>emb|CDX96021.1| BnaA07g27100D [Brassica napus]
Length=312

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 7/154 (5%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +  +CNAGAGAAAG IAATFVCPLDVIKTR QVHGLP+      RGS+I+ SL  I +
Sbjct  14   SIRDTICNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPE----TRRGSVIITSLGNILK  69

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            +EG+RGMYRGLSPT++ALLPNWAVYF++Y +LK  L S D +  LSIGANM+AAAGAGA+
Sbjct  70   KEGVRGMYRGLSPTIIALLPNWAVYFSVYGKLKDLLQSSDGK--LSIGANMVAAAGAGAS  127

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T+IATNPLWVVKTRL  + MR   VPY+  LSA 
Sbjct  128  TSIATNPLWVVKTRLMAR-MRPDVVPYKSMLSAF  160



>ref|XP_010477935.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Camelina sativa]
Length=363

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            FVCPLDVIKTR QV GLP+      RG +I+ SL+ I + EG+RGMYRGLSPT++ALLPN
Sbjct  34   FVCPLDVIKTRLQVLGLPEAPAAGQRGGVIITSLKSIVKNEGIRGMYRGLSPTIIALLPN  93

Query  451  WAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            WAVYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNPLWVVKTRL TQG+R
Sbjct  94   WAVYFSVYGKLKDVLQSSDGK--LSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGIR  151

Query  631  AGFVPYRGTLSAL  669
               VPY+  +SA 
Sbjct  152  PDVVPYKSVMSAF  164



>ref|XP_010559229.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=356

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +1

Query  220  LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL  399
            ++CNAGAGAAAG IAATFVCPLDVIKTR QV GLP+   T  RG +I+ SL+ I + EG 
Sbjct  17   VICNAGAGAAAGAIAATFVCPLDVIKTRLQVLGLPET-PTGQRGGVIITSLQNIIRNEGF  75

Query  400  RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattia  579
            RG+YRGLSPT++ALLPNWAVYFT+Y +LK  L S D +  L +GANM+AAAGAGA+T IA
Sbjct  76   RGLYRGLSPTIIALLPNWAVYFTVYGKLKDLLQSSDGK--LGVGANMIAAAGAGASTAIA  133

Query  580  tNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            TNP WVVKTRL TQGMR   VPY+  LSA 
Sbjct  134  TNPFWVVKTRLMTQGMRPDVVPYKSVLSAF  163



>ref|XP_002893428.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69687.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=364

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            FVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I Q+EG RGMYRGLSPT++ALLPN
Sbjct  34   FVCPLDVIKTRLQVLGLPETPASGQRGGVIITSLKNIVQKEGYRGMYRGLSPTIIALLPN  93

Query  451  WAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQ-TQGM  627
            WAVYF++Y +LK  L S+D +  LSIG+N++AAAGAGAAT+IATNPLWVVKTRL  TQG+
Sbjct  94   WAVYFSVYGKLKDVLQSNDGK--LSIGSNVVAAAGAGAATSIATNPLWVVKTRLMVTQGI  151

Query  628  RAGFVPYRGTLSAL  669
            R   VPY+  +SA 
Sbjct  152  RPDVVPYKSVMSAF  165



>gb|KFK43463.1| hypothetical protein AALP_AA1G128600 [Arabis alpina]
Length=238

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLG-NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFVCPLDVIKTR QV GLP    +   +GS+I+ SL+ I + EG+ GMYRGLSPT++ALL
Sbjct  30   TFVCPLDVIKTRLQVIGLPLAPLSGRQKGSVIIRSLQDIVKNEGVVGMYRGLSPTIIALL  89

Query  445  PNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            PNWA+YF++YE+LK  L S+D +  LS+GAN++A+A AG +TTIATNPLWV++TRL TQG
Sbjct  90   PNWAIYFSVYEKLKDALKSNDGK--LSVGANIVASAIAGVSTTIATNPLWVIRTRLVTQG  147

Query  625  MRAGFVPYRGTLSAL  669
            MR   VPY   LSA 
Sbjct  148  MRTDVVPYTTVLSAF  162



>gb|EPS70095.1| hypothetical protein M569_04665, partial [Genlisea aurea]
Length=326

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIR-GSLIVGSLEQIF  384
            S + ++C+A AGAAAG IAATFV PLDVIKTR QVHGLP+  N + R G +IV S++ I 
Sbjct  9    SVREIICDASAGAAAGAIAATFVSPLDVIKTRLQVHGLPEGRNPSGRIGGVIVVSMKNII  68

Query  385  QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagaga  564
            Q EG +G+YRGL+PT+ ALLPNWAVYF +Y  LK  L S    ++LSIG NM+AAAGAGA
Sbjct  69   QNEGFKGLYRGLTPTLAALLPNWAVYFAVYGHLKEILHSYGSANQLSIGLNMIAAAGAGA  128

Query  565  attiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AT +ATNPLWVVKTRLQTQGMR   VPY    SAL
Sbjct  129  ATAVATNPLWVVKTRLQTQGMRQDVVPYSSICSAL  163


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 75/133 (56%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ +     +  S I  +L +I   EG+RG Y GL P+++  + + A+
Sbjct  136  PLWVVKTRLQTQGMRQ---DVVPYSSICSALRRIAHEEGIRGWYSGLLPSLVG-ISHVAI  191

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
             F  YE++K +L +  D+  ++LS     +A++ +    ++ T P  V+++RLQ QG +R
Sbjct  192  QFPTYERIKYYLATRKDNSSNKLSPAEIAVASSLSKIVASVMTYPHEVIRSRLQEQGQVR  251

Query  631  AGFVPYRGTLSAL  669
               V Y+G +  +
Sbjct  252  NSDVKYQGVVDCM  264


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  ++ N++++   +V  ++++F++EG+ G YRG +  +L   P+ A+
Sbjct  236  PHEVIRSRLQEQG--QVRNSDVKYQGVVDCMKKVFKKEGIPGFYRGCATNLLRTTPSAAI  293

Query  460  YFTIYEQLKSFL  495
             FT YE +  F 
Sbjct  294  TFTSYEMIHRFF  305



>gb|AFW77703.1| hypothetical protein ZEAMMB73_178914 [Zea mays]
Length=125

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 90/102 (88%), Gaps = 5/102 (5%)
 Frame = +1

Query  202  GPS-PKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ  378
            GP+  +GLLC+AGAGA+AGV+AATFVCPLDVIKTRFQVHG PKL      GS+I+GSL+Q
Sbjct  27   GPTTARGLLCHAGAGASAGVVAATFVCPLDVIKTRFQVHGWPKLAT----GSVIIGSLQQ  82

Query  379  IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD  504
            I Q+EG RGMYRGLSPT+LALLPNWAVYFT+YEQLKSFL S+
Sbjct  83   IAQQEGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSFLSSN  124



>ref|XP_002987576.1| hypothetical protein SELMODRAFT_46815, partial [Selaginella moellendorffii]
 gb|EFJ11412.1| hypothetical protein SELMODRAFT_46815, partial [Selaginella moellendorffii]
Length=275

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGS-LIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFVCPLDV+KTR QVH  P       +G  +IV SL  IFQ EG+ GMYRGLSPT+ ALL
Sbjct  6    TFVCPLDVVKTRLQVHKAPVPDQAVAKGGGVIVRSLAVIFQNEGVAGMYRGLSPTIFALL  65

Query  445  PNWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQT  618
            PNWAVYFT YEQ+K +L   D     +LS G +M+AA  AG+AT IATNPLWVVKTRLQT
Sbjct  66   PNWAVYFTAYEQMKGYLERRDGSPDKKLSPGEHMIAAVVAGSATNIATNPLWVVKTRLQT  125

Query  619  QGMRAGFVPYRGTLSAL  669
            Q +++G  PY GTLS+L
Sbjct  126  QQVKSGIAPYVGTLSSL  142



>ref|XP_002978962.1| hypothetical protein SELMODRAFT_109819, partial [Selaginella 
moellendorffii]
 ref|XP_002986475.1| hypothetical protein SELMODRAFT_124353, partial [Selaginella 
moellendorffii]
 gb|EFJ12332.1| hypothetical protein SELMODRAFT_124353, partial [Selaginella 
moellendorffii]
 gb|EFJ19919.1| hypothetical protein SELMODRAFT_109819, partial [Selaginella 
moellendorffii]
Length=312

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI-VGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFV PLDV+KTR Q+  +PK G   + G L+ V +L+ I ++EG+RG+Y+GL+PT+LALL
Sbjct  6    TFVAPLDVVKTRLQIQRIPKAGQLGVNGKLVYVFTLQSIVRQEGVRGLYQGLAPTILALL  65

Query  445  PNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            PNWAV+FT YEQ+K  L +   + +L++ +++LAA  AGAAT + TNPLWVVKTRLQTQ 
Sbjct  66   PNWAVFFTTYEQMKRLLQTRAGKQQLTMSSHLLAATVAGAATNLITNPLWVVKTRLQTQR  125

Query  625  MRAGFVPYRGTLSAL  669
            +R   VPY+ T SAL
Sbjct  126  LRPDLVPYKNTFSAL  140



>ref|XP_006645938.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Oryza brachyantha]
Length=316

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLR  402
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP  L +T   G +I+   + IF+ EGL 
Sbjct  19   CNAIAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHIFKNEGLP  78

Query  403  GMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaattia  579
            G+YRGLSPT++AL P WAV F++Y  LK  L S DD   ELS+ +N+LAA+ AG AT IA
Sbjct  79   GLYRGLSPTIVALFPTWAVTFSVYNHLKGLLHSQDDNAGELSVQSNILAASCAGIATAIA  138

Query  580  tNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            TNPLWVVKTRLQTQGMR G VPY    SAL
Sbjct  139  TNPLWVVKTRLQTQGMRPGVVPYASIWSAL  168


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +  + I  +L +I   EG+RG+Y GL P+ LA + + A
Sbjct  141  PLWVVKTRLQTQGMRPGV----VPYASIWSALRRITAEEGIRGLYSGLLPS-LAGVTHVA  195

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-  627
            +   +YE++K +    D     +LS G   + ++G+    +I T P  VV+++LQ QG  
Sbjct  196  IQLPVYEKVKLYFAKRDNTTVDKLSPGKLAICSSGSKVTASIITYPHEVVRSKLQEQGRG  255

Query  628  RAGFVPYRGTL  660
            R G V Y G L
Sbjct  256  RHGAVHYTGVL  266


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V++++ Q  G  + G  +  G  ++  ++Q++Q+EG+ G YRG +  +L   PN  +
Sbjct  241  PHEVVRSKLQEQGRGRHGAVHYTG--VLDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVI  298

Query  460  YFTIYEQLKSFL  495
             FT YE +  F+
Sbjct  299  TFTSYEMINRFM  310



>ref|XP_002992842.1| hypothetical protein SELMODRAFT_46825, partial [Selaginella moellendorffii]
 gb|EFJ06132.1| hypothetical protein SELMODRAFT_46825, partial [Selaginella moellendorffii]
Length=275

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGS-LIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFVCPLDV+KTR QVH  P       +G  +IV SL  IFQ EG+ GMYRGLSPT+ ALL
Sbjct  6    TFVCPLDVVKTRLQVHKAPVPDQAVAKGGGVIVRSLAVIFQNEGVAGMYRGLSPTIFALL  65

Query  445  PNWAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQT  618
            PNWAVYFT YEQ+K +L   D     +LS G +M+AA  AG+AT IATNPLWVVKTRLQT
Sbjct  66   PNWAVYFTAYEQMKGYLERRDGSPDKKLSPGEHMIAAVVAGSATNIATNPLWVVKTRLQT  125

Query  619  QGMRAGFVPYRGTLSAL  669
            Q +++G  PY GT S+L
Sbjct  126  QQVKSGIAPYAGTFSSL  142



>gb|KFK43464.1| hypothetical protein AALP_AA1G128600 [Arabis alpina]
Length=321

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLG-NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFVCPLDVIKTR QV GLP    +   +GS+I+ SL+ I + EG+ GMYRGLSPT++ALL
Sbjct  30   TFVCPLDVIKTRLQVIGLPLAPLSGRQKGSVIIRSLQDIVKNEGVVGMYRGLSPTIIALL  89

Query  445  PNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            PNWA+YF++YE+LK  L S+D +  LS+GAN++A+A AG +TTIATNPLWV++TRL TQG
Sbjct  90   PNWAIYFSVYEKLKDALKSNDGK--LSVGANIVASAIAGVSTTIATNPLWVIRTRLVTQG  147

Query  625  MRAGFVPYRGTLSAL  669
            MR   VPY   LSA 
Sbjct  148  MRTDVVPYTTVLSAF  162



>ref|XP_004968826.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Setaria italica]
Length=316

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIR--GSLIVGSLEQIFQREGL  399
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP   ++     G +I+   +QI + EGL
Sbjct  18   CNAVAGGSAGVISATVLCPLDVIKTRLQVYGLPSNFSSGAAPPGRVIISGFQQILKNEGL  77

Query  400  RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDD-ERHELSIganmlaaagagaatti  576
             G+YRGLSPT++AL P WAV F++Y  +K  L S+D    ELS+ AN+LAA+ AG AT  
Sbjct  78   PGLYRGLSPTIVALFPTWAVTFSVYNHVKGLLHSEDGNNSELSVQANVLAASCAGIATAT  137

Query  577  atNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            ATNPLWVVKTRLQTQGMR G VPY+  LSAL
Sbjct  138  ATNPLWVVKTRLQTQGMRPGVVPYQSILSAL  168



>gb|AFW81644.1| hypothetical protein ZEAMMB73_626020 [Zea mays]
Length=159

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaag  555
            +I QREG RGMYRGLSPTVLALLPNWAVYFT+YEQLKS L S+D  H+LS+GAN++AA+ 
Sbjct  21   EIAQREGFRGMYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASC  80

Query  556  agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAATT  TNPLWVVKTR QTQG+RAG +PY+GTL+AL
Sbjct  81   AGAATTTVTNPLWVVKTRFQTQGIRAGPMPYKGTLAAL  118



>gb|AAG28807.1|AC079374_10 unknown protein [Arabidopsis thaliana]
Length=376

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 15/147 (10%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I + EG RGMYRGLSPT++ALLP
Sbjct  33   TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP  92

Query  448  NWA-------------VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNP  588
            NWA             VYF++Y +LK  L S D +  LSIG+NM+AAAGAGAAT+IATNP
Sbjct  93   NWAVSTTVLYRALFLQVYFSVYGKLKDVLQSSDGK--LSIGSNMIAAAGAGAATSIATNP  150

Query  589  LWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            LWVVKTRL TQG+R G VPY+  +SA 
Sbjct  151  LWVVKTRLMTQGIRPGVVPYKSVMSAF  177



>emb|CDM83064.1| unnamed protein product [Triticum aestivum]
Length=319

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  223  LCNagagaaagviaaTFVCPLDVIKTRFQVHGLPK--LGNTNIRGSLIVGSLEQIFQREG  396
            +CNA AG +AG I+AT +CPLDV+KTR QV+GLP      T   G +I+  L+ I + EG
Sbjct  20   VCNAVAGGSAGAISATVLCPLDVLKTRLQVYGLPSNLSPGTAPPGRIILSGLQHILKTEG  79

Query  397  LRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSIganmlaaagagaatt  573
            L G+YRGLSPT++AL P WAV F++Y  ++  L S DD+  ELSI  N+LAA+ AG AT 
Sbjct  80   LPGLYRGLSPTIVALYPTWAVTFSVYNYVRGLLRSQDDKNGELSIQENILAASSAGIATA  139

Query  574  iatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            +ATNPLWVVKTRLQTQGMR G VPY   LSAL
Sbjct  140  VATNPLWVVKTRLQTQGMRPGVVPYTSILSAL  171



>ref|XP_002457880.1| hypothetical protein SORBIDRAFT_03g017840 [Sorghum bicolor]
 gb|EES03000.1| hypothetical protein SORBIDRAFT_03g017840 [Sorghum bicolor]
Length=312

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLR  402
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP         G +++   +QI + EGL 
Sbjct  18   CNAVAGGSAGVISATVLCPLDVIKTRLQVYGLPSNFSGAPPPGRVLISGFQQILKNEGLP  77

Query  403  GMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiat  582
            G+YRGLSPT++AL P WAV F++Y  +K  L S D   ELS+ AN+LAA+ AG AT  AT
Sbjct  78   GLYRGLSPTIVALFPTWAVTFSVYNHVKGVLHSKDG--ELSVQANVLAASCAGIATATAT  135

Query  583  NPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NPLWVVKTRLQTQGMR G VPY+  LSAL
Sbjct  136  NPLWVVKTRLQTQGMRPGVVPYQSILSAL  164



>ref|XP_010518452.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=261

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaag  555
            +IF++EG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS D   +LS+GAN+LAA+G
Sbjct  12   KIFKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSKDVDRKLSVGANVLAASG  71

Query  556  agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  72   AGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  109


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  82   PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  137

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  138  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  194



>ref|XP_001754740.1| predicted protein [Physcomitrella patens]
 gb|EDQ80194.1| predicted protein [Physcomitrella patens]
Length=334

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 18/149 (12%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDV+KTR QV+   ++G  NI G +++G L  IF++EG++G+Y G S T++ALL 
Sbjct  37   TFVCPLDVVKTRLQVN---RMGYENINGMMVLGHLGTIFKKEGVKGLYCGFSSTMVALLV  93

Query  448  NWAVYFTIYEQLKSFLCSDDERH---------------ELSIganmlaaagagaattiat  582
            NWAVYFT+YEQLK  L + + R                +LS+GANMLA+AGAGA T + T
Sbjct  94   NWAVYFTVYEQLKGMLQAREARKNGGVVGKGGAYAHPPKLSVGANMLASAGAGATTILVT  153

Query  583  NPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            NPLWVVKTR+QTQ +R   +PY+G  SAL
Sbjct  154  NPLWVVKTRIQTQSLRPDLIPYKGVASAL  182



>dbj|BAD73080.1| putative mitochondrial folate transporter [Oryza sativa Japonica 
Group]
 dbj|BAD73272.1| putative mitochondrial folate transporter [Oryza sativa Japonica 
Group]
Length=314

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 13/161 (8%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLR  402
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP  L +T   G +I+   + I + EGL 
Sbjct  19   CNAIAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGLP  78

Query  403  GMYRGLSPTVLALLPNWA-----------VYFTIYEQLKSFLCSD-DERHELSIganmla  546
            G+YRGLSPT++AL P WA           V F++Y  LK  L S  D   ELS+ AN+LA
Sbjct  79   GLYRGLSPTIVALFPTWAAKYCFMIDACLVTFSVYNHLKGLLHSQGDNTGELSVQANILA  138

Query  547  aagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            A+ AG AT +ATNPLWVVKTRLQTQGMR G VPY    SAL
Sbjct  139  ASCAGIATAVATNPLWVVKTRLQTQGMRTGVVPYTSIWSAL  179


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V++++ Q  G  + G  +  G  ++  ++Q++Q+EG+ G YRG +  +L   PN  +
Sbjct  239  PHEVVRSKLQEQGRARHGAVHYTG--VIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVI  296

Query  460  YFTIYEQLKSFL  495
             FT YE +   +
Sbjct  297  TFTSYEMINRLM  308



>gb|EEC70751.1| hypothetical protein OsI_02162 [Oryza sativa Indica Group]
 gb|EEE54681.1| hypothetical protein OsJ_01987 [Oryza sativa Japonica Group]
Length=327

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 13/161 (8%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLR  402
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP  L +T   G +I+   + I + EGL 
Sbjct  19   CNAIAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGLP  78

Query  403  GMYRGLSPTVLALLPNWA-----------VYFTIYEQLKSFLCSD-DERHELSIganmla  546
            G+YRGLSPT++AL P WA           V F++Y  LK  L S  D   ELS+ AN+LA
Sbjct  79   GLYRGLSPTIVALFPTWAAKYCFMIDACLVTFSVYNHLKGLLHSQGDNTGELSVQANILA  138

Query  547  aagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            A+ AG AT +ATNPLWVVKTRLQTQGMR G VPY    SAL
Sbjct  139  ASCAGIATAVATNPLWVVKTRLQTQGMRTGVVPYTSIWSAL  179


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 72/133 (54%), Gaps = 7/133 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+       +  + I  +L +I + EG+RG+Y GL P+ LA + + A+
Sbjct  152  PLWVVKTRLQTQGMR---TGVVPYTSIWSALRRIAEEEGIRGLYSGLLPS-LAGVTHVAI  207

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG-MR  630
               +YE +K +    D     +LS G   + ++G+  A +I T P  VV+++LQ QG  R
Sbjct  208  QLPVYENVKLYFAKRDNTTVDKLSPGKLAICSSGSKVAASIITYPHEVVRSKLQEQGRAR  267

Query  631  AGFVPYRGTLSAL  669
             G V Y G +  +
Sbjct  268  HGAVHYTGVIDCI  280


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +V++++ Q  G  + G  +  G  ++  ++Q++Q+EG+ G YRG +  +L   PN  +
Sbjct  252  PHEVVRSKLQEQGRARHGAVHYTG--VIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVI  309

Query  460  YFTIYEQLKSFL  495
             FT YE +   +
Sbjct  310  TFTSYEMINRLM  321



>ref|XP_010906995.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=283

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +1

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELS  525
            GS+I+ SLEQI + EG++G+YRGLSPT+ ALLPNWAVYFT+Y QLK  L S +D  ++LS
Sbjct  28   GSVIISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYFTVYNQLKGLLHSHEDGNNQLS  87

Query  526  IganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            I AN++AA+GAGAAT +ATNPLWVVKTRLQTQGMR G VPYR  LSA 
Sbjct  88   ISANIIAASGAGAATAVATNPLWVVKTRLQTQGMRPGVVPYRNMLSAF  135


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    R  L   +  +I   EG+RG+Y GL P+ LA + + A+
Sbjct  108  PLWVVKTRLQTQGM-RPGVVPYRNML--SAFRRIVHEEGVRGLYSGLLPS-LAGVSHVAI  163

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE++K +L   D     +LS G+  +A++ +    +  T P  VV++RLQ QG
Sbjct  164  QFPAYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQG  220


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G  +  +T  + + +V  ++++FQ+EGL G YRG    +L   P
Sbjct  204  TMTYPHEVVRSRLQEQGQAR--DTANQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTP  261

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE ++ FL
Sbjct  262  TAVITFTSYEMIQRFL  277



>gb|KJB48098.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=327

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-DDERHELSI  528
            S+I+ SL+ I + EGL+G+YRGLSPT++ALLPNWAVYFT+YEQLK  L S D+   +L+I
Sbjct  32   SVIITSLQHIIKTEGLKGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLASHDNNSAQLTI  91

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            G NM+AAAGAGAAT I TNPLWVVKTRLQTQGMR G VPY G LSAL
Sbjct  92   GENMVAAAGAGAATAIVTNPLWVVKTRLQTQGMRTGVVPYTGVLSAL  138


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G     G  ++ +L +I   EGLRG+Y G+ P+ LA + + A+
Sbjct  111  PLWVVKTRLQTQGM-RTGVVPYTG--VLSALRRIVHEEGLRGLYSGVLPS-LAGISHVAI  166

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++KS++          LS     +A++ +    +I T P  V+++RLQ QG  R
Sbjct  167  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  226

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  227  HTEVQYAGVV  236


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  +  +T ++ + +V  + ++F++EG+ G YRG +  +L   P+  +
Sbjct  211  PHEVIRSRLQEQGQAR--HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVI  268

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  269  TFTSYEMIHRFL  280



>gb|EMS54256.1| hypothetical protein TRIUR3_07374 [Triticum urartu]
Length=357

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 88/108 (81%), Gaps = 9/108 (8%)
 Frame = +1

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GS+I+GSLEQI +REG RG+YRGLSPT+LALLPNWAVYFT+YEQLKS L S         
Sbjct  100  GSVIIGSLEQIARREGFRGLYRGLSPTILALLPNWAVYFTVYEQLKSMLASSGAN-----  154

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAG-FVPYRGTLSAL  669
               ++AA+ AGAATTIATNPLWVVKTR QTQG+RAG  +PY+GT++AL
Sbjct  155  ---VMAASCAGAATTIATNPLWVVKTRFQTQGVRAGAMIPYKGTVAAL  199


 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 6/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+        +G+  V +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  171  PLWVVKTRFQTQGVRAGAMIPYKGT--VAALTRIAHEEGIRGLYSGLVPA-LAGITHVAI  227

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  228  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGAHS  287

Query  634  GFVPYRGTL  660
                YRG +
Sbjct  288  E-ARYRGVI  295



>gb|KEH24420.1| substrate carrier family protein [Medicago truncatula]
Length=241

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGL+PTVLALLPNWAVYFT+YEQLKS L SDDE H LS+G+NM+AAAGAGAATT+ TN
Sbjct  1    MYRGLAPTVLALLPNWAVYFTMYEQLKSLLHSDDESHHLSVGSNMVAAAGAGAATTLFTN  60

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGMR+G VPYR TLSAL
Sbjct  61   PLWVVKTRLQTQGMRSGVVPYRSTLSAL  88


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    R +L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  58   FTNPLWVVKTRLQTQGM-RSGVVPYRSTL--SALRRIASEEGIRGLYSGLVP-ALAGISH  113

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F +YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  114  VAIQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  173

Query  625  MRA  633
              +
Sbjct  174  HHS  176



>gb|KDO87106.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=241

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGLSPTVLALLPNWAVYFT+YEQLKSFLCS+D+ H LS+GAN++AAA AGAATTIATN
Sbjct  1    MYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVIAAAVAGAATTIATN  60

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGM+AG VPYR TLSAL
Sbjct  61   PLWVVKTRLQTQGMKAGVVPYRSTLSAL  88


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ K G    R +L   +L +I Q EG+RG+Y GL P  LA + + A+
Sbjct  61   PLWVVKTRLQTQGM-KAGVVPYRSTL--SALSRIAQEEGIRGLYSGLVP-ALAGISHVAI  116

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F  YE++K  L    +    +LS     +A++ +    +  T P  VV++RLQ QG  +
Sbjct  117  QFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  176


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +V+++R Q  G     ++  R S +V  ++++FQ+EGL G YRG +  +L   P
Sbjct  157  TLTYPHEVVRSRLQEQG----HHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTP  212

Query  448  NWAVYFTIYEQLKSFLCS----DDERHEL  522
               + FT +E +  FL S    D + H L
Sbjct  213  AAVITFTSFEMIHRFLVSYFPPDPQPHTL  241



>gb|KJB06735.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
 gb|KJB06736.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
 gb|KJB06738.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=241

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGL+PTVLALLPNWAVYFT+YEQLK  LCS+D +H+LS+GANMLAA+GAGAATT  TN
Sbjct  1    MYRGLAPTVLALLPNWAVYFTMYEQLKDCLCSNDGKHQLSVGANMLAASGAGAATTCFTN  60

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGMRAG VPYRGT SAL
Sbjct  61   PLWVVKTRLQTQGMRAGVVPYRGTFSAL  88


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+    +L +I   EG+RG+Y GL P  LA + +
Sbjct  58   FTNPLWVVKTRLQTQGM-RAGVVPYRGTF--SALRRIAHEEGIRGLYSGLVP-ALAGISH  113

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  114  VAIQFPTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  173

Query  625  MRA  633
              +
Sbjct  174  HHS  176



>gb|EMT02103.1| Mitochondrial substrate carrier family protein W [Aegilops tauschii]
Length=424

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 88/108 (81%), Gaps = 9/108 (8%)
 Frame = +1

Query  349  GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI  528
            GS+I+GSLEQI +REG RG+YRGLSPT+LALLPNWAVYFT+YEQLKS L S         
Sbjct  167  GSVIIGSLEQIARREGFRGLYRGLSPTILALLPNWAVYFTVYEQLKSMLASSGAN-----  221

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGF-VPYRGTLSAL  669
               ++AA+ AGAATTIATNPLWVVKTR QTQG+RAG  +PY+GT++AL
Sbjct  222  ---VMAASCAGAATTIATNPLWVVKTRFQTQGVRAGATIPYKGTVAAL  266


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 6/129 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTRFQ  G+        +G+  V +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  238  PLWVVKTRFQTQGVRAGATIPYKGT--VAALTRIAHEEGIRGLYSGLVP-ALAGITHVAI  294

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
             F +YE++K++L   D      LS G   +A++ A  A +  T P  VV++RLQ QG  +
Sbjct  295  QFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGAHS  354

Query  634  GFVPYRGTL  660
                YRG +
Sbjct  355  E-ARYRGVI  362



>ref|XP_010922181.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=319

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIg  531
            ++I+ SLEQI + EG++G+YRGLSPT+ ALLP WAVYFT+Y QLK  L S D  ++LSIG
Sbjct  66   AVIISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHDGNNQLSIG  125

Query  532  anmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AN+LAA+GAGAAT I TNPLWVVKTRLQTQ +R G VPYR  LSAL
Sbjct  126  ANILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSAL  171


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +VI++R Q  G  +       G  +V  ++++FQ+EG+ G Y G    +L   P
Sbjct  240  TMTYPHEVIRSRLQEQGQARDAANRYTG--VVDCIKKVFQKEGIPGFYHGCGTNLLRTTP  297

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE +K FL
Sbjct  298  TAVITFTSYEMIKRFL  313



>ref|XP_001763122.1| predicted protein [Physcomitrella patens]
 gb|EDQ71999.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 97/142 (68%), Gaps = 9/142 (6%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTN-IRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFV PLDV+KTR QV+  P L +   ++G   +G L +I + EG RG+Y GLSPT++ALL
Sbjct  9    TFVSPLDVVKTRLQVN-RPILNSEGPLKGWTTIGILSKILRDEGPRGLYFGLSPTMVALL  67

Query  445  PNWAVYFTIYEQLKSFLCSDDER-------HELSIganmlaaagagaattiatNPLWVVK  603
             NW VYFT+YE LK  L S++         H + IG  ++AA+GAG AT + TNPLWVVK
Sbjct  68   TNWTVYFTVYEHLKRVLQSEELHDADHTTLHRMPIGTTLVAASGAGVATNLVTNPLWVVK  127

Query  604  TRLQTQGMRAGFVPYRGTLSAL  669
            TRLQTQ +R+  VPY+ T SAL
Sbjct  128  TRLQTQRLRSDIVPYKSTFSAL  149


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q     +L +  +       +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  122  PLWVVKTRLQTQ---RLRSDIVPYKSTFSALRRIAAEEGVRGLYSGLVP-ALAGISHGAI  177

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE LK F  + D+    ELS      A++ +    +  T P  VV++RLQ QG
Sbjct  178  QFPAYEYLKEFFANRDKTSVEELSPLNVAFASSLSKFIASTLTYPHEVVRSRLQEQG  234



>gb|KHN43485.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=240

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGL+PTVLALLPNWAVYF+ YEQLKS L SDD  H LSIGANM+AA+GAGAATT+ TN
Sbjct  1    MYRGLAPTVLALLPNWAVYFSAYEQLKSLLQSDDS-HHLSIGANMIAASGAGAATTMFTN  59

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGMR G VPYRGTLSAL
Sbjct  60   PLWVVKTRLQTQGMRPGVVPYRGTLSAL  87


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+L   +L +I   EG+RG+Y GL P  LA + +
Sbjct  57   FTNPLWVVKTRLQTQGM-RPGVVPYRGTL--SALRRIAHEEGIRGLYSGLVPA-LAGISH  112

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE +K +L + D+    +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  113  VAIQFPTYETIKFYLANQDDTAMEKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQG  172

Query  625  MRA  633
              +
Sbjct  173  HHS  175



>ref|XP_010922172.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=320

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSI  528
            ++I+ SLEQI + EG++G+YRGLSPT+ ALLP WAVYFT+Y QLK  L S  D  ++LSI
Sbjct  66   AVIISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHVDGNNQLSI  125

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAN+LAA+GAGAAT I TNPLWVVKTRLQTQ +R G VPYR  LSAL
Sbjct  126  GANILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSAL  172


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +VI++R Q  G  +       G  +V  ++++FQ+EG+ G Y G    +L   P
Sbjct  241  TMTYPHEVIRSRLQEQGQARDAANRYTG--VVDCIKKVFQKEGIPGFYHGCGTNLLRTTP  298

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE +K FL
Sbjct  299  TAVITFTSYEMIKRFL  314



>ref|XP_010922203.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X5 [Elaeis guineensis]
Length=301

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSI  528
            ++I+ SLEQI + EG++G+YRGLSPT+ ALLP WAVYFT+Y QLK  L S  D  ++LSI
Sbjct  47   AVIISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHVDGNNQLSI  106

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAN+LAA+GAGAAT I TNPLWVVKTRLQTQ +R G VPYR  LSAL
Sbjct  107  GANILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSAL  153


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 39/76 (51%), Gaps = 2/76 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   P +VI++R Q  G  +       G  +V  ++++FQ+EG+ G Y G    +L   P
Sbjct  222  TMTYPHEVIRSRLQEQGQARDAANRYTG--VVDCIKKVFQKEGIPGFYHGCGTNLLRTTP  279

Query  448  NWAVYFTIYEQLKSFL  495
               + FT YE +K FL
Sbjct  280  TAVITFTSYEMIKRFL  295



>ref|XP_008797621.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=278

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  352  SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSI  528
            ++I+ SLE + + EG++G+YRGLSPT+ ALLP WAVYFT+Y+QLK  L S  D  +  SI
Sbjct  24   AVIISSLEHVIKNEGVKGLYRGLSPTITALLPTWAVYFTVYDQLKGLLQSHVDGNNHFSI  83

Query  529  ganmlaaagagaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            GAN++AA+GAGAAT+I TNPLWVVKTRLQTQ MR G VPYR  LSA 
Sbjct  84   GANIIAASGAGAATSIVTNPLWVVKTRLQTQAMRPGVVPYRSLLSAF  130



>ref|XP_010518453.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X4 [Camelina sativa]
Length=253

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 8/98 (8%)
 Frame = +1

Query  376  QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaag  555
            +IF++EG+RG+YRGLSPTV+ALL NWA        LKSFLCS D   +LS+GAN+LAA+G
Sbjct  12   KIFKKEGMRGLYRGLSPTVMALLSNWA--------LKSFLCSKDVDRKLSVGANVLAASG  63

Query  556  agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            AGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  64   AGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  101


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+ + G    + +L   +L +I   EG+RG+Y GL P  LA + + A+
Sbjct  74   PLWVVKTRLQTQGM-RAGVVPYKSTL--SALRRIAYEEGIRGLYSGLVPA-LAGISHVAI  129

Query  460  YFTIYEQLKSFLCS--DDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             F  YE +K +L    D     L+     +A++ A    +  T P  VV+ RLQ QG
Sbjct  130  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG  186



>ref|XP_001701258.1| hypothetical protein CHLREDRAFT_122344 [Chlamydomonas reinhardtii]
 gb|EDO97651.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=303

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 83/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGN--TNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            FVCPLDV+KTR QVH LP      T  R + I G ++ I   EG++GMY+GL PT+LALL
Sbjct  23   FVCPLDVLKTRLQVHHLPTHQQPVTRSRSTTIAGGIKAIIANEGVKGMYKGLGPTLLALL  82

Query  445  PNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            PNWAVYF +Y+ LK  L +       S   +M AAAGAG  T + TNPLWVVKTR+Q  G
Sbjct  83   PNWAVYFVVYDSLKKRLGALPT----SPLTHMAAAAGAGVTTILVTNPLWVVKTRMQCHG  138

Query  625  M-RAG  636
            M RAG
Sbjct  139  MSRAG  143



>gb|KIY99796.1| putative carrier protein [Monoraphidium neglectum]
Length=212

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 92/142 (65%), Gaps = 13/142 (9%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            TFVCPLDV+KTR QV    ++ +T   G  I+G L  I + EG +G+YRGL+PT++ALLP
Sbjct  25   TFVCPLDVLKTRLQVQ---RISSTTRVG--IIGGLSAIVKAEGAKGLYRGLTPTLMALLP  79

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSI-ganmlaaagagaattiatNPLWVVKTRLQTQG  624
            NWAVYF++Y +LK+ L +   +   +    +M AAAGAG AT + TNPLWV+KTR+QTQ 
Sbjct  80   NWAVYFSVYGRLKTVLTTRQGQQVAATPAIHMAAAAGAGVATLLITNPLWVIKTRMQTQH  139

Query  625  MRAGF-------VPYRGTLSAL  669
            M   +         Y+ T  AL
Sbjct  140  MNISYGRGRQVRTEYKSTFDAL  161



>ref|XP_002509046.1| mitochondrial carrier family [Micromonas sp. RCC299]
 gb|ACO70304.1| mitochondrial carrier family [Micromonas sp. RCC299]
Length=314

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 89/151 (59%), Gaps = 27/151 (18%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T VCPLDV+KTR QV  L   G+  +     + SL  I + EG  G+YRGL+PT++ALLP
Sbjct  24   TIVCPLDVLKTRLQVSTLRVGGDAYVS---TLQSLSAIARTEGFVGLYRGLTPTIVALLP  80

Query  448  NWAVYFTIYEQLKSFL-----------CSDDERHELSIganmlaaagagaattiatNPLW  594
            NWAVYFT+YE LK F+            S   RH +S       AAGAG AT + TNPLW
Sbjct  81   NWAVYFTVYEGLKEFMEPVGAAGSQSWSSPHLRHMVS-------AAGAGVATVLVTNPLW  133

Query  595  VVKTRLQTQ---GMRAGF---VPYRGTLSAL  669
            VVKTRLQ Q    +RA     VPY G  SAL
Sbjct  134  VVKTRLQVQHSEALRASMPTRVPYSGAFSAL  164



>dbj|GAN03363.1| mitochondrial NAD transporter [Mucor ambiguus]
Length=305

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV KTR Q  G+ K G    +G+  VG+L +I+Q EG+RG+YRGL PT+L  LP WA
Sbjct  37   CPLDVAKTRLQNQGIAKPGEKLYKGT--VGTLSRIWQEEGIRGLYRGLGPTILGYLPTWA  94

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  KS   +D+  H+     ++ +A  AGAA+T+ TNPLWV+KTRL TQ  R  
Sbjct  95   IYFTAYDYCKSH-WADELGHDKEWLLHISSAMSAGAASTMLTNPLWVIKTRLMTQNER--  151

Query  637  FVPYR  651
              PYR
Sbjct  152  -TPYR  155



>gb|AFK34832.1| unknown [Lotus japonicus]
Length=277

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGLSPT+LALLPNWAVYFT+Y+QLK  L S D  +EL+   N++AAAGAG AT I+TN
Sbjct  1    MYRGLSPTILALLPNWAVYFTVYDQLKGRLRSRDGCNELTTIGNIIAAAGAGVATAISTN  60

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGMR+  VPY+  LSAL
Sbjct  61   PLWVVKTRLQTQGMRSDVVPYKSVLSAL  88


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G+ K  N  +  + ++   +++FQ+EG+RG YRG +  +L   P+  +
Sbjct  161  PHEVIRSRLQEQGIAK--NNGVHYAGVIDCTKKVFQKEGIRGFYRGCATNLLRTTPSAVI  218

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  219  TFTSYEMIHRFL  230


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 72/130 (55%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL V+KTR Q  G+    +  +    ++ +L +I   EG+RG+Y G+ P+ LA + + A+
Sbjct  61   PLWVVKTRLQTQGMR---SDVVPYKSVLSALTRIAHEEGVRGLYSGILPS-LAGVSHVAI  116

Query  460  YFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM-R  630
             F  YE++K ++   D     +LS G   +A++ +    ++ T P  V+++RLQ QG+ +
Sbjct  117  QFPAYEKIKLYMAEKDNTTVDKLSPGNVAIASSISKITASLLTYPHEVIRSRLQEQGIAK  176

Query  631  AGFVPYRGTL  660
               V Y G +
Sbjct  177  NNGVHYAGVI  186



>gb|EPB89321.1| hypothetical protein HMPREF1544_03830 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=303

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV KTR Q  G+ K G    +G+  VG+L +I+Q EG+RG+YRGL PT+L  LP WA
Sbjct  37   CPLDVAKTRLQNQGIAKPGEKLYKGT--VGTLSRIWQEEGIRGLYRGLGPTILGYLPTWA  94

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  KS   +D+  H+     ++ +A  AGAA+T+ TNPLWV+KTRL TQ  R  
Sbjct  95   IYFTAYDYCKSH-WADELGHDKEWLLHISSAMSAGAASTMLTNPLWVIKTRLMTQNER--  151

Query  637  FVPYR  651
              PYR
Sbjct  152  -TPYR  155



>emb|CDY27484.1| BnaC04g51250D [Brassica napus]
Length=255

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 98/164 (60%), Gaps = 27/164 (16%)
 Frame = +1

Query  187  TADAHGPSPKG--LLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI  360
            +A++H P      +LCNA AG  A     TFVCPLDVIKTRFQVHGLP L ++NI+GSLI
Sbjct  34   SANSHPPPNNSTIVLCNAAAGVVAA----TFVCPLDVIKTRFQVHGLPNLAHSNIKGSLI  89

Query  361  VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganm  540
            VGSL+   +R                    W + +T   +  S L      + + I  + 
Sbjct  90   VGSLQT--RRNA------------------WLIPWTFSYRHGSSLQLGCLFYNMRITNSA  129

Query  541  laaag-agaattiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            L     AGAATTIATNPLWVVKTRLQTQGMRAG VPY+ TLSAL
Sbjct  130  LVLMSGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSAL  173



>ref|XP_006604086.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Glycine max]
Length=289

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  406  MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatN  585
            MYRGLSPT++ALLPNWAVYFT YEQLK  L S D  +EL+   +++AAAGAGAAT I+TN
Sbjct  1    MYRGLSPTIVALLPNWAVYFTSYEQLKGLLRSRDGCNELTTIGSIIAAAGAGAATAISTN  60

Query  586  PLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            PLWVVKTRLQTQGMR   VPY+  LSAL
Sbjct  61   PLWVVKTRLQTQGMRPDVVPYKSVLSAL  88


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +1

Query  280  PLDVIKTRFQVHGL-PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            PL V+KTR Q  G+ P +    +    ++ +L +I   EG+RG+Y G+ P+ LA + + A
Sbjct  61   PLWVVKTRLQTQGMRPDV----VPYKSVLSALTRITHEEGIRGLYSGIVPS-LAGVSHVA  115

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            + F  YE++KS++   D     +L+ G+  +A++ +    ++ T P  V+++RLQ QG  
Sbjct  116  IQFPAYEKIKSYIAEKDNTTVDKLTPGSVAVASSISKVFASVMTYPHEVIRSRLQEQGQA  175

Query  631  AGF-VPYRGTL  660
                V Y G +
Sbjct  176  KNIGVQYAGVI  186


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            P +VI++R Q  G  K  N  ++ + ++   +++FQ+EG+ G YRG +  +    P+  +
Sbjct  161  PHEVIRSRLQEQGQAK--NIGVQYAGVIDCTKKVFQKEGIPGFYRGCATNLFRTTPSAVI  218

Query  460  YFTIYEQLKSFL  495
             FT YE +  FL
Sbjct  219  TFTSYEMIHRFL  230



>gb|KFH65804.1| hypothetical protein MVEG_07907 [Mortierella verticillata NRRL 
6337]
Length=307

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 79/131 (60%), Gaps = 3/131 (2%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G+    + + +G+   G+L +I+  EG+RG+YRGL PT+   LP WA
Sbjct  35   CPLDVVKTRLQNQGVVSAKSKSYKGT--AGTLTRIWSEEGVRGLYRGLGPTIFGYLPTWA  92

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  K  +      HE ++   ++AA  AGA +T  TNPLWV+KTR  TQ     
Sbjct  93   IYFTAYDYFKDLVARQTGHHESNLFVYIVAAMSAGATSTTITNPLWVIKTRFMTQNEHTP  152

Query  637  FVPYRGTLSAL  669
            +  Y+ TL A 
Sbjct  153  Y-RYKNTLDAF  162



>dbj|GAA95912.1| hypothetical protein E5Q_02570 [Mixia osmundae IAM 14324]
 gb|KEI42622.1| hypothetical protein L969DRAFT_101074 [Mixia osmundae IAM 14324]
Length=366

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KT+ Q  G  + G     G  + G+L +I+  EG RG+YRGL PTVL  LP WA
Sbjct  71   CPLDVVKTKLQAQGFVQAGARGYHG--LFGTLSRIWLEEGPRGLYRGLGPTVLGYLPTWA  128

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT+Y+++K  +  + +  E    A++ AA  AGA  TI TNPLWV+KTR  TQ +  G
Sbjct  129  IYFTVYDRVKLAMAQNTQADENDWTAHITAAMVAGATGTICTNPLWVIKTRFMTQKVGEG  188

Query  637  FVPYRGTLSAL  669
               Y+ TL A+
Sbjct  189  EERYKHTLDAI  199



>emb|CEP14775.1| hypothetical protein [Parasitella parasitica]
Length=308

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 84/133 (63%), Gaps = 5/133 (4%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV KTR Q   + K G    +G+  VG+L +I+Q EG+RG+YRGL PT+L  LP WA
Sbjct  37   CPLDVAKTRLQNQSIAKPGEKLYKGT--VGTLSRIWQEEGIRGLYRGLGPTILGYLPTWA  94

Query  457  VYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQGMR  630
            +YFT Y+  KS    + E   H+     ++ +A  AGAA+T+ TNPLWV+KTRL TQ  R
Sbjct  95   IYFTAYDYCKSHWADELETVGHDKEWLLHISSAMSAGAASTMLTNPLWVIKTRLMTQNER  154

Query  631  AGFVPYRGTLSAL  669
              +  Y+ TL A 
Sbjct  155  TPY-RYKNTLHAF  166



>ref|XP_002418843.1| mitochondrial NAD+ transporter, putative [Candida dubliniensis 
CD36]
 emb|CAX44149.1| mitochondrial NAD+ transporter, putative [Candida dubliniensis 
CD36]
Length=366

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G       N++ +  +G+ + I   EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQGTV---GENLKYNGFLGTFQTILHEEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S  +++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKKFYPSFLQQYNIENPSIVHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>ref|XP_007404089.1| hypothetical protein MELLADRAFT_46330 [Melampsora larici-populina 
98AG31]
 gb|EGG13151.1| hypothetical protein MELLADRAFT_46330 [Melampsora larici-populina 
98AG31]
Length=344

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHG-LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
              CPLD++KT+ Q  G L   G T     L VGSL  I+Q EG RG+YRGL PT+   LP
Sbjct  38   LTCPLDLVKTKLQAQGGLRVEGQTGYYDGL-VGSLRIIWQEEGFRGLYRGLGPTIFGYLP  96

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
             WA+YFT+Y+ +KS L      H   + +++LAA  AGA +TIATNPLWV+KTR  TQ +
Sbjct  97   TWAIYFTVYDSVKSTLAELRPSHREDVFSHVLAAMTAGATSTIATNPLWVIKTRFMTQRI  156

Query  628  RAG  636
              G
Sbjct  157  TEG  159


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 3/114 (3%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV  459
            PL VIKTRF    + + G+   R      +  +I+ +EGLRG YRG+ P++   + + A+
Sbjct  143  PLWVIKTRFMTQRITE-GSKTERYKHTFDAFRRIYAQEGLRGFYRGMLPSLFG-VSHVAI  200

Query  460  YFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
             F +YEQ+K +  S D  ++L     ++A+A +    ++ T P  V++TRLQ  
Sbjct  201  QFPLYEQIKLYYKSTDS-NDLPSSRILVASACSKMLASVITYPHEVLRTRLQVH  253



>gb|KGR00544.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans GC75]
 gb|KGU11245.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P87]
 gb|KGU33031.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P75063]
 gb|KHC44663.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans Ca6]
 gb|KHC72834.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P75016]
Length=366

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G   +G  N++ +  +G+ + I + EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQG--TMGE-NLKYNGFLGTFKTILREEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S   ++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKRFYPSFLHQYNIENPSIIHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>emb|CDH57170.1| mitochondrial nad transporter [Lichtheimia corymbifera JMRC:FSU:9682]
Length=303

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G  + G    RG+L  G+L +I++ EG+RG+YRGL PTVL  LP WA
Sbjct  36   CPLDVVKTRLQNQGKAEAGVILYRGTL--GTLSRIWKEEGIRGLYRGLGPTVLGYLPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  K+    + +  + +   ++ +A  AGA ++  TNPLW++KTRL TQ  R  
Sbjct  94   IYFTAYDYCKARYGRNMDADK-AWLVHIASAMSAGATSSCMTNPLWLIKTRLMTQNERTA  152

Query  637  FVPYRGTLSAL  669
            +  Y+ TL A 
Sbjct  153  Y-RYKNTLDAF  162



>ref|XP_002952313.1| hypothetical protein VOLCADRAFT_62332 [Volvox carteri f. nagariensis]
 gb|EFJ46784.1| hypothetical protein VOLCADRAFT_62332 [Volvox carteri f. nagariensis]
Length=290

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 12/135 (9%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            FVCPLDV+KTR QV        T    + I G +  I   EG RGMY+GL PT+LALLPN
Sbjct  22   FVCPLDVLKTRLQV--------TKASSTSISGGIRAIIAHEGTRGMYKGLGPTLLALLPN  73

Query  451  WAVYFTIYEQLKSFL--CSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            WAVYF +Y+ LK  L   +  +        +M AAAGAG  T + TNPLWVVKTR+Q+  
Sbjct  74   WAVYFVVYDSLKRRLGAVTPPQSAAEGPLTHMAAAAGAGVTTILVTNPLWVVKTRMQSPY  133

Query  625  MRAGFVPYRGTLSAL  669
            +R    PY+ T  AL
Sbjct  134  LRRP--PYKSTAEAL  146



>ref|XP_714659.1| likely mitochondrial carrier protein [Candida albicans SC5314]
 gb|EAK95611.1| likely mitochondrial carrier protein [Candida albicans SC5314]
 gb|EEQ47457.1| conserved hypothetical protein [Candida albicans WO-1]
 gb|KGQ95946.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P37005]
 gb|KGR11796.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P57072]
 gb|KGR13931.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P78048]
 gb|KGR20768.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P37037]
 gb|KGT70331.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans 12C]
 gb|KGU12947.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans 19F]
 gb|KGU15733.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans L26]
 gb|KHC54023.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P60002]
 gb|KHC66039.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P75010]
 gb|KHC88309.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans SC5314]
Length=366

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G       N++ +  +G+ + I + EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQGTV---GENLKYNGFLGTFKTILREEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S   ++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKRFYPSFLHQYNIENPSIIHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>gb|KGU29009.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P34048]
 gb|KHC38546.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P76055]
 gb|KHC39990.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P76067]
Length=366

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G       N++ +  +G+ + I + EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQGTV---GENLKYNGFLGTFKTILREEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S   ++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKRFYPSFLHQYNIENPSVIHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>gb|KGU35528.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P57055]
Length=366

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G       N++ +  +G+ + I + EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQGTV---GENLKYNGFLGTFKTILREEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S   ++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKRFYPSFLHQYNIENPSVIHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>ref|XP_714565.1| likely mitochondrial carrier protein [Candida albicans SC5314]
 gb|EAK95512.1| likely mitochondrial carrier protein [Candida albicans SC5314]
 gb|KGQ89482.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P94015]
 gb|KHC58055.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P37039]
 gb|KHC80736.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans P78042]
 gb|KHC81987.1| solute carrier family 25 (mitochondrial folate transporter), 
member 32 [Candida albicans SC5314]
Length=366

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G       N++ +  +G+ + I + EG+RG+YRGL PT++  LP W
Sbjct  82   VCPLDVVKTRLQAQGTV---GENLKYNGFLGTFKTILREEGIRGLYRGLVPTMIGYLPTW  138

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQ-G  624
             +YFT+YEQ K F  S   ++ +   + +   +A  AG  ++IA NP+WVVKTRL  Q G
Sbjct  139  TIYFTVYEQAKRFYPSFLHQYNIENPSIIHFCSALTAGMTSSIAVNPIWVVKTRLMVQTG  198

Query  625  MRAGFVPYRGTLSAL  669
                 V YRGT  A 
Sbjct  199  KEGQQVYYRGTFDAF  213



>ref|XP_001420486.1| MC family transporter: folate [Ostreococcus lucimarinus CCE9901]
 gb|ABO98779.1| MC family transporter: folate [Ostreococcus lucimarinus CCE9901]
Length=345

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 82/140 (59%), Gaps = 14/140 (10%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T VCPLDV+KTR QV      G T    +   G+L +I + EG RG+YRGL PTV ALLP
Sbjct  66   TVVCPLDVLKTRLQVSA-ATTGTTEYLSTY--GALRRIVRHEGARGLYRGLGPTVAALLP  122

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            NW VYF+ Y  LK    +D   H   I    LAAAGAGAAT   TNPLWV KTRLQ Q  
Sbjct  123  NWGVYFSTYGALKRIFIADAN-HFAHI----LAAAGAGAATIFVTNPLWVAKTRLQVQHS  177

Query  628  RA------GFVPYRGTLSAL  669
             A        VPY  T++AL
Sbjct  178  HALASAMPKRVPYTSTINAL  197



>ref|NP_001172375.1| Os01g0513301 [Oryza sativa Japonica Group]
 dbj|BAH91105.1| Os01g0513301 [Oryza sativa Japonica Group]
Length=120

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  226  CNagagaaagviaaTFVCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLR  402
            CNA AG +AGVI+AT +CPLDVIKTR QV+GLP  L +T   G +I+   + I + EGL 
Sbjct  19   CNAIAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGLP  78

Query  403  GMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD  504
            G+YRGLSPT++AL P WAV F++Y  LK  L S 
Sbjct  79   GLYRGLSPTIVALFPTWAVTFSVYNHLKGLLHSQ  112



>emb|CEI99166.1| hypothetical protein RMCBS344292_13258 [Rhizopus microsporus]
Length=305

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
             CPLDV KTR Q  G+   G    +G+  VG+L +I+  EG+RG+YRGL PT+L  LP W
Sbjct  35   TCPLDVAKTRLQNQGVTLPGEKIYKGT--VGTLSRIWHEEGIRGLYRGLGPTILGYLPTW  92

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRA  633
            A+YFT Y+  KS   +++  +E     ++++A  AGA +T  TNPLWV+KTRL TQ  R 
Sbjct  93   AIYFTAYDYCKS-QWANEIGNEKEWLLHIISAMSAGALSTTLTNPLWVIKTRLMTQSERT  151

Query  634  GFVPYRGTLSAL  669
             +  Y  T+ A 
Sbjct  152  SY-RYNNTIHAF  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 7/134 (5%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   PL VIKTR     + +   T+ R +  + +   I + EG RG Y+GL P+++  + 
Sbjct  132  TLTNPLWVIKTRL----MTQSERTSYRYNNTIHAFATIAKEEGFRGFYKGLGPSLIG-IS  186

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            + AV F +YE+LK  L  D +       + +LA+A +  + ++AT P  V++TRLQ Q  
Sbjct  187  HVAVQFPLYEKLKVALHVDQDSSSYGSTSILLASALSKMSASLATYPHEVIRTRLQNQTR  246

Query  628  RAGFVPYRGTLSAL  669
            +     Y+G L A+
Sbjct  247  KP--YKYKGILHAI  258



>ref|XP_006957017.1| mitochondrial NAD transporter, partial [Wallemia sebi CBS 633.66]
 gb|EIM22976.1| mitochondrial NAD transporter, partial [Wallemia sebi CBS 633.66]
Length=296

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 83/131 (63%), Gaps = 6/131 (5%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDVIKT+ Q     K     + G  ++G++++I + +G +G Y+GL PT+   LP WA
Sbjct  26   CPLDVIKTKLQAQ--KKFKGRTLDG--VIGTIKRISKEQGFKGFYKGLGPTIFGYLPTWA  81

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT+Y+++K+ L    + + ++   +M+A+A AGA     +NPLWVVKTR  TQ M + 
Sbjct  82   IYFTVYDEVKAVLSKSGDPNGVNWSTHMIASATAGATGATLSNPLWVVKTRFMTQDMES-  140

Query  637  FVPYRGTLSAL  669
             +PY+ T  AL
Sbjct  141  -IPYKHTFHAL  150



>emb|CEG79270.1| hypothetical protein RMATCC62417_13755 [Rhizopus microsporus]
Length=305

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV KTR Q  G+   G    +G+  VG+L +I+  EG+RG+YRGL PT+L  LP WA
Sbjct  36   CPLDVAKTRLQNQGVTLPGEKIYKGT--VGTLSRIWHEEGIRGLYRGLGPTILGYLPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  KS   +++  +E     ++++A  AGA +T  TNPLWV+KTRL TQ  R  
Sbjct  94   IYFTAYDYCKS-QWANEIGNEKEWLLHIISAMSAGALSTTLTNPLWVIKTRLMTQSERTS  152

Query  637  FVPYRGTLSAL  669
            +  Y  T+ A 
Sbjct  153  Y-RYNNTIHAF  162


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 7/134 (5%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T   PL VIKTR     + +   T+ R +  + +   I + EG RG Y+GL P+++  + 
Sbjct  132  TLTNPLWVIKTRL----MTQSERTSYRYNNTIHAFATIAKEEGFRGFYKGLGPSLIG-IS  186

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            + AV F +YE+LK  L  D +       + +LA+A +  + ++AT P  V++TRLQ Q  
Sbjct  187  HVAVQFPLYEKLKVVLHVDRDSSSYGSTSILLASALSKMSASLATYPHEVIRTRLQNQTR  246

Query  628  RAGFVPYRGTLSAL  669
            +     Y+G L A+
Sbjct  247  KP--YKYKGILHAI  258



>emb|CDH58404.1| mitochondrial nad transporter [Lichtheimia corymbifera JMRC:FSU:9682]
Length=303

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G  + G    RG+  VG+L +I++ EG+RG+YRGL PT+L  +P WA
Sbjct  36   CPLDVVKTRLQNQGKLEPGIVVYRGT--VGTLSRIWKEEGIRGLYRGLGPTILGYIPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  K      +  +  +   ++ +A  AGAA+T  TNPLWV+KTR+ TQ  R  
Sbjct  94   IYFTAYDYFKH-RWGKEFGYNKAWLVHIASAMSAGAASTSLTNPLWVIKTRMMTQNERTA  152

Query  637  FVPYRGTLSAL  669
            +  Y+ TL A 
Sbjct  153  Y-RYKNTLDAF  162



>ref|XP_008601767.1| folate transporter/carrier (mitochondrial) [Beauveria bassiana 
ARSEF 2860]
 gb|EJP62537.1| folate transporter/carrier (mitochondrial) [Beauveria bassiana 
ARSEF 2860]
Length=403

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
             CPLDVIKT+ Q     K G++ +   L VG+   I++ EGLRGMYRGL P VL  LP W
Sbjct  68   TCPLDVIKTKLQAQAAVKAGHSRMYNGL-VGTASVIWREEGLRGMYRGLGPIVLGYLPTW  126

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            AV+FT+Y + K +L   D  H + +  N  ++  AGA++T+ATNP+WV+KTRL +Q
Sbjct  127  AVWFTVYNKSKVYLA--DYHHNVHL-INFWSSIIAGASSTVATNPIWVIKTRLMSQ  179



>emb|CDS04125.1| hypothetical protein LRAMOSA07080 [Absidia idahoensis var. thermophila]
Length=303

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G  + G    RG+  VG+L +I++ EG+RG+YRGL+ T+L  LP WA
Sbjct  36   CPLDVVKTRLQNQGKAEAGVIPYRGT--VGTLSRIWKEEGIRGLYRGLNVTLLGYLPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  K+    + +  + +   ++ +A  AGA ++  TNPLW++KTRL TQ  R  
Sbjct  94   IYFTAYDYCKARYGRNMDSDK-AWLVHIASAMSAGATSSCMTNPLWLIKTRLMTQNERTA  152

Query  637  FVPYRGTLSAL  669
            +  Y+ TL A 
Sbjct  153  Y-RYKSTLDAF  162



>ref|XP_005833561.1| mitochondrial carrier protein [Guillardia theta CCMP2712]
 gb|EKX46581.1| mitochondrial carrier protein [Guillardia theta CCMP2712]
Length=339

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q            RG+  V ++  I + EG+RG+YRGLSPT+L ++P W
Sbjct  43   VCPLDVVKTRLQGQIHSHSSIVKYRGT--VDTIHTIMKEEGVRGLYRGLSPTLLGMVPTW  100

Query  454  AVYFTIYEQLKSFLCSDDERHEL-----SIganmlaaagagaattiatNPLWVVKTRLQT  618
              YFT Y   KS L ++D +  L      I  +ML+A GAG  T   +NP WVVKTR+Q 
Sbjct  101  TTYFTAYNFFKSMLETNDRQEGLQFSKGQIFVHMLSACGAGIVTATVSNPFWVVKTRIQM  160

Query  619  QGMRAGFVPYRGTLSAL  669
                +   PYRGT+ A 
Sbjct  161  FSRHS--CPYRGTMDAF  175



>gb|KGQ04974.1| nicotinamide adenine dinucleotide transporter 1 [Beauveria bassiana 
D1-5]
Length=519

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
             CPLDVIKT+ Q     K G++ +   L VG+   I++ EGLRGMYRGL P VL  LP W
Sbjct  184  TCPLDVIKTKLQAQAAVKAGHSRMYNGL-VGTASVIWREEGLRGMYRGLGPIVLGYLPTW  242

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            AV+FT+Y + K +L   D  H + +  N  ++  AGA++T+ATNP+WV+KTRL +Q
Sbjct  243  AVWFTVYNKSKVYLA--DYHHNVHL-INFWSSIIAGASSTVATNPIWVIKTRLMSQ  295



>gb|EJU03317.1| mitochondrial carrier [Dacryopinax sp. DJM-731 SS1]
Length=374

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 82/139 (59%), Gaps = 12/139 (9%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
             +CPLDVIKT+ Q   + + G+ +  G+  +G+++QI +R+G+RG+YRGLSPT+L  LP 
Sbjct  55   LMCPLDVIKTKLQAQTV-RHGHIDYLGA--IGTVKQILERDGVRGLYRGLSPTMLGYLPT  111

Query  451  WAVYFTIYEQLKSFLCSDDERHELSIganm-------laaagagaattiatNPLWVVKTR  609
            WA+YFT+Y+  K         HE    A          AA  AGA  TI TNPLWV+KTR
Sbjct  112  WAIYFTVYDGFKRTFGVTPRMHEKKGYAISNLWFLHIAAAMTAGATGTIITNPLWVIKTR  171

Query  610  LQTQGMRAGFVPYRGTLSA  666
              TQ       PYR TL A
Sbjct  172  FMTQPHTEP--PYRSTLQA  188



>ref|XP_011277308.1| putative mitochondrial carrier [Wickerhamomyces ciferrii]
 emb|CCH40914.1| putative mitochondrial carrier [Wickerhamomyces ciferrii]
Length=402

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 17/127 (13%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV KTR Q  GL  +     +   I G+L+ IF  EG+RG+YRGLSP +L   P W
Sbjct  87   VCPLDVAKTRLQAQGLSSIK----KYHGIKGTLKTIFNEEGVRGLYRGLSPIILGYFPTW  142

Query  454  AVYFTIYEQLKSFL-----------CSDDERHELSIganmlaaagagaattiatNPLWVV  600
             +YF++YE+ K F              D+E HE  I  + L+A  AG+ +T  TNP+WVV
Sbjct  143  MIYFSVYEKAKIFYPNFFDKHYGINHKDNEFHEFLI--HSLSAFTAGSVSTSITNPIWVV  200

Query  601  KTRLQTQ  621
            KTRL  Q
Sbjct  201  KTRLMLQ  207



>ref|XP_002616917.1| hypothetical protein CLUG_02361 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38235.1| hypothetical protein CLUG_02361 [Clavispora lusitaniae ATCC 42720]
Length=357

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G      ++ RG L  G+   IF+ EG+RG+Y+G+ P  +  LP W
Sbjct  78   VCPLDVVKTRLQAQGF----GSHYRGFL--GTFATIFREEGIRGLYKGVVPVTIGYLPTW  131

Query  454  AVYFTIYEQLKSFLCSDDERH---ELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
            A+YFT+YE+ K+F      R     +    +  A+  AG +++   NP+WVVKTRL  Q 
Sbjct  132  AIYFTVYERAKAFYPGYFSRTFGINIDSLNHFAASITAGISSSCLVNPIWVVKTRLMVQT  191

Query  625  MRAGFVPYRGTLSAL  669
             +   V Y+GT+ A 
Sbjct  192  GKEDVV-YKGTIDAF  205



>ref|XP_003712078.1| solute carrier family 25 member 33 [Magnaporthe oryzae 70-15]
 gb|EHA52271.1| solute carrier family 25 member 33 [Magnaporthe oryzae 70-15]
 gb|ELQ42870.1| solute carrier family 25 member 33 [Magnaporthe oryzae Y34]
 gb|ELQ65845.1| solute carrier family 25 member 33 [Magnaporthe oryzae P131]
Length=430

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 79/126 (63%), Gaps = 11/126 (9%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGL-------PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV  432
            VCPLDVIKT+ Q  G          +G+  +   L+ G+ + I++ EG+RGMYRGL P +
Sbjct  98   VCPLDVIKTKLQAQGGFAAVQKGRHVGHHRVYSGLL-GTGKIIWREEGIRGMYRGLGPII  156

Query  433  LALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRL  612
            L  LP WAV+FT+Y + K FL    E H+ S   N  ++  AGA++TI TNP+WV+KTRL
Sbjct  157  LGYLPTWAVWFTVYNKSKEFL---GEHHKNSFIVNFWSSIVAGASSTIVTNPIWVIKTRL  213

Query  613  QTQGMR  630
             +Q  R
Sbjct  214  MSQSAR  219



>ref|XP_002547687.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER35132.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=362

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 7/136 (5%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV+KTR Q  G   LG  N++ +  + + + I + EG+RG+YRGL PT++  LP W
Sbjct  77   VCPLDVVKTRLQAQG--TLGK-NLKYNGFLNTFKTIIREEGVRGLYRGLVPTMIGYLPTW  133

Query  454  AVYFTIYEQLKSFLCSDDERHELSIganml--aaagagaattiatNPLWVVKTRLQTQG-  624
             +YFT+YEQ K F     + + +   + +   +A  AG  ++IA NP+WVVKTRL  Q  
Sbjct  134  TIYFTVYEQAKRFYPGFLKNYNIENPSIIHFCSALSAGMTSSIAVNPIWVVKTRLMVQNG  193

Query  625  -MRAGFVPYRGTLSAL  669
              +   V Y+GT+ A+
Sbjct  194  QEKKNEVYYKGTIDAI  209



>gb|KEZ38744.1| Mitochondrial carrier protein [Scedosporium apiospermum]
Length=385

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 12/126 (10%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG--LP------KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPT  429
             CPLDVIKT+ Q  G  +P       +G+  +   L VG+   I++ EG+RGMYRGL P 
Sbjct  38   TCPLDVIKTKLQAQGGFIPFKKQGGHVGHPKMYNGL-VGTARTIWRTEGIRGMYRGLGPI  96

Query  430  VLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTR  609
            V+  LP WAV+FT+Y + K+FL S   +HE  +  NM ++  AGA++TI TNP+WV+KTR
Sbjct  97   VMGYLPTWAVWFTVYNKSKNFL-SQRYKHEFLV--NMCSSVVAGASSTIVTNPIWVIKTR  153

Query  610  LQTQGM  627
            L +QG+
Sbjct  154  LMSQGV  159



>ref|XP_009105387.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Brassica rapa]
Length=288

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 99/154 (64%), Gaps = 31/154 (20%)
 Frame = +1

Query  208  SPKGLLCNagagaaagviaaTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ  387
            S +  +CNAGAGAAAG IAATFVCPLDVIKTR QVHGLP+                   +
Sbjct  14   SIRDTICNAGAGAAAGAIAATFVCPLDVIKTRLQVHGLPET------------------R  55

Query  388  REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaa  567
            R+G+RG++               VYF++Y +LK  L S D +  LSIGANM+AA GAGA+
Sbjct  56   RDGIRGLH-----------VFRQVYFSVYGKLKDLLQSSDGK--LSIGANMVAAGGAGAS  102

Query  568  ttiatNPLWVVKTRLQTQGMRAGFVPYRGTLSAL  669
            T+IATNPLWVVKTRL TQGMR   +PY+  LSA 
Sbjct  103  TSIATNPLWVVKTRLMTQGMRPDVIPYKSMLSAF  136



>gb|EIE86128.1| hypothetical protein RO3G_10839 [Rhizopus delemar RA 99-880]
Length=297

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 76/131 (58%), Gaps = 13/131 (10%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV KTR Q  G+   G    +G+  VG+L +I+  EG+RG+YRGLSPT+L  LP WA
Sbjct  36   CPLDVAKTRLQNQGVVLPGEKMYKGT--VGTLSRIWCEEGIRGLYRGLSPTILGYLPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y          D   E     ++++A  AGA +T  TNPLWV+KTR  TQ  R  
Sbjct  94   IYFTAY----------DYYSEKGWLLHIVSAMSAGALSTSLTNPLWVIKTRFMTQNERTA  143

Query  637  FVPYRGTLSAL  669
            +  Y  TL A 
Sbjct  144  Y-RYHNTLHAF  153



>ref|XP_457354.2| DEHA2B09284p [Debaryomyces hansenii CBS767]
 emb|CAG85358.2| DEHA2B09284p [Debaryomyces hansenii CBS767]
Length=390

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 72/124 (58%), Gaps = 10/124 (8%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG-----LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA  438
            VCPLDV+KTRFQ HG        L +   RG L  G+ + I + EGLRG+YRGL P  + 
Sbjct  82   VCPLDVVKTRFQAHGALAQSTGSLASKKYRGFL--GAFKTILREEGLRGLYRGLVPITIG  139

Query  439  LLPNWAVYFTIYEQLKSFLCSDDERH---ELSIganmlaaagagaattiatNPLWVVKTR  609
             LP W +YFT+YE+ K F     + H   E     +  +A  AG  ++IA NP+WVVKTR
Sbjct  140  YLPTWTIYFTVYERAKLFYPEFLKSHFNLETHALNHFCSALTAGMTSSIAVNPIWVVKTR  199

Query  610  LQTQ  621
            L  Q
Sbjct  200  LMIQ  203



>emb|CDS12517.1| hypothetical protein LRAMOSA04711 [Absidia idahoensis var. thermophila]
Length=303

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G  + G    RG+  VG+L +I++ EG+RG+YRGL  TV+  +P WA
Sbjct  36   CPLDVVKTRLQNQGKAEAGVIPYRGT--VGTLSRIWKEEGIRGLYRGLGVTVIGYMPTWA  93

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT Y+  K+    + +  + +   ++ +A  AGAA+T  TNPLWV+KTR+ TQ  R  
Sbjct  94   IYFTAYDYCKARYGRNMDSDK-AWLIHIASAMSAGAASTSLTNPLWVIKTRMMTQNERTA  152

Query  637  FVPYRGTLSAL  669
            +  Y+ +L A 
Sbjct  153  Y-RYKNSLDAF  162



>gb|EPQ62397.1| hypothetical protein BGT96224_A20515 [Blumeria graminis f. sp. 
tritici 96224]
Length=369

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 76/121 (63%), Gaps = 8/121 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIV-----GSLEQIFQREGLRGMYRGLSPTVLA  438
             CPLDVIKT+ Q  G  +  N NI  S IV     G+   I+Q+EG +GMYRGL P +L 
Sbjct  46   TCPLDVIKTKLQAQGGFRNQNENINSSNIVYRGMVGTARVIWQQEGFKGMYRGLGPIILG  105

Query  439  LLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQT  618
             LP WAV+FT+Y + K F+ +  E        N  ++  AGA++++ATNP+WV+KTRL +
Sbjct  106  YLPTWAVWFTVYGRSKQFIGAHIESQ---FYVNFWSSVVAGASSSMATNPIWVIKTRLMS  162

Query  619  Q  621
            Q
Sbjct  163  Q  163



>emb|CCU78404.1| mitochondrial folate transporter/carrier, partial [Blumeria graminis 
f. sp. hordei DH14]
Length=323

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 76/121 (63%), Gaps = 8/121 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIV-----GSLEQIFQREGLRGMYRGLSPTVLA  438
             CPLDVIKT+ Q  G  +  N NI  S IV     G+   I+Q+EG +GMYRGL P +L 
Sbjct  46   TCPLDVIKTKLQAQGGFRNQNENISSSNIVYRGMVGTARVIWQQEGFKGMYRGLGPIILG  105

Query  439  LLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQT  618
             LP WAV+FT+Y + K F+ +  E        N  ++  AGA++++ATNP+WV+KTRL +
Sbjct  106  YLPTWAVWFTVYGRSKQFIGAHIESQ---FYVNFWSSVVAGASSSMATNPIWVIKTRLMS  162

Query  619  Q  621
            Q
Sbjct  163  Q  163



>ref|XP_009267688.1| Ribonucleoside-diphosphate reductase large chain [Wallemia ichthyophaga 
EXF-994]
 gb|EOR01426.1| Ribonucleoside-diphosphate reductase large chain [Wallemia ichthyophaga 
EXF-994]
Length=1242

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 7/134 (5%)
 Frame = +1

Query  271   FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
               CPLDVIKTR Q     K G+T + G  ++ ++++I   +G +G Y+GL PT+L  LP 
Sbjct  905   LTCPLDVIKTRLQAQKKSK-GHT-LDG--VIDTVKKISHEQGYKGYYKGLGPTILGYLPT  960

Query  451   WAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
             WA+YFT+Y+++K+ L S   +   +    +M+A+A AGA     TNPLWVVKTR  TQ  
Sbjct  961   WAIYFTVYDEVKAILSSKRGDPDGVDWSTHMIASASAGATGATLTNPLWVVKTRFMTQ--  1018

Query  628   RAGFVPYRGTLSAL  669
               G +PYR TL AL
Sbjct  1019  EKGTIPYRHTLHAL  1032



>emb|CEP60397.1| LALA0S01e09824g1_1 [Lachancea lanzarotensis]
Length=383

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 75/138 (54%), Gaps = 15/138 (11%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW  453
            VCPLDV KTR Q  GL         G  IVG+L  I + EG+RG+Y+GL P V+   P W
Sbjct  96   VCPLDVAKTRLQAQGLRPASIKYYNG--IVGTLSTIVRDEGVRGLYKGLVPIVMGYFPTW  153

Query  454  AVYFTIYEQLKS-----FLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQT  618
             +YFT+YE+ K      F  SD   H LS       A  AG+ +TI TNP+WVVKTRL  
Sbjct  154  MIYFTVYEKSKKRYPQIFGSSDFFSHSLS-------ALTAGSISTILTNPVWVVKTRLML  206

Query  619  Q-GMRAGFVPYRGTLSAL  669
            Q  +      YRGT  A 
Sbjct  207  QTHVDKNSTNYRGTFDAF  224



>emb|CCF32408.1| hypothetical protein CH063_04804 [Colletotrichum higginsianum]
Length=447

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 21/128 (16%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       ++G+   I++ EG+RGMYRG
Sbjct  97   TCPLDVIKTKLQAQGGFNPVEKGRHVGHPKLYNG------LLGTARVIWKDEGIRGMYRG  150

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWV  597
            L P VL  LP WAV+FT+Y + K +L     RHE ++  N  ++  AGA++TI TNP+WV
Sbjct  151  LGPIVLGYLPTWAVWFTVYNKSKDYL---KHRHENTVLINFWSSIIAGASSTIVTNPIWV  207

Query  598  VKTRLQTQ  621
            +KTRL +Q
Sbjct  208  IKTRLMSQ  215



>gb|EFQ32338.1| hypothetical protein GLRG_07482 [Colletotrichum graminicola M1.001]
Length=445

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 21/128 (16%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       ++G+   I++ EG+RGMYRG
Sbjct  95   TCPLDVIKTKLQAQGGFNPIEKGRHVGHPKLYNG------LLGTARVIWREEGIRGMYRG  148

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWV  597
            L P VL  LP WAV+FT+Y + K +L     RHE ++  N  ++  AGA++TI TNP+WV
Sbjct  149  LGPIVLGYLPTWAVWFTVYNKSKDWL---KHRHENTVLINFWSSIIAGASSTIVTNPIWV  205

Query  598  VKTRLQTQ  621
            +KTRL +Q
Sbjct  206  IKTRLMSQ  213



>gb|KJB06734.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=227

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            VYFT+YEQLK  LCS+D +H+LS+GANMLAA+GAGAATT  TNPLWVVKTRLQTQGMRAG
Sbjct  4    VYFTMYEQLKDCLCSNDGKHQLSVGANMLAASGAGAATTCFTNPLWVVKTRLQTQGMRAG  63

Query  637  FVPYRGTLSAL  669
             VPYRGT SAL
Sbjct  64   VVPYRGTFSAL  74


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 6/123 (5%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN  450
            F  PL V+KTR Q  G+ + G    RG+    +L +I   EG+RG+Y GL P  LA + +
Sbjct  44   FTNPLWVVKTRLQTQGM-RAGVVPYRGTF--SALRRIAHEEGIRGLYSGLVP-ALAGISH  99

Query  451  WAVYFTIYEQLKSFLCSDDER--HELSIganmlaaagagaattiatNPLWVVKTRLQTQG  624
             A+ F  YE++K +L + D     +L      +A++ +    +  T P  VV++RLQ QG
Sbjct  100  VAIQFPTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQG  159

Query  625  MRA  633
              +
Sbjct  160  HHS  162



>gb|KDN71827.1| hypothetical protein CSUB01_04228 [Colletotrichum sublineola]
Length=445

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 11/123 (9%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHGL-------PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV  432
             CPLDVIKT+ Q  G          +G+  I   L+ G+   I++ EG+RGMYRGL P V
Sbjct  95   TCPLDVIKTKLQAQGGFNPVEKGRHVGHPKIYNGLL-GTARVIWREEGIRGMYRGLGPIV  153

Query  433  LALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRL  612
            L  LP WAV+FT+Y + K +L     RHE ++  N  ++  AGA++TI TNP+WV+KTRL
Sbjct  154  LGYLPTWAVWFTVYNKSKDWL---KHRHENTMLINFWSSIIAGASSTIVTNPIWVIKTRL  210

Query  613  QTQ  621
             +Q
Sbjct  211  MSQ  213



>gb|KFA52148.1| hypothetical protein S40293_00468 [Stachybotrys chartarum IBT 
40293]
 gb|KFA74762.1| hypothetical protein S40288_06598 [Stachybotrys chartarum IBT 
40288]
Length=404

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 80/138 (58%), Gaps = 23/138 (17%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       +VG+ + I++ EGLRGMYRG
Sbjct  69   TCPLDVIKTKLQAQGGFTHVDMGRHAGHPKLYNG------LVGTAKVIWREEGLRGMYRG  122

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDER-HELSIganmlaaagagaattiatNPLW  594
            L P VL  LP WAV+FT+Y + K  L    E  H L++     +A  AGA++TI TNP+W
Sbjct  123  LGPIVLGYLPTWAVWFTVYNESKVRLAPHYENIHILNL----WSAIIAGASSTIVTNPIW  178

Query  595  VVKTRLQTQGMRAGFVPY  648
            V+KTRL +Q  ++   PY
Sbjct  179  VIKTRLMSQSNKSAKEPY  196



>gb|KEY72054.1| hypothetical protein S7711_00071 [Stachybotrys chartarum IBT 
7711]
Length=404

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 80/138 (58%), Gaps = 23/138 (17%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       +VG+ + I++ EGLRGMYRG
Sbjct  69   TCPLDVIKTKLQAQGGFTHVDMGRHAGHPKLYNG------LVGTAKVIWREEGLRGMYRG  122

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDER-HELSIganmlaaagagaattiatNPLW  594
            L P VL  LP WAV+FT+Y + K  L    E  H L++     +A  AGA++TI TNP+W
Sbjct  123  LGPIVLGYLPTWAVWFTVYNESKVRLAPHYENIHILNL----WSAIIAGASSTIVTNPIW  178

Query  595  VVKTRLQTQGMRAGFVPY  648
            V+KTRL +Q  ++   PY
Sbjct  179  VIKTRLMSQSNKSAKEPY  196



>ref|XP_005644233.1| mitochondrial carrier, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE19689.1| mitochondrial carrier, partial [Coccomyxa subellipsoidea C-169]
Length=315

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 94/145 (65%), Gaps = 16/145 (11%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHG-LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL  444
            TFVCPLDV+KTR QV   +P      ++ + I G L +I   EG++G+YRGL+PT+LALL
Sbjct  14   TFVCPLDVLKTRLQVQRRVP-----GVKYNGISGGLSKILAEEGVKGLYRGLTPTLLALL  68

Query  445  PNWAVYFTIYEQLKSFLCSDDERHELSI--ganmlaaagagaattiatNPLWVVKTRLQT  618
            PNWAVYFT+YE+LK  L +  + H        +M AA GAG AT + TNPLWVVKTRLQT
Sbjct  69   PNWAVYFTVYERLKISLGNRAQGHAFIKPPMVHMAAATGAGVATMLVTNPLWVVKTRLQT  128

Query  619  Q--GMRAGFVP------YRGTLSAL  669
            Q  G+R G         Y GT +AL
Sbjct  129  QHMGLRMGRASGGRAPLYTGTFNAL  153



>gb|ENH76893.1| mitochondrial carrier protein [Colletotrichum orbiculare MAFF 
240422]
Length=388

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 21/128 (16%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       ++G+   I++ EG+RGMYRG
Sbjct  38   TCPLDVIKTKLQAQGGFNPIAKGRHVGHPKLYNG------LLGTAGVIWKEEGIRGMYRG  91

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWV  597
            L P VL  LP WAV+FT+Y + K ++    +RH+ ++  N  ++  AGA++TI TNP+WV
Sbjct  92   LGPIVLGYLPTWAVWFTVYNKSKDWM---KQRHDNAVFINFWSSIVAGASSTIVTNPIWV  148

Query  598  VKTRLQTQ  621
            +KTRL +Q
Sbjct  149  IKTRLMSQ  156



>gb|EER43542.1| mitochondrial folate transporter/carrier [Histoplasma capsulatum 
H143]
 gb|EGC42068.1| mitochondrial folate transporter/carrier [Histoplasma capsulatum 
H88]
Length=420

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 9/125 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG---LPKLGNTNIRGSL---IVGSLEQIFQREGLRGMYRGLSPTVL  435
             CPLDVIKT+ Q  G   L + G     G+L   + G+ + I++ EG+RG+YRGL P +L
Sbjct  77   TCPLDVIKTKLQAQGGFQLRRNGKLIESGTLYRGMFGTGKMIWRDEGIRGLYRGLGPMLL  136

Query  436  ALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQ  615
              LP WAVY T+Y++ + + C   +   L+      A+  AG  +T+ATNP+WV+KTRL 
Sbjct  137  GYLPTWAVYLTVYDRSREYFCQKTDNWWLA---RAYASLTAGTCSTVATNPIWVIKTRLM  193

Query  616  TQGMR  630
            +QG R
Sbjct  194  SQGFR  198



>ref|XP_003061718.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
 gb|EEH54348.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
Length=381

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 75/134 (56%), Gaps = 28/134 (21%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T VCPLDV+KTR QV   P      +       SL  I + EG R +YRGL+PT++ALLP
Sbjct  76   TVVCPLDVLKTRLQV--TPGGSRAYVS---TYESLSHIVKNEGPRALYRGLTPTIVALLP  130

Query  448  NWAVYFTIYEQLKSFLC----------------SDDERHELSIganmlaaagagaattia  579
            NWAVYFT+YE LK  +                 S   RH L+        AGAGAAT + 
Sbjct  131  NWAVYFTVYEGLKGAMARAAGEGGGSERAGGERSRPLRHMLAA-------AGAGAATVLT  183

Query  580  tNPLWVVKTRLQTQ  621
            TNPLWVVKTRLQ Q
Sbjct  184  TNPLWVVKTRLQVQ  197



>gb|EEH08759.1| mitochondrial folate transporter/carrier [Histoplasma capsulatum 
G186AR]
Length=420

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 9/125 (7%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG---LPKLGNTNIRGSL---IVGSLEQIFQREGLRGMYRGLSPTVL  435
             CPLDVIKT+ Q  G   L + G     G+L   + G+ + I++ EG+RG+YRGL P +L
Sbjct  77   TCPLDVIKTKLQAQGGFQLRRNGKLIESGTLYRGMFGTGKTIWRDEGIRGLYRGLGPMLL  136

Query  436  ALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQ  615
              LP WAVY T+Y++ + + C   +   L+      A+  AG  +T+ATNP+WV+KTRL 
Sbjct  137  GYLPTWAVYLTVYDRSREYFCQKTDNWWLA---RAYASLTAGTCSTVATNPIWVIKTRLM  193

Query  616  TQGMR  630
            +QG R
Sbjct  194  SQGFR  198



>ref|XP_011398544.1| Mitochondrial nicotinamide adenine dinucleotide transporter 1 
[Auxenochlorella protothecoides]
 gb|KFM25648.1| Mitochondrial nicotinamide adenine dinucleotide transporter 1 
[Auxenochlorella protothecoides]
Length=263

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  268  TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            T VCPLDV+KTR QV G      +   G  I G L +I   EG+RG+YRGL+PT++ALLP
Sbjct  27   TVVCPLDVLKTRLQVQGRAAFVASPYGG--IGGGLSKIVAEEGVRGLYRGLAPTLVALLP  84

Query  448  NWAVYFTIYEQLK  486
            NWAVYFT YE+LK
Sbjct  85   NWAVYFTAYERLK  97



>ref|XP_007833533.1| hypothetical protein PFICI_06761 [Pestalotiopsis fici W106-1]
 gb|ETS81759.1| hypothetical protein PFICI_06761 [Pestalotiopsis fici W106-1]
Length=441

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG--LP-----KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV  432
             CPLDVIKT+ Q  G   P      +G+  +   LI G+   I++ EG+RGMYRGL P +
Sbjct  95   TCPLDVIKTKLQAQGGFTPVDKGRHVGHHKVYEGLI-GTARVIWREEGIRGMYRGLGPII  153

Query  433  LALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRL  612
            L  LP WAV+FT+Y   K FL   + +++L I  N  ++  AGA++T+ TNP+WV+KTRL
Sbjct  154  LGYLPTWAVWFTVYTNSKEFLAERNVQNQLLI--NFWSSIVAGASSTVVTNPIWVIKTRL  211

Query  613  QTQ  621
             +Q
Sbjct  212  MSQ  214



>gb|KFA61402.1| hypothetical protein S40285_03606 [Stachybotrys chlorohalonata 
IBT 40285]
Length=404

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 23/138 (17%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       +VG+ + I++ EG+RGMYRG
Sbjct  69   TCPLDVIKTKLQAQGGFTHVDMGRHAGHPKLYNG------LVGTAKVIWREEGIRGMYRG  122

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDER-HELSIganmlaaagagaattiatNPLW  594
            L P VL  LP WAV+FT+Y + K  L    E  H L++     +A  AGA++TI TNP+W
Sbjct  123  LGPIVLGYLPTWAVWFTVYNESKVRLAPHYENIHILNL----WSAIIAGASSTIVTNPIW  178

Query  595  VVKTRLQTQGMRAGFVPY  648
            V+KTRL +Q  ++   PY
Sbjct  179  VIKTRLMSQSNKSAKEPY  196



>emb|CCA74771.1| related to YIA6-Pvruvate transporter of the mitochondrial inner 
membrane [Piriformospora indica DSM 11827]
Length=322

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 83/143 (58%), Gaps = 22/143 (15%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDVIKT+ Q       G    RG  ++ +   +++++G+RG YRGL PT+L  LP WA
Sbjct  36   CPLDVIKTKLQAQEFAH-GTLGYRG--VIETTRYVYEKKGIRGFYRGLGPTILGYLPTWA  92

Query  457  VYFTIYEQLKSFLCSD---------------DERHELSIganmlaaagagaattiatNPL  591
            +YFT+Y+ +K++                   D+RH L++  ++ +A  AGA +T+ T+PL
Sbjct  93   IYFTVYDSVKAYFGEAALGGTRPVVDPDHALDKRHSLAL--HVFSAMSAGAVSTVCTSPL  150

Query  592  WVVKTRLQTQGMRAGFVPYRGTL  660
            WVVKTR+  Q +     PY+ TL
Sbjct  151  WVVKTRIMAQPLHEK--PYKHTL  171



>emb|CEP18167.1| hypothetical protein [Parasitella parasitica]
Length=275

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 10/125 (8%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q   +    N   RG++  G++ +I   EG+RG+YRGL PTV+  LP WA
Sbjct  36   CPLDVVKTRLQNQAIE---NFKYRGTM--GTIRRIRLEEGMRGLYRGLGPTVVGYLPTWA  90

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT+Y+  K      D  ++    A++ +A  AG  +T  T+P+WV+KTR  TQ MR+ 
Sbjct  91   IYFTVYDYCKINWAKGDIENDW--LAHISSAMTAGMVSTTLTSPVWVIKTRFMTQTMRS-  147

Query  637  FVPYR  651
              P+R
Sbjct  148  --PHR  150



>ref|XP_007281229.1| mitochondrial carrier protein [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA29720.1| mitochondrial carrier protein [Colletotrichum gloeosporioides 
Nara gc5]
Length=394

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 21/128 (16%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       ++G+   I++ EG+RGMYRG
Sbjct  47   TCPLDVIKTKLQAQGGFNPIAKGRHVGHPKLYNG------LLGTAGVIWREEGIRGMYRG  100

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWV  597
            L P VL  LP WAV+FT+Y + K ++    +RH+ ++  N  ++  AGA++TI TNP+WV
Sbjct  101  LGPIVLGYLPTWAVWFTVYNKSKDWM---KQRHDNAVFINFWSSIIAGASSTIVTNPIWV  157

Query  598  VKTRLQTQ  621
            +KTRL +Q
Sbjct  158  IKTRLMSQ  165



>gb|KDE08552.1| hypothetical protein MVLG_01329 [Microbotryum violaceum p1A1 
Lamole]
Length=325

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 75/131 (57%), Gaps = 8/131 (6%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDVIKTR Q  G      T  RG  ++G+   I    G RG YRGL PT++  LP WA
Sbjct  38   CPLDVIKTRLQASG----ATTAPRG--LIGTCVHIASTAGFRGFYRGLGPTIIGYLPTWA  91

Query  457  VYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQGMRAG  636
            +YFT+Y+++KS +     R      ++++AA  AGA  TI TNPLWVVKTR  TQ     
Sbjct  92   IYFTVYDKIKSTM--GRSRGNDDPISHIVAAMVAGATGTIVTNPLWVVKTRFMTQTTGPN  149

Query  637  FVPYRGTLSAL  669
              PY  T  A+
Sbjct  150  EPPYSHTWDAI  160



>ref|XP_003050900.1| hypothetical protein NECHADRAFT_40983 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU45187.1| hypothetical protein NECHADRAFT_40983 [Nectria haematococca mpVI 
77-13-4]
Length=399

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 23/129 (18%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG------------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRG  417
             CPLDVIKT+ Q  G             PKL N       ++GS + I++ EG+RG+YRG
Sbjct  71   TCPLDVIKTKLQAQGGYAALNRGRHVGHPKLYNG------LIGSAKVIWREEGIRGLYRG  124

Query  418  LSPTVLALLPNWAVYFTIYEQLKSFLCSD-DERHELSIganmlaaagagaattiatNPLW  594
            L P V+  LP WAVYFT+Y + K +L    D  H +++     ++  AGA++TI TNP+W
Sbjct  125  LGPIVMGYLPTWAVYFTVYNKSKGWLSQHYDNSHLINL----WSSITAGASSTIVTNPIW  180

Query  595  VVKTRLQTQ  621
            V+KTRL +Q
Sbjct  181  VIKTRLMSQ  189



>ref|XP_001384546.2| mitochondrial carrier protein [Scheffersomyces stipitis CBS 6054]
 gb|ABN66517.2| mitochondrial carrier protein [Scheffersomyces stipitis CBS 6054]
Length=375

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 69/128 (54%), Gaps = 19/128 (15%)
 Frame = +1

Query  274  VCPLDVIKTRFQVHG--LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            VCPLDV+KTR Q  G  L    NT I+    +G+ + I + EG+RG+YRGL P  +  LP
Sbjct  75   VCPLDVVKTRLQAQGAMLRSDSNTTIKYKGFLGAFKTIVREEGIRGLYRGLVPITIGYLP  134

Query  448  NWAVYFTIYEQLKSFLCS----------DDERHELSIganmlaaagagaattiatNPLWV  597
             W +YFT+YE+ K    S          D   H LS       A  AG  ++ A NP+WV
Sbjct  135  TWTIYFTVYERTKQLYPSILHQYLGIERDSATHFLS-------ALTAGITSSCAVNPIWV  187

Query  598  VKTRLQTQ  621
            VKTRL  Q
Sbjct  188  VKTRLMIQ  195



>gb|ESA08977.1| hypothetical protein GLOINDRAFT_81209 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX55361.1| Yia6p [Rhizophagus irregularis DAOM 197198w]
Length=304

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 8/134 (6%)
 Frame = +1

Query  277  CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA  456
            CPLDV+KTR Q  G  K   +    S   G+L++I+  EG+RG+YRGL PT+   LP WA
Sbjct  35   CPLDVVKTRLQNQG--KFDQSVPLYSGTGGTLKRIWVEEGIRGLYRGLGPTLYGYLPTWA  92

Query  457  VYFTIYEQLKSFLCSDDER---HELSIganmlaaagagaattiatNPLWVVKTRLQTQGM  627
            +YF+ Y+  K+   +   R   H+  +  ++ AA GAGA +TI TNPLWV+KTR  TQ  
Sbjct  93   IYFSAYDYFKAAFGAHAGRTGNHQWVV--HIFAAMGAGATSTIVTNPLWVIKTRFMTQNE  150

Query  628  RAGFVPYRGTLSAL  669
            R  ++ Y+ TL A 
Sbjct  151  RTSYM-YKNTLDAF  163


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 14/118 (12%)
 Frame = +1

Query  280  PLDVIKTRFQVHGLPKLGNTNIRGSLI----VGSLEQIFQREGLRGMYRGLSPTVLALLP  447
            PL VIKTRF           N R S +    + + + I+  EG RG Y+GL P+++  + 
Sbjct  137  PLWVIKTRFMTQ--------NERTSYMYKNTLDAFKTIYSTEGFRGFYKGLGPSLMG-VS  187

Query  448  NWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQTQ  621
            + AV F +YE+LK  L   D+ H LS  + + A++ +  A ++AT P  VV+TRLQ Q
Sbjct  188  HVAVQFPLYEKLKVRLKQPDQDH-LSNLSILFASSVSKMAASVATYPHEVVRTRLQNQ  244



>ref|XP_007738192.1| hypothetical protein A1O3_09911 [Capronia epimyces CBS 606.96]
 gb|EXJ77682.1| hypothetical protein A1O3_09911 [Capronia epimyces CBS 606.96]
Length=345

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 7/125 (6%)
 Frame = +1

Query  271  FVCPLDVIKTRFQVHG----LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA  438
              CPLDVIKT+ Q  G       + +TN     IVG+   I++ EG+RGMYRGL P +L 
Sbjct  41   ITCPLDVIKTKLQAQGGFVSKKSMSHTNHLYKGIVGTTRVIWREEGIRGMYRGLGPMLLG  100

Query  439  LLPNWAVYFTIYEQLKSFLCSDDERHELSIganmlaaagagaattiatNPLWVVKTRLQT  618
             LP WAVY T+YE+ + F     +R      A   ++  AGA +TI TNP+WV+KTRL +
Sbjct  101  YLPTWAVYLTVYEKTREFYY---DRCGSWWVARCYSSLTAGACSTILTNPIWVIKTRLMS  157

Query  619  QGMRA  633
            Q  +A
Sbjct  158  QSTKA  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780