BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021H11

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361548.1|  PREDICTED: cullin-4-like                           256   4e-76   Solanum tuberosum [potatoes]
ref|XP_011096567.1|  PREDICTED: cullin-4-like                           254   4e-75   Sesamum indicum [beniseed]
ref|NP_001234356.1|  cullin 4                                           246   1e-72   
gb|KJB66936.1|  hypothetical protein B456_010G166800                    246   2e-72   Gossypium raimondii
gb|KJB66935.1|  hypothetical protein B456_010G166800                    246   3e-72   Gossypium raimondii
ref|XP_011085242.1|  PREDICTED: cullin-4                                244   1e-71   
ref|XP_007025065.1|  Cullin-4B isoform 2                                239   5e-71   
ref|XP_007025064.1|  Cullin-4B isoform 1                                241   3e-70   
ref|XP_009759464.1|  PREDICTED: cullin-4                                239   1e-69   Nicotiana sylvestris
ref|XP_009599227.1|  PREDICTED: cullin-4                                236   8e-69   Nicotiana tomentosiformis
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg                235   3e-68   Erythranthe guttata [common monkey flower]
gb|KJB69828.1|  hypothetical protein B456_011G044900                    232   2e-67   Gossypium raimondii
gb|KJB69827.1|  hypothetical protein B456_011G044900                    232   2e-67   Gossypium raimondii
ref|XP_009360892.1|  PREDICTED: cullin-4                                232   4e-67   Pyrus x bretschneideri [bai li]
gb|KHG10035.1|  Cullin-4 -like protein                                  231   8e-67   Gossypium arboreum [tree cotton]
gb|KHG21020.1|  Cullin-4 -like protein                                  229   3e-66   Gossypium arboreum [tree cotton]
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg             229   4e-66   Prunus persica
ref|XP_008225565.1|  PREDICTED: cullin-4                                229   5e-66   Prunus mume [ume]
ref|XP_008349190.1|  PREDICTED: cullin-4-like                           223   3e-65   
gb|KJB68315.1|  hypothetical protein B456_010G238300                    225   3e-65   Gossypium raimondii
gb|KGN65538.1|  hypothetical protein Csa_1G435830                       214   3e-65   Cucumis sativus [cucumbers]
gb|KJB68319.1|  hypothetical protein B456_010G238300                    225   5e-65   Gossypium raimondii
gb|KJB68318.1|  hypothetical protein B456_010G238300                    225   6e-65   Gossypium raimondii
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg             223   4e-64   Citrus clementina [clementine]
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                   223   4e-64   Citrus sinensis [apfelsine]
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                   223   5e-64   Citrus sinensis [apfelsine]
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1                223   5e-64   Citrus sinensis [apfelsine]
ref|XP_006449703.1|  hypothetical protein CICLE_v10014310mg             223   5e-64   
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2                223   6e-64   
gb|KDO78192.1|  hypothetical protein CISIN_1g003648mg                   222   7e-64   Citrus sinensis [apfelsine]
gb|AAL27655.2|  putative cullin protein                                 219   1e-62   Olea europaea
gb|KDP37982.1|  hypothetical protein JCGZ_04625                         219   2e-62   Jatropha curcas
ref|XP_008371761.1|  PREDICTED: cullin-4                                218   4e-62   
ref|XP_011011309.1|  PREDICTED: cullin-4-like isoform X2                216   6e-62   Populus euphratica
ref|XP_006352972.1|  PREDICTED: cullin-4-like                           217   6e-62   Solanum tuberosum [potatoes]
ref|XP_011013417.1|  PREDICTED: cullin-4-like                           216   1e-61   Populus euphratica
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1                216   2e-61   Populus euphratica
ref|XP_002270764.2|  PREDICTED: cullin-4                                216   2e-61   Vitis vinifera
ref|XP_004162809.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      216   2e-61   
gb|EPS64061.1|  cullin 4                                                215   2e-61   Genlisea aurea
ref|XP_004149667.1|  PREDICTED: cullin-4-like                           216   2e-61   Cucumis sativus [cucumbers]
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g             215   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006377605.1|  hypothetical protein POPTR_0011s08280g             213   2e-60   
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g             213   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008444359.1|  PREDICTED: cullin-4                                213   2e-60   Cucumis melo [Oriental melon]
ref|XP_002519675.1|  cullin, putative                                   212   5e-60   
gb|KCW73810.1|  hypothetical protein EUGRSUZ_E02414                     210   2e-59   Eucalyptus grandis [rose gum]
gb|KCW73811.1|  hypothetical protein EUGRSUZ_E02414                     210   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010056896.1|  PREDICTED: cullin-4                                210   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010247871.1|  PREDICTED: cullin-4-like isoform X2                209   3e-59   Nelumbo nucifera [Indian lotus]
emb|CAN75926.1|  hypothetical protein VITISV_010491                     209   4e-59   Vitis vinifera
emb|CBI30911.3|  unnamed protein product                                209   4e-59   Vitis vinifera
ref|XP_010247870.1|  PREDICTED: cullin-4-like isoform X1                209   5e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010274939.1|  PREDICTED: cullin-4-like                           207   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008787804.1|  PREDICTED: cullin-4-like isoform X2                207   3e-58   Phoenix dactylifera
ref|XP_010110959.1|  hypothetical protein L484_021653                   207   4e-58   
gb|KHN06973.1|  Cullin-4                                                206   4e-58   Glycine soja [wild soybean]
ref|XP_008787803.1|  PREDICTED: cullin-4-like isoform X1                207   4e-58   Phoenix dactylifera
ref|XP_009408525.1|  PREDICTED: cullin-4-like                           206   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398338.1|  PREDICTED: cullin-4-like                           204   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010666663.1|  PREDICTED: cullin-4                                203   9e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010941311.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      202   2e-56   Elaeis guineensis
ref|XP_004233125.1|  PREDICTED: cullin-4                                201   4e-56   Solanum lycopersicum
ref|XP_010923713.1|  PREDICTED: cullin-4-like isoform X2                200   7e-56   Elaeis guineensis
ref|XP_010923712.1|  PREDICTED: cullin-4-like isoform X1                200   8e-56   Elaeis guineensis
gb|KHN47328.1|  Cullin-4                                                199   2e-55   Glycine soja [wild soybean]
ref|XP_003546083.1|  PREDICTED: cullin-4-like                           196   2e-54   Glycine max [soybeans]
ref|XP_007147910.1|  hypothetical protein PHAVU_006G165300g             191   1e-52   Phaseolus vulgaris [French bean]
ref|XP_008809585.1|  PREDICTED: cullin-4-like                           191   2e-52   
ref|XP_003593913.1|  Cullin                                             190   3e-52   
ref|XP_003593912.1|  Cullin                                             189   4e-52   Medicago truncatula
ref|XP_003593911.1|  Cullin                                             189   4e-52   
ref|XP_003524860.1|  PREDICTED: cullin-4-like                           187   2e-51   Glycine max [soybeans]
ref|XP_009101534.1|  PREDICTED: cullin-4-like                           187   4e-51   Brassica rapa
ref|XP_008383554.1|  PREDICTED: cullin-4-like                           182   1e-50   
ref|XP_006398310.1|  hypothetical protein EUTSA_v10000782mg             181   5e-50   
ref|XP_006398309.1|  hypothetical protein EUTSA_v10000782mg             182   6e-50   
ref|XP_006585082.1|  PREDICTED: cullin-4-like isoform X2                183   7e-50   Glycine max [soybeans]
ref|XP_003532695.2|  PREDICTED: cullin-4-like isoform X1                183   7e-50   Glycine max [soybeans]
emb|CDX77644.1|  BnaC07g18980D                                          182   1e-49   
ref|XP_006398308.1|  hypothetical protein EUTSA_v10000782mg             182   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_004486019.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      181   4e-49   Cicer arietinum [garbanzo]
gb|KHN12460.1|  Cullin-4                                                180   8e-49   Glycine soja [wild soybean]
ref|XP_002863417.1|  hypothetical protein ARALYDRAFT_916814             180   1e-48   Arabidopsis lyrata subsp. lyrata
emb|CDY43957.1|  BnaA02g24350D                                          180   1e-48   Brassica napus [oilseed rape]
ref|XP_006414121.1|  hypothetical protein EUTSA_v10024458mg             179   1e-48   Eutrema salsugineum [saltwater cress]
emb|CDY35152.1|  BnaA09g17890D                                          179   1e-48   Brassica napus [oilseed rape]
ref|NP_568658.1|  cullin4                                               179   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981510.1|  PREDICTED: cullin-4-like isoform X2                179   3e-48   Setaria italica
ref|XP_004981509.1|  PREDICTED: cullin-4-like isoform X1                179   4e-48   
emb|CDY33461.1|  BnaA06g36120D                                          177   6e-48   Brassica napus [oilseed rape]
ref|XP_006836434.1|  hypothetical protein AMTR_s00092p00163840          178   7e-48   Amborella trichopoda
gb|KHN46079.1|  Cullin-4                                                177   1e-47   Glycine soja [wild soybean]
gb|AAM14063.1|  putative cullin                                         177   1e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87735.1|  BnaC02g32140D                                          176   2e-47   
ref|XP_009114369.1|  PREDICTED: cullin-4-like                           176   2e-47   Brassica rapa
ref|XP_010495750.1|  PREDICTED: cullin-4-like                           176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010484784.1|  PREDICTED: cullin-4-like                           175   4e-47   Camelina sativa [gold-of-pleasure]
gb|KFK31486.1|  cullin                                                  175   5e-47   Arabis alpina [alpine rockcress]
emb|CDY03235.1|  BnaC09g19210D                                          175   7e-47   
ref|XP_010529158.1|  PREDICTED: cullin-4                                174   8e-47   Tarenaya hassleriana [spider flower]
gb|KHN29857.1|  Cullin-4                                                166   2e-46   Glycine soja [wild soybean]
ref|XP_010441611.1|  PREDICTED: cullin-4                                174   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006281916.1|  hypothetical protein CARUB_v10028121mg             173   4e-46   Capsella rubella
gb|KFK28509.1|  cullin 4                                                171   1e-45   Arabis alpina [alpine rockcress]
ref|XP_009128848.1|  PREDICTED: cullin-4                                170   3e-45   Brassica rapa
emb|CAC85265.1|  cullin 4                                               169   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb|EMT18857.1|  Cullin-4B                                               169   7e-45   
ref|XP_006650698.1|  PREDICTED: cullin-4-like                           169   1e-44   Oryza brachyantha
dbj|BAK02870.1|  predicted protein                                      167   5e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558082.1|  PREDICTED: cullin-4                                167   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_002466340.1|  hypothetical protein SORBIDRAFT_01g005920          166   2e-43   Sorghum bicolor [broomcorn]
tpg|DAA51790.1|  TPA: hypothetical protein ZEAMMB73_453479              164   2e-43   
ref|XP_011460204.1|  PREDICTED: cullin-4                                163   1e-42   Fragaria vesca subsp. vesca
gb|EEE60060.1|  hypothetical protein OsJ_12866                          162   2e-42   Oryza sativa Japonica Group [Japonica rice]
gb|AAT75245.1|  putative cullin protein                                 162   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99238.1|  Cullin-4B, putative, expressed                          161   8e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644442.1|  PREDICTED: cullin-4                                159   4e-41   Zea mays [maize]
gb|ACA52121.1|  cullin 4                                                145   1e-39   Vitis vinifera
ref|XP_001764780.1|  predicted protein                                  153   4e-39   
ref|XP_010518764.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      152   8e-39   Tarenaya hassleriana [spider flower]
ref|XP_002984123.1|  ubiquitin-protein ligase, cullin 4                 149   9e-38   
ref|XP_002972211.1|  ubiquitin-protein ligase, Cullin 4                 149   1e-37   
tpg|DAA51791.1|  TPA: hypothetical protein ZEAMMB73_453479              147   2e-37   
ref|XP_001776334.1|  predicted protein                                  140   2e-34   
gb|KHG11994.1|  Cullin-4 -like protein                                  132   3e-32   Gossypium arboreum [tree cotton]
ref|XP_005825979.1|  hypothetical protein GUITHDRAFT_160035             106   1e-22   Guillardia theta CCMP2712
gb|EEC76292.1|  hypothetical protein OsI_13805                          105   3e-22   Oryza sativa Indica Group [Indian rice]
emb|CBJ49182.1|  conserved unknown protein                              100   2e-20   Ectocarpus siliculosus
gb|KIZ03018.1|  cullin 4                                              94.7    3e-19   Monoraphidium neglectum
ref|XP_005644988.1|  Cullin-domain-containing protein                 96.3    4e-19   Coccomyxa subellipsoidea C-169
gb|KJB66937.1|  hypothetical protein B456_010G166800                  95.1    1e-18   Gossypium raimondii
ref|XP_002947918.1|  hypothetical protein VOLCADRAFT_57881            92.4    9e-18   Volvox carteri f. nagariensis
ref|XP_001703219.1|  cullin                                           92.4    9e-18   Chlamydomonas reinhardtii
ref|XP_006449701.1|  hypothetical protein CICLE_v10014310mg           91.7    1e-17   
gb|KDO78193.1|  hypothetical protein CISIN_1g003648mg                 91.7    1e-17   Citrus sinensis [apfelsine]
ref|XP_002504743.1|  predicted protein                                89.0    1e-16   Micromonas commoda
ref|XP_006823839.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like   89.0    1e-16   Saccoglossus kowalevskii
ref|XP_004349795.2|  Cullin 4                                         88.6    2e-16   Capsaspora owczarzaki ATCC 30864
gb|KJE89856.1|  Cullin 4                                              88.6    2e-16   Capsaspora owczarzaki ATCC 30864
ref|XP_006598170.1|  PREDICTED: cullin-4-like                         82.8    2e-16   
ref|XP_003729103.1|  PREDICTED: cullin-4A-like                        88.2    2e-16   
ref|XP_008171287.1|  PREDICTED: cullin-4B isoform X2                  87.0    5e-16   Chrysemys picta bellii
ref|XP_010139394.1|  PREDICTED: cullin-4B                             86.7    8e-16   Buceros rhinoceros silvestris
ref|XP_009899852.1|  PREDICTED: cullin-4B                             86.7    8e-16   Picoides pubescens
ref|XP_009073198.1|  PREDICTED: cullin-4B                             86.7    9e-16   Acanthisitta chloris
ref|XP_010287736.1|  PREDICTED: cullin-4B                             86.7    9e-16   Phaethon lepturus
ref|XP_003208504.1|  PREDICTED: cullin-4B                             86.7    9e-16   Meleagris gallopavo [common turkey]
ref|XP_010162624.1|  PREDICTED: cullin-4B                             86.7    9e-16   Antrostomus carolinensis
ref|XP_005022179.1|  PREDICTED: cullin-4B                             86.7    9e-16   
ref|XP_009968477.1|  PREDICTED: cullin-4B                             86.7    9e-16   Tyto alba [Schleiereule]
ref|XP_010020149.1|  PREDICTED: cullin-4B                             86.7    9e-16   Nestor notabilis
ref|XP_009915406.1|  PREDICTED: cullin-4B isoform X1                  86.7    9e-16   Haliaeetus albicilla
ref|XP_009887578.1|  PREDICTED: cullin-4B                             86.7    9e-16   Charadrius vociferus
ref|XP_009871272.1|  PREDICTED: cullin-4B                             86.7    9e-16   Apaloderma vittatum
ref|XP_009578947.1|  PREDICTED: cullin-4B                             86.7    9e-16   Fulmarus glacialis
ref|XP_009487693.1|  PREDICTED: cullin-4B                             86.7    9e-16   Pelecanus crispus
ref|XP_009273579.1|  PREDICTED: cullin-4B                             86.7    9e-16   Aptenodytes forsteri
ref|XP_005432498.1|  PREDICTED: cullin-4B                             86.7    9e-16   Falco cherrug
ref|XP_005148357.1|  PREDICTED: cullin-4B                             86.7    9e-16   
ref|XP_009943501.1|  PREDICTED: cullin-4B                             86.7    9e-16   Opisthocomus hoazin [hoatzin]
ref|XP_005045907.1|  PREDICTED: cullin-4B                             86.7    9e-16   Ficedula albicollis
ref|XP_005504485.1|  PREDICTED: cullin-4B                             86.7    1e-15   Columba livia [carrier pigeon]
ref|XP_008638702.1|  PREDICTED: cullin-4B                             86.3    1e-15   Corvus brachyrhynchos
ref|XP_009670270.1|  PREDICTED: cullin-4B                             86.3    1e-15   Struthio camelus australis
ref|XP_008491853.1|  PREDICTED: cullin-4B                             86.3    1e-15   Calypte anna
ref|XP_006260081.1|  PREDICTED: cullin-4B                             86.3    1e-15   
ref|XP_006028559.1|  PREDICTED: cullin-4B                             86.3    1e-15   Alligator sinensis
ref|XP_010150094.1|  PREDICTED: cullin-4B                             86.3    1e-15   Eurypyga helias
ref|XP_009088610.1|  PREDICTED: cullin-4B                             86.3    1e-15   Serinus canaria [canary]
ref|XP_009981623.1|  PREDICTED: cullin-4B                             86.3    1e-15   Tauraco erythrolophus
ref|XP_009564621.1|  PREDICTED: cullin-4B                             86.3    1e-15   Cuculus canorus
ref|XP_007060188.1|  PREDICTED: cullin-4B                             86.3    1e-15   Chelonia mydas [green seaturtle]
ref|XP_007436244.1|  PREDICTED: cullin-4B                             86.3    1e-15   Python bivittatus
ref|XP_005484500.1|  PREDICTED: cullin-4B                             86.3    1e-15   Zonotrichia albicollis
ref|XP_005241130.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        86.3    1e-15   Falco peregrinus [peregrine]
ref|XP_010206238.1|  PREDICTED: cullin-4B                             86.3    1e-15   Colius striatus
ref|XP_002196531.1|  PREDICTED: cullin-4B                             86.3    1e-15   Taeniopygia guttata
ref|XP_005307468.2|  PREDICTED: cullin-4B isoform X1                  86.3    1e-15   Chrysemys picta bellii
ref|XP_006115461.1|  PREDICTED: cullin-4B                             86.3    1e-15   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010210224.1|  PREDICTED: cullin-4B                             85.9    1e-15   Tinamus guttatus
gb|ESA04652.1|  hypothetical protein GLOINDRAFT_85233                 85.1    3e-15   
ref|XP_004545810.1|  PREDICTED: cullin-4B-like                        84.7    3e-15   
ref|XP_003445252.1|  PREDICTED: cullin-4B                             84.7    3e-15   Oreochromis niloticus
ref|XP_005913219.1|  PREDICTED: cullin-4B-like                        84.7    3e-15   Haplochromis burtoni
ref|XP_009506519.1|  PREDICTED: cullin-4B                             84.7    3e-15   Phalacrocorax carbo [common cormorant]
ref|XP_011478226.1|  PREDICTED: cullin-4B                             84.7    4e-15   Oryzias latipes [Japanese rice fish]
ref|XP_008935860.1|  PREDICTED: cullin-4B                             84.7    4e-15   Merops nubicus
ref|XP_006803308.1|  PREDICTED: cullin-4B-like                        84.3    4e-15   Neolamprologus brichardi [lyretail cichlid]
dbj|BAB64445.1|  hypothetical protein                                 81.6    5e-15   Macaca fascicularis [crab eating macaque]
ref|XP_003800032.1|  PREDICTED: cullin-4A                             84.0    6e-15   Otolemur garnettii
ref|XP_010764721.1|  PREDICTED: cullin-4B                             84.0    6e-15   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003229259.1|  PREDICTED: cullin-4B                             84.0    7e-15   
ref|XP_010730305.1|  PREDICTED: cullin-4B                             84.0    7e-15   
ref|XP_003970600.1|  PREDICTED: cullin-4B-like                        84.0    7e-15   Takifugu rubripes [tiger puffer]
ref|XP_005799582.1|  PREDICTED: cullin-4B-like                        83.6    8e-15   Xiphophorus maculatus
dbj|BAC41443.3|  mKIAA0695 protein                                    83.6    8e-15   Mus musculus [mouse]
ref|XP_420335.2|  PREDICTED: cullin-4B                                83.6    8e-15   Gallus gallus [bantam]
ref|XP_008418856.1|  PREDICTED: cullin-4B                             83.6    8e-15   Poecilia reticulata
ref|XP_007569758.1|  PREDICTED: cullin-4B                             83.6    8e-15   Poecilia formosa
ref|XP_008274104.1|  PREDICTED: cullin-4B                             83.6    9e-15   Stegastes partitus
ref|XP_010073509.1|  PREDICTED: cullin-4B                             83.6    9e-15   Pterocles gutturalis
ref|XP_006877535.1|  PREDICTED: cullin-4B isoform X2                  82.8    1e-14   Chrysochloris asiatica
ref|XP_004713104.1|  PREDICTED: cullin-4B isoform X1                  83.2    1e-14   
ref|XP_004713106.1|  PREDICTED: cullin-4B isoform X3                  82.8    1e-14   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004713105.1|  PREDICTED: cullin-4B isoform X2                  83.2    1e-14   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009556241.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        82.8    1e-14   Cuculus canorus
ref|XP_004379638.1|  PREDICTED: cullin-4B isoform 2                   82.8    1e-14   Trichechus manatus latirostris
ref|XP_008154342.1|  PREDICTED: cullin-4B isoform X2                  82.4    2e-14   Eptesicus fuscus
ref|XP_007254497.1|  PREDICTED: cullin-4B-like                        82.8    2e-14   
ref|XP_006632966.1|  PREDICTED: cullin-4B-like                        82.8    2e-14   
ref|XP_007891612.1|  PREDICTED: cullin-4B                             82.4    2e-14   Callorhinchus milii [Australian ghost shark]
ref|XP_003131149.1|  PREDICTED: cullin-4A                             82.4    2e-14   Sus scrofa [pigs]
ref|XP_006003900.1|  PREDICTED: cullin-4B                             82.4    2e-14   Latimeria chalumnae
ref|XP_006885131.1|  PREDICTED: cullin-4B-like isoform X2             82.0    2e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAB28222.2|  unnamed protein product                              82.4    2e-14   Mus musculus [mouse]
ref|XP_005687851.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        82.0    2e-14   
ref|XP_001656862.1|  AAEL003466-PB                                    82.0    2e-14   Aedes aegypti
ref|XP_010981119.1|  PREDICTED: cullin-4A                             82.0    2e-14   Camelus dromedarius [camel]
ref|XP_007530425.1|  PREDICTED: cullin-4B isoform X2                  82.0    2e-14   Erinaceus europaeus [common hedgehog]
ref|XP_005438905.1|  PREDICTED: cullin-4A                             82.0    2e-14   
pdb|4A0C|C  Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex        82.0    2e-14   Mus musculus [mouse]
ref|NP_001120891.1|  cullin 4B                                        82.0    2e-14   Xenopus tropicalis [western clawed frog]
pdb|4A0L|E  Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A...  82.0    2e-14   Homo sapiens [man]
ref|XP_006076682.1|  PREDICTED: cullin-4A                             82.0    2e-14   
dbj|BAE36141.1|  unnamed protein product                              82.4    2e-14   Mus musculus [mouse]
ref|NP_001116316.1|  cullin-4B                                        82.0    2e-14   Danio rerio [leopard danio]
ref|XP_001510185.3|  PREDICTED: cullin-4B                             82.0    3e-14   
ref|XP_005969110.1|  PREDICTED: cullin-4A                             82.0    3e-14   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008324704.1|  PREDICTED: cullin-4B                             82.0    3e-14   
ref|XP_005998125.1|  PREDICTED: cullin-4A                             82.0    3e-14   
dbj|BAC27992.1|  unnamed protein product                              82.0    3e-14   Mus musculus [mouse]
gb|EWM25493.1|  ubiquitin-protein cullin 4                            82.0    3e-14   Nannochloropsis gaditana
ref|XP_006218259.1|  PREDICTED: cullin-4A                             82.0    3e-14   
ref|NP_001103612.1|  cullin-4B                                        82.0    3e-14   Mus musculus [mouse]
ref|XP_009196472.1|  PREDICTED: cullin-4B isoform X5                  81.6    3e-14   Papio anubis [baboon]
ref|XP_010950632.1|  PREDICTED: cullin-4A                             81.6    3e-14   Camelus bactrianus [camel]
ref|XP_004022403.1|  PREDICTED: cullin-4B isoform 2                   81.6    3e-14   
ref|XP_005319407.1|  PREDICTED: cullin-4B isoform X2                  81.6    3e-14   
ref|XP_004685824.1|  PREDICTED: cullin-4B isoform X2                  81.6    3e-14   
gb|EAX11877.1|  cullin 4B, isoform CRA_b                              81.6    3e-14   Homo sapiens [man]
ref|XP_004285635.1|  PREDICTED: cullin-4B isoform 2                   81.6    3e-14   Orcinus orca [Orca]
ref|XP_008988097.1|  PREDICTED: cullin-4B isoform X5                  81.6    3e-14   Callithrix jacchus [common marmoset]
ref|XP_004012417.1|  PREDICTED: cullin-4A                             81.6    3e-14   
gb|EGW01006.1|  Cullin-4B                                             81.6    4e-14   Cricetulus griseus [Chinese hamsters]
gb|KFW86599.1|  Cullin-4B                                             81.6    4e-14   Manacus vitellinus
ref|XP_006883869.1|  PREDICTED: cullin-4A                             81.3    4e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010829841.1|  PREDICTED: cullin-4A                             81.3    4e-14   Bison bison bison
tpg|DAA23688.1|  TPA: cullin 4A                                       81.3    4e-14   Bos taurus [bovine]
ref|XP_875362.3|  PREDICTED: cullin-4A                                81.3    4e-14   
ref|XP_010894682.1|  PREDICTED: cullin-4B isoform X3                  81.3    5e-14   
ref|XP_008271384.1|  PREDICTED: cullin-4B isoform X5                  81.3    5e-14   Oryctolagus cuniculus [domestic rabbit]
ref|XP_010819678.1|  PREDICTED: cullin-4B isoform X5                  81.3    5e-14   
ref|XP_007647173.1|  PREDICTED: cullin-4B isoform X1                  81.3    5e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_011376545.1|  PREDICTED: cullin-4B isoform X2                  81.3    5e-14   
gb|KGL96725.1|  Cullin-4B                                             81.3    5e-14   Charadrius vociferus
ref|XP_006191373.1|  PREDICTED: cullin-4B-like isoform X2             81.3    5e-14   Camelus ferus
dbj|BAA31670.2|  KIAA0695 protein                                     81.3    5e-14   Homo sapiens [man]
ref|XP_005767862.1|  hypothetical protein EMIHUDRAFT_427672           80.9    5e-14   Emiliania huxleyi CCMP1516
ref|XP_006191372.1|  PREDICTED: cullin-4B-like isoform X1             81.3    5e-14   Camelus ferus
ref|NP_001041617.1|  cullin-4B                                        81.3    5e-14   Felis catus [cat]
ref|XP_007610124.1|  PREDICTED: cullin-4B isoform X2                  81.3    5e-14   
ref|XP_003774810.1|  PREDICTED: cullin-4B                             81.3    5e-14   Sarcophilus harrisii
gb|KFQ77299.1|  Cullin-4B                                             80.9    6e-14   Phaethon lepturus
ref|XP_006981626.1|  PREDICTED: cullin-4B isoform X2                  80.9    6e-14   
gb|KFQ02433.1|  Cullin-4B                                             80.9    6e-14   Haliaeetus albicilla
ref|XP_005413716.1|  PREDICTED: cullin-4B isoform X4                  80.9    6e-14   Chinchilla lanigera
gb|KFV93759.1|  Cullin-4B                                             80.9    6e-14   Fulmarus glacialis
gb|KFP90614.1|  Cullin-4B                                             80.9    6e-14   Apaloderma vittatum
gb|KFP57528.1|  Cullin-4B                                             80.9    6e-14   Cathartes aura
gb|KFM04851.1|  Cullin-4B                                             80.9    6e-14   Aptenodytes forsteri
gb|KFR04226.1|  Cullin-4B                                             80.9    6e-14   Opisthocomus hoazin [hoatzin]
ref|XP_004379637.1|  PREDICTED: cullin-4B isoform 1                   80.9    6e-14   
ref|XP_006981625.1|  PREDICTED: cullin-4B isoform X1                  80.9    6e-14   
gb|KFO92809.1|  Cullin-4B                                             80.9    6e-14   Buceros rhinoceros silvestris
ref|XP_006877534.1|  PREDICTED: cullin-4B isoform X1                  80.9    6e-14   Chrysochloris asiatica
gb|KFZ46418.1|  Cullin-4B                                             80.9    6e-14   Antrostomus carolinensis
gb|KFQ89647.1|  Cullin-4B                                             80.9    6e-14   Phoenicopterus ruber ruber
gb|KFQ56289.1|  Cullin-4B                                             80.9    6e-14   Nestor notabilis
gb|KFP38487.1|  Cullin-4B                                             80.9    6e-14   
gb|KFO06527.1|  Cullin-4B                                             80.9    6e-14   
ref|XP_007951543.1|  PREDICTED: cullin-4B                             80.9    7e-14   
gb|KFZ62825.1|  Cullin-4B                                             80.9    7e-14   
gb|KFV04835.1|  Cullin-4B                                             80.9    7e-14   
ref|XP_008832150.1|  PREDICTED: cullin-4B                             80.9    7e-14   
ref|XP_005790994.1|  hypothetical protein EMIHUDRAFT_224320           79.3    7e-14   
gb|KFQ64788.1|  Cullin-4B                                             80.9    7e-14   
gb|EPQ19199.1|  Cullin-4B                                             80.9    7e-14   
gb|KFO64284.1|  Cullin-4B                                             80.9    7e-14   
gb|KFP00724.1|  Cullin-4B                                             80.9    7e-14   
ref|XP_005782887.1|  hypothetical protein EMIHUDRAFT_468368           80.5    7e-14   
ref|XP_004704475.1|  PREDICTED: cullin-4A                             80.5    8e-14   
ref|XP_004478393.1|  PREDICTED: cullin-4B                             80.5    8e-14   
ref|XP_004273640.1|  PREDICTED: cullin-4A                             80.5    8e-14   
ref|XP_007940575.1|  PREDICTED: cullin-4A                             80.5    9e-14   
ref|XP_007466424.1|  PREDICTED: cullin-4A                             80.5    9e-14   
gb|EGI59840.1|  Cullin-4B                                             80.5    9e-14   
ref|XP_008154341.1|  PREDICTED: cullin-4B isoform X1                  80.5    9e-14   
gb|KFV68186.1|  Cullin-4B                                             80.5    9e-14   
ref|XP_006981365.1|  PREDICTED: cullin-4A                             80.1    9e-14   
gb|ELK27187.1|  Cullin-4B                                             80.5    1e-13   
ref|XP_002930544.1|  PREDICTED: cullin-4A isoform X1                  80.1    1e-13   
ref|XP_008683174.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_009995422.1|  PREDICTED: cullin-4B                             80.5    1e-13   
ref|XP_864628.3|  PREDICTED: cullin-4B isoform 3                      80.5    1e-13   
ref|XP_001364868.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_007064015.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_006257551.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_005884739.1|  PREDICTED: cullin-4B                             80.1    1e-13   
gb|KFP13940.1|  Cullin-4B                                             80.1    1e-13   
ref|XP_005374279.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_007530424.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_007178671.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        80.1    1e-13   
ref|XP_004423239.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_003690323.1|  PREDICTED: cullin-4B-like                        80.1    1e-13   
ref|XP_003397436.1|  PREDICTED: cullin-4B-like                        80.1    1e-13   
ref|XP_392800.3|  PREDICTED: cullin-4B-like                           80.1    1e-13   
ref|XP_006102095.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        80.1    1e-13   
ref|XP_003414815.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_009968332.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_010627873.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_849542.3|  PREDICTED: cullin-4A                                80.1    1e-13   
ref|XP_010627872.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_009196470.1|  PREDICTED: cullin-4B isoform X3                  80.1    1e-13   
ref|XP_011063503.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_007122106.1|  PREDICTED: cullin-4B-like isoform X2             80.1    1e-13   
ref|XP_004285634.1|  PREDICTED: cullin-4B isoform 1                   80.1    1e-13   
ref|XP_010592962.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_007122105.1|  PREDICTED: cullin-4B-like isoform X1             80.1    1e-13   
ref|XP_004631217.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_003465638.1|  PREDICTED: cullin-4B                             80.1    1e-13   
ref|XP_003765773.1|  PREDICTED: cullin-4A                             80.1    1e-13   
ref|XP_008988093.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_002723510.1|  PREDICTED: cullin-4A                             80.1    1e-13   
gb|AAR13073.1|  cullin 4B                                             80.1    1e-13   
ref|XP_004587715.1|  PREDICTED: cullin-4B                             80.1    1e-13   
ref|NP_001073341.1|  cullin-4B isoform 2                              80.1    1e-13   
ref|XP_008988095.1|  PREDICTED: cullin-4B isoform X3                  80.1    1e-13   
emb|CAD97843.1|  hypothetical protein                                 80.1    1e-13   
ref|XP_006917880.1|  PREDICTED: cullin-4B                             80.1    1e-13   
ref|XP_006909411.1|  PREDICTED: cullin-4A                             79.7    1e-13   
ref|XP_006082212.1|  PREDICTED: cullin-4B isoform X3                  80.1    1e-13   
ref|XP_006767871.1|  PREDICTED: cullin-4B                             80.1    1e-13   
ref|XP_010962238.1|  PREDICTED: cullin-4B                             80.1    1e-13   
ref|XP_006215962.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_006215961.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_008988094.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_006724847.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_006082213.1|  PREDICTED: cullin-4B isoform X4                  80.1    1e-13   
gb|AAK16812.1|AF212995_1  cullin CUL4B                                79.7    1e-13   
ref|XP_006724848.1|  PREDICTED: cullin-4B isoform X3                  80.1    1e-13   
ref|XP_005884540.1|  PREDICTED: cullin-4A                             79.7    1e-13   
ref|XP_009196468.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_006082210.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_011376546.1|  PREDICTED: cullin-4B isoform X3                  80.1    1e-13   
ref|XP_001086195.1|  PREDICTED: cullin-4B isoform 1                   80.1    1e-13   
ref|XP_011376543.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_008988096.1|  PREDICTED: cullin-4B isoform X4                  80.1    1e-13   
ref|XP_006082211.1|  PREDICTED: cullin-4B isoform X2                  80.1    1e-13   
ref|XP_006885130.1|  PREDICTED: cullin-4B-like isoform X1             80.1    1e-13   
ref|XP_005700400.1|  PREDICTED: cullin-4B isoform X1                  80.1    1e-13   
ref|XP_010989951.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        80.1    1e-13   
gb|EMC88699.1|  Cullin-4B                                             80.1    1e-13   
ref|XP_005083198.1|  PREDICTED: cullin-4B                             79.7    1e-13   
ref|XP_004022402.1|  PREDICTED: cullin-4B isoform 1                   80.1    1e-13   
ref|XP_004537530.1|  PREDICTED: cullin-4B-like                        79.7    1e-13   
ref|XP_005420081.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        79.7    1e-13   
ref|XP_003707650.1|  PREDICTED: cullin-4B-like                        79.7    1e-13   
ref|XP_008142137.1|  PREDICTED: cullin-4A                             79.7    1e-13   
ref|XP_004647716.1|  PREDICTED: cullin-4B                             79.7    1e-13   
ref|XP_005673908.1|  PREDICTED: cullin-4B-like                        79.7    1e-13   
ref|XP_007507206.1|  PREDICTED: cullin-4B isoform X3                  79.7    1e-13   
ref|XP_009534475.1|  hypothetical protein PHYSODRAFT_361833           79.7    1e-13   
ref|XP_006144939.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        79.7    1e-13   
ref|XP_007076303.1|  PREDICTED: cullin-4B isoform X3                  79.7    1e-13   
ref|XP_007076301.1|  PREDICTED: cullin-4B isoform X1                  79.7    1e-13   
ref|XP_010798617.1|  PREDICTED: cullin-4B isoform X1                  79.7    1e-13   
ref|XP_010292721.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        79.7    1e-13   
ref|XP_011277733.1|  PREDICTED: cullin-4B isoform X1                  79.7    1e-13   
ref|XP_008271382.1|  PREDICTED: cullin-4B isoform X3                  79.7    1e-13   
ref|XP_006048867.1|  PREDICTED: cullin-4B isoform X4                  79.7    1e-13   
ref|XP_002699556.2|  PREDICTED: cullin-4B isoform X4                  79.7    1e-13   
ref|XP_007507207.1|  PREDICTED: cullin-4B isoform X4                  79.7    1e-13   
ref|XP_007076302.1|  PREDICTED: cullin-4B isoform X2                  79.7    1e-13   
gb|AAH36216.1|  Cullin 4B                                             79.7    1e-13   
ref|NP_003579.3|  cullin-4B isoform 1                                 79.7    1e-13   
ref|XP_005262538.1|  PREDICTED: cullin-4B isoform X1                  79.7    1e-13   
ref|XP_008017652.1|  PREDICTED: cullin-4B isoform X5                  79.7    1e-13   
ref|XP_008017651.1|  PREDICTED: cullin-4B isoform X4                  79.7    1e-13   
ref|XP_010592963.1|  PREDICTED: cullin-4B isoform X3                  79.7    1e-13   
ref|XP_001870810.1|  cullin                                           79.7    1e-13   
ref|NP_001100421.1|  cullin-4B                                        79.7    2e-13   
ref|XP_004653844.1|  PREDICTED: cullin-4B                             79.7    2e-13   
ref|XP_011277734.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_004685823.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|NP_001090088.1|  cullin 4B                                        79.7    2e-13   
ref|XP_005505503.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_010178748.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_009988821.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_004406978.1|  PREDICTED: cullin-4B                             79.7    2e-13   
ref|XP_008271383.1|  PREDICTED: cullin-4B isoform X4                  79.7    2e-13   
ref|XP_005319406.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_008974985.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_007507205.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_007507204.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_006769372.1|  PREDICTED: cullin-4A                             79.7    2e-13   
gb|EFB23437.1|  hypothetical protein PANDA_021021                     79.3    2e-13   
ref|XP_005366325.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_005307673.1|  PREDICTED: cullin-4A isoform X1                  79.3    2e-13   
ref|XP_010086167.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_008707988.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        79.7    2e-13   
ref|XP_005358493.1|  PREDICTED: cullin-4B                             79.7    2e-13   
ref|XP_009324584.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_009484087.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_004762117.1|  PREDICTED: cullin-4B isoform X4                  79.7    2e-13   
ref|XP_010117727.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_008944998.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        79.3    2e-13   
ref|XP_004762115.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_005228767.1|  PREDICTED: cullin-4A                             79.3    2e-13   
gb|EFB16493.1|  hypothetical protein PANDA_011593                     79.7    2e-13   
ref|XP_008585584.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_008585583.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_008070821.1|  PREDICTED: cullin-4B                             79.7    2e-13   
ref|XP_004437389.1|  PREDICTED: cullin-4B                             79.7    2e-13   
ref|XP_008538116.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_007537520.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_008271380.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_009644037.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_005227530.1|  PREDICTED: cullin-4B isoform X2                  79.7    2e-13   
ref|XP_008538115.1|  PREDICTED: cullin-4B isoform X1                  79.7    2e-13   
ref|XP_010160186.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        79.3    2e-13   
ref|XP_009578999.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_006851582.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_009957785.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_011227402.1|  PREDICTED: cullin-4B isoform X2                  79.3    2e-13   
ref|XP_005413715.1|  PREDICTED: cullin-4B isoform X3                  79.3    2e-13   
ref|XP_011227401.1|  PREDICTED: cullin-4B isoform X1                  79.3    2e-13   
ref|XP_002720454.2|  PREDICTED: cullin-4B isoform X2                  79.3    2e-13   
ref|XP_005413713.1|  PREDICTED: cullin-4B isoform X1                  79.3    2e-13   
ref|XP_006048866.1|  PREDICTED: cullin-4B isoform X3                  79.3    2e-13   
ref|XP_010819677.1|  PREDICTED: cullin-4B isoform X3                  79.3    2e-13   
ref|XP_006048864.1|  PREDICTED: cullin-4B isoform X1                  79.3    2e-13   
ref|XP_005413714.1|  PREDICTED: cullin-4B isoform X2                  79.3    2e-13   
ref|XP_008846647.1|  PREDICTED: cullin-4A                             79.3    2e-13   
gb|EMC87002.1|  Cullin-4A                                             79.3    2e-13   
dbj|BAE40173.1|  unnamed protein product                              79.3    2e-13   
ref|XP_011279428.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_001603521.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_004899937.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        79.3    2e-13   
ref|XP_007642800.1|  PREDICTED: cullin-4A isoform X1                  79.3    2e-13   
ref|XP_007630482.1|  PREDICTED: cullin-4A isoform X2                  79.3    2e-13   
ref|XP_006746270.1|  PREDICTED: cullin-4B                             79.3    2e-13   
ref|XP_004762114.1|  PREDICTED: cullin-4B isoform X1                  79.3    2e-13   
ref|XP_004746221.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|NP_666319.2|  cullin-4A                                           79.3    2e-13   
ref|XP_009083710.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_004762116.1|  PREDICTED: cullin-4B isoform X3                  79.3    2e-13   
ref|XP_009707260.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|NP_001120773.1|  cullin-4A                                        79.3    2e-13   
ref|XP_009996265.1|  PREDICTED: cullin-4A                             79.3    2e-13   
ref|XP_005007188.1|  PREDICTED: cullin-4A isoform X2                  79.3    2e-13   
ref|XP_003477616.1|  PREDICTED: cullin-4A isoform X1                  79.3    2e-13   
ref|XP_003640577.1|  PREDICTED: cullin-4A isoform X1                  79.0    2e-13   
ref|XP_007902269.1|  PREDICTED: cullin-4A isoform X2                  79.0    2e-13   
ref|XP_008494595.1|  PREDICTED: cullin-4A                             79.0    2e-13   
ref|XP_003365917.2|  PREDICTED: cullin-4B                             79.3    2e-13   
ref|XP_004383008.1|  PREDICTED: cullin-4A                             79.0    2e-13   
ref|XP_004412313.1|  PREDICTED: cullin-4A                             79.0    2e-13   
ref|XP_004938591.1|  PREDICTED: cullin-4A isoform X2                  79.0    2e-13   
gb|KFW96883.1|  Cullin-4B                                             79.0    2e-13   
ref|XP_005516645.1|  PREDICTED: cullin-4A                             79.0    2e-13   
ref|XP_007902268.1|  PREDICTED: cullin-4A isoform X1                  79.0    2e-13   
ref|XP_004874660.1|  PREDICTED: cullin-4B isoform X2                  79.0    2e-13   
ref|XP_004874659.1|  PREDICTED: cullin-4B isoform X1                  79.0    2e-13   
ref|XP_009890453.1|  PREDICTED: cullin-4A                             79.0    2e-13   
ref|XP_005145983.1|  PREDICTED: cullin-4A                             79.0    3e-13   
gb|EDL22120.1|  mCG3701, isoform CRA_b                                79.0    3e-13   
ref|XP_005037540.1|  PREDICTED: cullin-4A isoform X1                  79.0    3e-13   
ref|XP_009820586.1|  PREDICTED: cullin-4A                             79.0    3e-13   
pdb|4A64|A  Chain A, Crystal Structure Of The N-Terminal Domain O...  77.0    3e-13   
ref|XP_004663475.1|  PREDICTED: cullin-4A                             79.0    3e-13   
gb|EDM08876.1|  similar to cullin 4A (predicted), isoform CRA_b       79.0    3e-13   
ref|XP_005601443.1|  PREDICTED: cullin-4A                             79.0    3e-13   
gb|ELT94808.1|  hypothetical protein CAPTEDRAFT_227595                79.0    3e-13   
gb|KFV79701.1|  Cullin-4B                                             79.0    3e-13   
pdb|4A0K|A  Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A...  78.6    3e-13   
ref|XP_010171675.1|  PREDICTED: cullin-4A                             78.6    3e-13   
ref|XP_009897043.1|  PREDICTED: cullin-4A                             78.6    3e-13   
gb|KFV55551.1|  Cullin-4B                                             78.6    3e-13   
ref|XP_009936506.1|  PREDICTED: cullin-4A                             78.6    4e-13   
ref|XP_009470947.1|  PREDICTED: cullin-4A                             78.6    4e-13   
ref|XP_010726908.1|  PREDICTED: cullin-4A                             78.6    4e-13   
ref|XP_011504999.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like   78.6    4e-13   
ref|XP_005022013.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        78.2    4e-13   
ref|XP_009274422.1|  PREDICTED: cullin-4A                             78.6    4e-13   
ref|XP_008924491.1|  PREDICTED: cullin-4A                             78.6    4e-13   
ref|XP_007959168.1|  PREDICTED: cullin-4A isoform X1                  78.2    4e-13   
ref|XP_003914139.1|  PREDICTED: cullin-4A isoform X2                  78.2    4e-13   
dbj|BAD93235.1|  cullin-4A                                            78.2    4e-13   
ref|XP_011168244.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        78.6    4e-13   



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 169/213 (79%), Gaps = 10/213 (5%)
 Frame = +1

Query  49   MSQPTSNPNKR-----SSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHH  213
            MSQPT+NP KR      S  SS + T G           MKKAKSQA+ CS+D NKNG H
Sbjct  1    MSQPTTNPKKRFIPTNPSSSSSSTPTTGGTGGRTPAYSSMKKAKSQALPCSID-NKNGQH  59

Query  214  HVHFYPDVDEDPS--SASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  387
             VHF  D+D DPS  S+ MED +   +S     TANLSRKKAT PQPAKKLVIKL+KAKP
Sbjct  60   -VHFSSDID-DPSGNSSMMEDSNIDASSVAGGVTANLSRKKATPPQPAKKLVIKLLKAKP  117

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+
Sbjct  118  TLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECES  177

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HIA AL+SLVGQSEDLVVFLSLVE+CWQDFCDQ
Sbjct  178  HIAAALRSLVGQSEDLVVFLSLVERCWQDFCDQ  210



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 163/231 (71%), Gaps = 30/231 (13%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGD--------------GAPPLHRPPPMKKAKSQAVACSLDTNK  201
            S PN  ++P +S SA  G               G       P MKKAKSQAVACSLD NK
Sbjct  2    SQPNTSTTPATSASAVPGKRSSSPRSSTTPTATGVGAASVVPAMKKAKSQAVACSLDGNK  61

Query  202  NGHH----HVHFY------PDVDEDPSSASMEDLDSPGASATRAA------TANLSRKKA  333
            NG      HVHF       P +++DPS  +ME   S  A   R +      TANLSRKKA
Sbjct  62   NGQQQITPHVHFAEPPVHSPMMEDDPSDVAMEASPSSTAFGRRVSASGGGVTANLSRKKA  121

Query  334  TLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  513
            T PQP KKLVIKLVKAKPTLP+NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC
Sbjct  122  TPPQPTKKLVIKLVKAKPTLPSNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  181

Query  514  LHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LHKMGGSLYQRIE+ECE  I+ ALQ+LVGQSEDL VFLSLVEKCWQDFCDQ
Sbjct  182  LHKMGGSLYQRIERECEEFISAALQTLVGQSEDLAVFLSLVEKCWQDFCDQ  232



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 152/174 (87%), Gaps = 5/174 (3%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSAS--MEDLDSPGASATRAATANLSR  324
            MKKAKSQA+ CS+D+ KNG H VHF  D+D DPS  S  MED +   +S     TANLSR
Sbjct  1    MKKAKSQALPCSIDS-KNGQH-VHFSSDID-DPSGNSPMMEDCNIDSSSVAGGVTANLSR  57

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKAT PQPAKKLVIKL+KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVN
Sbjct  58   KKATPPQPAKKLVIKLLKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVN  117

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLCLHKMGG+LYQRIEKECE+HIA AL+SLVGQ+EDLVVFLSLVE+CWQDFCDQ
Sbjct  118  DLCLHKMGGNLYQRIEKECESHIAAALRSLVGQNEDLVVFLSLVERCWQDFCDQ  171



>gb|KJB66936.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=788

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 162/209 (78%), Gaps = 10/209 (5%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFY  228
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  229  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  399
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  400  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAV  579
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE HI+ 
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECEEHIST  173

Query  580  ALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  174  ALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  202



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 162/209 (78%), Gaps = 10/209 (5%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFY  228
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  229  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  399
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  400  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAV  579
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE HI+ 
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECEEHIST  173

Query  580  ALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  174  ALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  202



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 151/189 (80%), Gaps = 18/189 (10%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHH----HVHFY------PDVDEDPSSASMEDLDSPG-----  285
            MKKAKSQAVACSLD NKNG      HVHF       P +++DP+  ++E   SP      
Sbjct  43   MKKAKSQAVACSLDGNKNGQQQIAPHVHFAEPPAHSPMIEDDPNDVALET-SSPSNAFGR  101

Query  286  --ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  459
              A++    TANLSRKKAT PQP KKLVIKLVKAKPTLP NFEENTWATLKSAI+AIFLK
Sbjct  102  GLAASAGGVTANLSRKKATPPQPTKKLVIKLVKAKPTLPNNFEENTWATLKSAISAIFLK  161

Query  460  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  639
            QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIE ECE +I+ ALQSLVGQSEDLVVFLSLVE
Sbjct  162  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIENECEAYISAALQSLVGQSEDLVVFLSLVE  221

Query  640  KCWQDFCDQ  666
            KCWQDFCDQ
Sbjct  222  KCWQDFCDQ  230



>ref|XP_007025065.1| Cullin-4B isoform 2, partial [Theobroma cacao]
 gb|EOY27687.1| Cullin-4B isoform 2, partial [Theobroma cacao]
Length=653

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  HRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  309
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  310  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  489
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  490  YQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            YQAVN+LCLHKMGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  147  YQAVNNLCLHKMGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  205



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = +1

Query  136  HRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  309
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  310  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  489
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  490  YQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            YQAVN+LCLHKMGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  147  YQAVNNLCLHKMGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  205



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 164/221 (74%), Gaps = 29/221 (13%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  198
            MSQPT+NP KRSS +          S+ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSFFISTNPSSSTPSTGSGDVGSGGPAY---SLMKKAKSQAV-------  50

Query  199  KNGHHHVHFYPDVDEDPS--SASMED--LDSPG-ASATRAATANLSRKKATLPQpakklv  363
             NG H VHF  D  EDPS  SA MED  +D+P  AS     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSGNSAMMEDSNMDAPSRASVGGGVTANLSRKKATPPQPAKKLV  106

Query  364  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  543
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PCDLE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCDLEALYQAVNDLCLHKMGGSLYQ  166

Query  544  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            RIEKECE+HIA AL+SL GQSEDLVVFLSLVE+ WQDFCDQ
Sbjct  167  RIEKECESHIAAALRSLAGQSEDLVVFLSLVERRWQDFCDQ  207



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score =   236 bits (603),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 163/221 (74%), Gaps = 29/221 (13%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  198
            MSQPT+NP KRSS +          ++ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSIFISTNTSSSTPTTGSGNVGSGTPAY---SLMKKAKSQAV-------  50

Query  199  KNGHHHVHFYPDVDEDPSSAS--MED--LDSPG-ASATRAATANLSRKKATLPQpakklv  363
             NG H VHF  D  EDPSS S  MED  +D+P   S     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSSNSSMMEDSNMDAPSRVSVGGGVTANLSRKKATPPQPAKKLV  106

Query  364  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  543
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PC+LE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCELEALYQAVNDLCLHKMGGSLYQ  166

Query  544  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            RIEKECE+HIA AL+SL GQSEDLVVFLSLVE+ WQDFCDQ
Sbjct  167  RIEKECESHIAAALRSLAGQSEDLVVFLSLVERRWQDFCDQ  207



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 166/232 (72%), Gaps = 29/232 (13%)
 Frame = +1

Query  49   MSQPT----SNPNKRSS---PYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNG  207
            MSQ T    +NPNKRSS   P ++    A   A P+   P +KKAKSQ V+CSLD N NG
Sbjct  1    MSQRTNSSSTNPNKRSSSTNPNANTPIAAAAAASPIF--PALKKAKSQGVSCSLDGNMNG  58

Query  208  HH------HVHFY------PDVDEDPSSASMEDLDSP-------GASATRAATANLSRKK  330
                    HVHF       P +++DP+ A + D  SP       GA++    T+NLSRKK
Sbjct  59   QQQQQPTPHVHFAETPALSPMIEDDPNDAVL-DASSPSSAFGRVGATSCGGITSNLSRKK  117

Query  331  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  510
            AT PQP KKLVIKL +AKPTLP+NFEE TW  LKSAI+ IFLKQP+PCDLEKLYQAVN+L
Sbjct  118  ATPPQPTKKLVIKLFRAKPTLPSNFEETTWEILKSAISTIFLKQPNPCDLEKLYQAVNNL  177

Query  511  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CLHK+GG+LYQRIEKECE HI+ ALQSLVGQSEDLVVFLSLVE CWQDFCDQ
Sbjct  178  CLHKLGGNLYQRIEKECEFHISAALQSLVGQSEDLVVFLSLVENCWQDFCDQ  229



>gb|KJB69828.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=786

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  HRPPPMKKAKSQAVACSLDTNKNG---HHHVHFYPDVDEDPSSASMEDLDSPGASATRAA  306
            H  P MKKAKSQAVACSLD NKNG   HH+     DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  307  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  486
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  487  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  148  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  207



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  HRPPPMKKAKSQAVACSLDTNKNG---HHHVHFYPDVDEDPSSASMEDLDSPGASATRAA  306
            H  P MKKAKSQAVACSLD NKNG   HH+     DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  307  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  486
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  487  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  148  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  207



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 152/213 (71%), Gaps = 12/213 (6%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFY-----  228
            S+PNKRSS  +    ++     P    PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPNKRSSAINHSGTSSSSSLNPSSAGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  229  ----PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-  387
                PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +     
Sbjct  65   PSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVKAKP  124

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  125  TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECER  184

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  185  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  217



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = +1

Query  136  HRPPPMKKAKSQAVACSLDTNKNG---HHHVHFYPDVDEDPSSASMEDLDSPGASATRAA  306
            H    MKKAKSQAVACSLD NKNG   HH+     DV  DPSS    D DS        A
Sbjct  23   HFQQSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMALDDDSKSDDGRAPA  82

Query  307  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  486
             ANLSRKKAT PQPAKKLVIK VKAKPT+P NFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  83   AANLSRKKATPPQPAKKLVIKFVKAKPTVPMNFEEETWAKLKSAINAIFLKQPDSCDLEK  142

Query  487  LYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LYQAVNDLCLH+MGGSLYQRIEKECE  I+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  143  LYQAVNDLCLHRMGGSLYQRIEKECEARISAALKSLVGQSPDLVVFLSLVEKCWQDLCDQ  202



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 141/173 (82%), Gaps = 2/173 (1%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            M KAKSQAVA S+D NKNG HHH     DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSQAVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  328  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  507
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  508  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  172



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 161/213 (76%), Gaps = 13/213 (6%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYP----  231
            S+P KRSS  ++ ++++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTSSSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  232  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  387
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDPDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRIEKECER  183

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  184  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  216



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 160/213 (75%), Gaps = 13/213 (6%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYP----  231
            S+P KRSS  ++ + ++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTISSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  232  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  387
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDSDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRIEKECER  183

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  184  HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  216



>ref|XP_008349190.1| PREDICTED: cullin-4-like [Malus domestica]
Length=579

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 153/216 (71%), Gaps = 15/216 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRP---PPMKKAKSQAVACSLDTNKNGHHHVHFY--  228
            S+PNKRSS  +    ++   +  L+     PPMKKAKSQAVA SLD +KNG HH H +  
Sbjct  5    SHPNKRSSAINHSGTSSSSSSSSLNPSSAGPPMKKAKSQAVAGSLDXSKNGLHHHHHHHP  64

Query  229  -------PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka  381
                   PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +  
Sbjct  65   HTHPSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVK  124

Query  382  kp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  558
               TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKE
Sbjct  125  AKPTLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  184

Query  559  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CE HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  185  CERHIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  220



>gb|KJB68315.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=703

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 140/173 (81%), Gaps = 2/173 (1%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            M KAKS +VA S+D NKNG HHH     DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  328  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  507
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  508  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  172



>gb|KGN65538.1| hypothetical protein Csa_1G435830 [Cucumis sativus]
Length=278

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 140/178 (79%), Gaps = 13/178 (7%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  312
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ
Sbjct  162  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQ  219



>gb|KJB68319.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=759

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 140/173 (81%), Gaps = 2/173 (1%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            M KAKS +VA S+D NKNG HHH     DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  328  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  507
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  508  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  172



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 140/173 (81%), Gaps = 2/173 (1%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            M KAKS +VA S+D NKNG HHH     DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  328  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  507
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  508  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LCLHK+GGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  120  LCLHKLGGSLYQRIEKECEEHISAALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  172



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>ref|XP_006449703.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62943.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=805

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +1

Query  151  MKKAKSQAVACSLDT-NKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  1    MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  56

Query  328  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  507
            KA  PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK AI AIFLKQP  CDLEKLYQAVND
Sbjct  57   KAQPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKLAIKAIFLKQPTSCDLEKLYQAVND  116

Query  508  LCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LCLHKMGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  117  LCLHKMGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQ  169



>gb|KDO78192.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=739

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGHHHVHFYPDVD  240
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  241  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  420
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  421  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVG  600
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ A++SLVG
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRIEKECEEHISAAIRSLVG  168

Query  601  QSEDLVVFLSLVEKCWQDFCDQ  666
            QS DLVVFLSLVE+CWQD CDQ
Sbjct  169  QSPDLVVFLSLVERCWQDLCDQ  190



>gb|AAL27655.2| putative cullin protein [Olea europaea]
Length=816

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 153/202 (76%), Gaps = 24/202 (12%)
 Frame = +1

Query  112  AGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHH---HVHFYPD-----VDEDPSSASME  267
            A DGA      P MKKAKSQA+A SLD NKNG     HVHF P      +DED +     
Sbjct  7    ADDGASI---SPRMKKAKSQALAYSLD-NKNGQQSVPHVHFDPSANSSMIDEDSNDVV--  60

Query  268  DLDSPGASAT--------RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
             LD+  +S +           TANL+RKKAT PQPAKKLVIKLVKAKP LPT+FEENTWA
Sbjct  61   -LDASASSNSFGRVVGGGGGVTANLARKKATPPQPAKKLVIKLVKAKPMLPTDFEENTWA  119

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
            TLKSAI AIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY+RIEKECE++I+ ALQSLVGQ
Sbjct  120  TLKSAIIAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYRRIEKECESYISAALQSLVGQ  179

Query  604  SEDLVVFLSLVE-KCWQDFCDQ  666
            S+DLVVFLSL + KCWQDFCDQ
Sbjct  180  SQDLVVFLSLGQKKCWQDFCDQ  201



>gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 147/182 (81%), Gaps = 9/182 (5%)
 Frame = +1

Query  145  PPMKKAKSQAV-ACS-LD--TNKNGHHHVHFYP----DVDEDPSSASMEDLDSPGASATR  300
            PPMKKAKSQAV ACS L+  +NKNG HH +       D+  DPSS +++D D      + 
Sbjct  27   PPMKKAKSQAVSACSPLEPTSNKNGLHHFNSATAPENDIVFDPSSMTLDD-DPKLDDRSP  85

Query  301  AATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDL  480
               ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA L+SAI AIFLKQPD CDL
Sbjct  86   PPAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPDSCDL  145

Query  481  EKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFC  660
            EKLYQAVNDLCLHKMGG+LYQRIEKECE HI+ ALQSLVGQS DLVVFLSLVE+CWQD C
Sbjct  146  EKLYQAVNDLCLHKMGGNLYQRIEKECEAHISAALQSLVGQSPDLVVFLSLVERCWQDMC  205

Query  661  DQ  666
            DQ
Sbjct  206  DQ  207



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 138/185 (75%), Gaps = 11/185 (6%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFY--------PDVDE--DPSSASMEDLDSPGASA  294
            PPMKKAKSQAVACSLD +KNG HH H +        PD D   DPSS S++D   P   +
Sbjct  36   PPMKKAKSQAVACSLDPSKNGLHHHHHHPHTHPTQDPDNDXVFDPSSMSLDDDLRPDDPS  95

Query  295  TRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDP  471
             R   ANLSRKKA  PQP+ K ++  +     TLPTNFEE TWA LKSAI AIFLK+PD 
Sbjct  96   PRGVAANLSRKKAQPPQPSTKKLVIKLVKAKPTLPTNFEEETWAKLKSAICAIFLKKPDS  155

Query  472  CDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQ  651
            CDLEKLYQAV DLCLHKMGGSLYQRIEKECE HIA ALQSLVGQS DLVVFLSLVE+CWQ
Sbjct  156  CDLEKLYQAVTDLCLHKMGGSLYQRIEKECERHIAAALQSLVGQSPDLVVFLSLVERCWQ  215

Query  652  DFCDQ  666
            D CDQ
Sbjct  216  DLCDQ  220



>ref|XP_011011309.1| PREDICTED: cullin-4-like isoform X2 [Populus euphratica]
Length=655

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +1

Query  148  PMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
             DLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ
Sbjct  140  TDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQ  194



>ref|XP_006352972.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=797

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 132/172 (77%), Gaps = 11/172 (6%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  330
            MKKAKSQA A   D NKNG    H     DE     SM      G       T+NLSRKK
Sbjct  23   MKKAKSQAAAT--DDNKNGQQQHHKVESTDE--PCVSMIQYSGGGV------TSNLSRKK  72

Query  331  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  510
            AT P P K+LVIKL KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDL
Sbjct  73   AT-PPPKKQLVIKLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDL  131

Query  511  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CLHKMGGSLYQRIEKECE HI   LQSLVGQSEDLVVFLSLVE+CWQDFCDQ
Sbjct  132  CLHKMGGSLYQRIEKECEAHIVAVLQSLVGQSEDLVVFLSLVERCWQDFCDQ  183



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 140/178 (79%), Gaps = 9/178 (5%)
 Frame = +1

Query  145  PPMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  312
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGRHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLY  139

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY RIEKECE H++ ALQSLVGQS DL VFL LV  CW+D CDQ
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEEHVSAALQSLVGQSPDLEVFLKLVATCWKDLCDQ  197



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +1

Query  148  PMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
             DLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ
Sbjct  140  TDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQ  194



>ref|XP_002270764.2| PREDICTED: cullin-4 [Vitis vinifera]
Length=828

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 153/221 (69%), Gaps = 28/221 (13%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYP----  231
            S+P KRS   ++ S++ G  +P     PPMKKAKSQAVACSLD  KNG       P    
Sbjct  2    SHPTKRSLSNTTTSSSGG-ASPHF---PPMKKAKSQAVACSLDP-KNGLQPPPHPPPPSS  56

Query  232  ----DVDEDPSSASMEDL-----------DSPGASATRAATANLSRKKATLPQpakklvi  366
                D D DPS+ +++D              P A      TANLSRKKAT PQPAKK ++
Sbjct  57   HHFPDDDFDPSAMALDDDLKPDDADAAACSRPSAGG---VTANLSRKKATPPQPAKKQLV  113

Query  367  klvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  543
              +     TLPTNFEE+TWA LKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQ
Sbjct  114  IKLLKAKPTLPTNFEEDTWAKLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQ  173

Query  544  RIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            RIEKECE+HI  ALQSLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  174  RIEKECESHIRAALQSLVGQSPDLVVFLSLVEKCWQDLCDQ  214



>ref|XP_004162809.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cucumis sativus]
Length=833

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 140/178 (79%), Gaps = 13/178 (7%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  312
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ
Sbjct  162  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQ  219



>gb|EPS64061.1| cullin 4, partial [Genlisea aurea]
Length=763

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 143/186 (77%), Gaps = 13/186 (7%)
 Frame = +1

Query  142  PPPMKKAKSQAVACSLDTNKNGHHHVHFYPD---VDEDPSSASMEDLDSPGASA------  294
            PP MKKAKSQAVACS+D  +    H    P    + ED + ++ME   SP A++      
Sbjct  29   PPTMKKAKSQAVACSIDAPQQQIPHFAETPAHSPMIEDDADSAMEA--SPPANSFGRVVS  86

Query  295  --TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPD  468
                  TANLSRKKAT PQPAKK VIKL KAKPTLP+NFEENTWATLKSAI+AIFLK+PD
Sbjct  87   GSGGGVTANLSRKKATPPQPAKKFVIKLNKAKPTLPSNFEENTWATLKSAISAIFLKRPD  146

Query  469  PCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCW  648
            PCD EKLYQAV+DLCLHKMGGSLYQRIEKECE +I+ AL  LVGQSEDL VFLSLVE+CW
Sbjct  147  PCDSEKLYQAVSDLCLHKMGGSLYQRIEKECEAYISFALHFLVGQSEDLAVFLSLVERCW  206

Query  649  QDFCDQ  666
            QDFCDQ
Sbjct  207  QDFCDQ  212



>ref|XP_004149667.1| PREDICTED: cullin-4-like [Cucumis sativus]
Length=833

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 140/178 (79%), Gaps = 13/178 (7%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  312
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ
Sbjct  162  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQ  219



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +1

Query  148  PMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  28   PMKKAKSQAASACSPLDHNKNGLYHSD---DVVFDPSSMSLDDDLKLVDYRTPPAAANLS  84

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLYQAV
Sbjct  85   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLYQAV  144

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            NDLCLHKMGG+LY RIEKECETHI+ ALQSLVGQS DLVVFL LVE+CW D CDQ
Sbjct  145  NDLCLHKMGGNLYLRIEKECETHISAALQSLVGQSPDLVVFLKLVEECWHDLCDQ  199



>ref|XP_006377605.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55402.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=741

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  145  PPMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  312
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY RIEKECE HI+ ALQSLVGQS DL VFL LV  CW+D CDQ
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEAHISAALQSLVGQSPDLEVFLKLVATCWKDLCDQ  197



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  145  PPMKKAKSQAV-ACS-LDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  312
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY RIEKECE HI+ ALQSLVGQS DL VFL LV  CW+D CDQ
Sbjct  140  QAVNDLCLHKMGGNLYLRIEKECEAHISAALQSLVGQSPDLEVFLKLVATCWKDLCDQ  197



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 139/178 (78%), Gaps = 13/178 (7%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  312
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      S    A+R+   
Sbjct  45   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSSLIGASRSVAT  97

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  98   NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  157

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVNDLCLHKMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL+ VEKCWQDFCDQ
Sbjct  158  QAVNDLCLHKMGGNLYRRIEKECEVHISAALQSLVGQSPDLVVFLAYVEKCWQDFCDQ  215



>ref|XP_002519675.1| cullin, putative [Ricinus communis]
 gb|EEF42648.1| cullin, putative [Ricinus communis]
Length=807

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 144/193 (75%), Gaps = 21/193 (11%)
 Frame = +1

Query  145  PPMKKAKSQAV-ACS-LDT--NKNGHHHVHFYP--------DVDEDPSSASMEDLDSPGA  288
            PPMKKAKSQAV ACS LDT  NKNG HH  F P        DV  DPSS    D D    
Sbjct  26   PPMKKAKSQAVSACSPLDTTTNKNGIHH--FNPSTTAAAENDVVFDPSSMMSLDDDPKLD  83

Query  289  SATRA-------ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  447
                        A ANLSRKKAT PQPAKKLVIKLVKAKPTLP NFEE+TWA L+SAI A
Sbjct  84   DDHHRSHHHHPPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPINFEEDTWAKLQSAIKA  143

Query  448  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFL  627
            IFLKQPD CDLEKLYQAVNDLCLHKMGG+LYQ+IEKECE HI+ AL+SLVGQS DLVVFL
Sbjct  144  IFLKQPDSCDLEKLYQAVNDLCLHKMGGNLYQQIEKECEAHISAALRSLVGQSPDLVVFL  203

Query  628  SLVEKCWQDFCDQ  666
            SLVE+CWQD CDQ
Sbjct  204  SLVERCWQDLCDQ  216



>gb|KCW73810.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 15/187 (8%)
 Frame = +1

Query  151  MKKAKSQAVACSLDT---NKNGHH---------HVHFYP--DVDEDPSSASMED-LDSPG  285
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  286  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  465
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  466  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  645
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  180

Query  646  WQDFCDQ  666
            WQDFCDQ
Sbjct  181  WQDFCDQ  187



>gb|KCW73811.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 15/187 (8%)
 Frame = +1

Query  151  MKKAKSQAVACSLDT---NKNGHH---------HVHFYP--DVDEDPSSASMED-LDSPG  285
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  286  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  465
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  466  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  645
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  180

Query  646  WQDFCDQ  666
            WQDFCDQ
Sbjct  181  WQDFCDQ  187



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 15/187 (8%)
 Frame = +1

Query  151  MKKAKSQAVACSLDT---NKNGHH---------HVHFYP--DVDEDPSSASMED-LDSPG  285
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  38   MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  97

Query  286  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  465
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  98   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  157

Query  466  DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKC  645
              C LE  YQAVNDLCLHK+GG+LYQRIEKECETHI+  LQ+LVGQS DL VFLSLVE+C
Sbjct  158  VSCSLEDYYQAVNDLCLHKLGGNLYQRIEKECETHISAVLQTLVGQSPDLAVFLSLVERC  217

Query  646  WQDFCDQ  666
            WQDFCDQ
Sbjct  218  WQDFCDQ  224



>ref|XP_010247871.1| PREDICTED: cullin-4-like isoform X2 [Nelumbo nucifera]
Length=725

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 151/219 (69%), Gaps = 25/219 (11%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDV--  237
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  238  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  369
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  370  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  549
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174

Query  550  EKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            EKECE HI+ ALQSLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  175  EKECEAHISAALQSLVGQSPDLVVFLSLVEKCWQDLCDQ  213



>emb|CAN75926.1| hypothetical protein VITISV_010491 [Vitis vinifera]
Length=806

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 137/192 (71%), Gaps = 24/192 (13%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYP--------DVDEDPSSASMEDL-----------  273
            MKKAKSQAVACSLD  KNG       P        D D DPS+ +++D            
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  274  DSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAI  450
              P A      TANLSRKKAT PQPAKK ++  +     TLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGG---VTANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  451  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  630
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  176

Query  631  LVEKCWQDFCDQ  666
            LVEKCWQD CDQ
Sbjct  177  LVEKCWQDLCDQ  188



>emb|CBI30911.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 137/192 (71%), Gaps = 24/192 (13%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYP--------DVDEDPSSASMEDL-----------  273
            MKKAKSQAVACSLD  KNG       P        D D DPS+ +++D            
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  274  DSPGASATRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAI  450
              P A      TANLSRKKAT PQPAKK ++  +     TLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGG---VTANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  451  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  630
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  176

Query  631  LVEKCWQDFCDQ  666
            LVEKCWQD CDQ
Sbjct  177  LVEKCWQDLCDQ  188



>ref|XP_010247870.1| PREDICTED: cullin-4-like isoform X1 [Nelumbo nucifera]
Length=827

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 151/219 (69%), Gaps = 25/219 (11%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDV--  237
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  238  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  369
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  370  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  549
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174

Query  550  EKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            EKECE HI+ ALQSLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  175  EKECEAHISAALQSLVGQSPDLVVFLSLVEKCWQDLCDQ  213



>ref|XP_010274939.1| PREDICTED: cullin-4-like [Nelumbo nucifera]
Length=837

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 145/195 (74%), Gaps = 28/195 (14%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTN----------KNGHHHVHFYPDVDEDPSSASMED------LDSP  282
            MKKAKSQAVACSL+ N           +  HH+      D+D SS  ++D      +D+ 
Sbjct  34   MKKAKSQAVACSLEKNGLQQQQQQQQNHAQHHL-----FDDDDSSMIVDDDIKVDAVDAT  88

Query  283  ------GASAT-RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  441
                  G+S T     ANLSRKKAT PQPAKKLVIKLVKAKP LPTNFEE+TWATLKSAI
Sbjct  89   PIALGVGSSGTPHGVAANLSRKKATPPQPAKKLVIKLVKAKPKLPTNFEEDTWATLKSAI  148

Query  442  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVV  621
            +AIFLKQPD CD EKLYQAV DLCLHKMGG+LYQRIEKECE+HI+ ALQSLVGQS DLVV
Sbjct  149  SAIFLKQPDSCDSEKLYQAVCDLCLHKMGGNLYQRIEKECESHISAALQSLVGQSPDLVV  208

Query  622  FLSLVEKCWQDFCDQ  666
            FL+LVEKCWQD CDQ
Sbjct  209  FLALVEKCWQDLCDQ  223



>ref|XP_008787804.1| PREDICTED: cullin-4-like isoform X2 [Phoenix dactylifera]
Length=846

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 151/224 (67%), Gaps = 19/224 (8%)
 Frame = +1

Query  52   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGHH--  213
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  214  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  354
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  355  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  534
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  535  LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LYQRIEKECE HI+  L SLVGQS DLVVFLSLVEKCWQDFCDQ
Sbjct  189  LYQRIEKECEVHISTTLSSLVGQSPDLVVFLSLVEKCWQDFCDQ  232



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 129/178 (72%), Gaps = 9/178 (5%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PPMKK KSQA+ACSLD NKNG HH+     DV  DPS A  ED   P  S    A ANLS
Sbjct  35   PPMKKTKSQAMACSLDPNKNGLHHNNQDNNDVVFDPSMALDED---PKPSD--GAAANLS  89

Query  322  RKKATLPQ---pakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            RKKAT P        +     K KP LP NFE+ TWA LKSAI AIFLK+ D CDLEKLY
Sbjct  90   RKKATPPHPPGKKFVIKFNKDKEKPKLPVNFEDETWAKLKSAICAIFLKRRDSCDLEKLY  149

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAVN+LCLHK+G +LYQRIE+ECETHIA AL++LVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  150  QAVNNLCLHKLGANLYQRIERECETHIAAALRALVGQSPDLVVFLSLVERCWQDLCDQ  207



>gb|KHN06973.1| Cullin-4 [Glycine soja]
Length=788

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 144/201 (72%), Gaps = 28/201 (14%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE  243
            S P KRSS       TAG    P   PPPMKKAKS  +  S  +            D   
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLHSSSSS------------DAVL  39

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  153

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLVE+CWQD CDQ
Sbjct  154  SPDLVVFLSLVERCWQDLCDQ  174



>ref|XP_008787803.1| PREDICTED: cullin-4-like isoform X1 [Phoenix dactylifera]
Length=871

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 151/224 (67%), Gaps = 19/224 (8%)
 Frame = +1

Query  52   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGHH--  213
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  214  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  354
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  355  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  534
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  535  LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LYQRIEKECE HI+  L SLVGQS DLVVFLSLVEKCWQDFCDQ
Sbjct  189  LYQRIEKECEVHISTTLSSLVGQSPDLVVFLSLVEKCWQDFCDQ  232



>ref|XP_009408525.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=847

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 138/189 (73%), Gaps = 19/189 (10%)
 Frame = +1

Query  151  MKKAKSQ-AVACSLDTNKNGHHHVHF-----------YPDVDEDPSSASMEDLDSPGASA  294
            MKKAK   A ACSL+  KNG HH HF            P  +ED      E+L  PGAS 
Sbjct  47   MKKAKPLPAAACSLEKEKNGLHH-HFDTAAAAAAVAARPGKEEDAMLVDQEEL-KPGASV  104

Query  295  TRAAT---ANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  459
              A T   ANLSRKKAT PQ    K+LVIK VK KP++P NFEE+TWATLKSAINAIFLK
Sbjct  105  PVAMTGVAANLSRKKATPPQPSAKKQLVIKFVKGKPSVPANFEEDTWATLKSAINAIFLK  164

Query  460  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  639
            + DPCD EKLYQAV+DLCLHKMGG+LYQR+++ECE HI+ AL SLVGQS DLVVFLSLVE
Sbjct  165  RRDPCDSEKLYQAVDDLCLHKMGGNLYQRVQRECEIHISRALSSLVGQSPDLVVFLSLVE  224

Query  640  KCWQDFCDQ  666
            KCWQDFCDQ
Sbjct  225  KCWQDFCDQ  233



>ref|XP_009398338.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=842

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 145/212 (68%), Gaps = 19/212 (9%)
 Frame = +1

Query  85   SPYSSCSATAGDGAPPLHRPPPMKKAKSQ-AVACSLDTNKNGHHHVHFYPDV--------  237
            +P S+  A+ G         P MKKAK Q A  CSL+  KNG H    + +         
Sbjct  18   TPNSNSGASGGATHISPELSPAMKKAKPQLAATCSLEKEKNGLHPQPHHSNTTAAAAVAA  77

Query  238  ----DEDPSSASMEDLDSPGASATRAAT---ANLSRKKATLPQ--pakklviklvkakpT  390
                ++D      E+L  PGASA    T   ANLSRKKAT PQ    K+LVIKLVK KP+
Sbjct  78   QSGEEDDAMLVDQEEL-KPGASAPVMVTGVAANLSRKKATPPQPSVKKQLVIKLVKGKPS  136

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECETH
Sbjct  137  LPKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECETH  196

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I+  + SLVGQS DLVVFLSLVEKCWQDFCDQ
Sbjct  197  ISSTMSSLVGQSPDLVVFLSLVEKCWQDFCDQ  228



>ref|XP_010666663.1| PREDICTED: cullin-4 [Beta vulgaris subsp. vulgaris]
Length=825

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 138/220 (63%), Gaps = 23/220 (10%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFY  228
            MS P +N    SSP S+ +        P      MKK KSQ    SLDT    H   +  
Sbjct  1    MSPPNNNKRPASSPTSTHTNLTSSSFSP-----SMKKPKSQ----SLDTRNALHSAFNSS  51

Query  229  PDVDEDPSSASMEDLD-------------SPGASATRAATANLSRKKATLPQpakklvik  369
              VD+DP+S  +++ D             S  A  +   TANLSRKKAT P P+ K ++ 
Sbjct  52   SAVDDDPASVIVDNDDDLKSNAVISSSANSRSAPISGGVTANLSRKKATPPNPSTKKLVI  111

Query  370  lvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  546
             +     TLP NFEE TWATLKSAINAIFLKQPD CDLEKLYQAVNDLCLHKMGGSLYQR
Sbjct  112  KLVKAKPTLPPNFEEVTWATLKSAINAIFLKQPDSCDLEKLYQAVNDLCLHKMGGSLYQR  171

Query  547  IEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            IEKE E H++  L SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  172  IEKESEAHVSTVLHSLVGQSPDLVVFLSLVEKCWQDLCDQ  211



>ref|XP_010941311.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Elaeis guineensis]
Length=846

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 135/189 (71%), Gaps = 17/189 (9%)
 Frame = +1

Query  151  MKKAKSQA-VACSLDTNKNGHH--HVHFYPDVDE----------DPSSASMEDLDSPGAS  291
            MKK KSQ   A +++  KNG H    HF P              DP     EDL +  ++
Sbjct  44   MKKFKSQPPAAAAVEREKNGLHPHSTHFDPAAAAEAAAQPAGEEDPMLVDQEDLKAGAST  103

Query  292  A--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  459
            A  +    ANLSRKKAT PQ    K+L+IKLVK KPTLPTNFEE+TWATLKSAI AIFLK
Sbjct  104  AITSTGVAANLSRKKATPPQPLAKKQLIIKLVKGKPTLPTNFEEDTWATLKSAITAIFLK  163

Query  460  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  639
            QPDPCD EKLYQAV+DLCLHKMGG+LYQRIEKECE HI+  L +LVGQS DLVVFLSLVE
Sbjct  164  QPDPCDSEKLYQAVSDLCLHKMGGNLYQRIEKECEVHISTTLFALVGQSPDLVVFLSLVE  223

Query  640  KCWQDFCDQ  666
            KCWQDFCDQ
Sbjct  224  KCWQDFCDQ  232



>ref|XP_004233125.1| PREDICTED: cullin-4 [Solanum lycopersicum]
Length=802

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 117/160 (73%), Gaps = 7/160 (4%)
 Frame = +1

Query  190  DTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvik  369
            D NKNG      +    +D    SM      G       T+NLSRKKAT PQP KK ++ 
Sbjct  35   DDNKNGQQQQQHHHHHHKDEPCVSMIQYSGGGV------TSNLSRKKATPPQPPKKQLVI  88

Query  370  lvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  546
             +     TLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAV DLCLHKMGGSLYQR
Sbjct  89   KLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVTDLCLHKMGGSLYQR  148

Query  547  IEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            IEKECE HI   LQSLVGQSEDLVVFLS+V++CWQDFCDQ
Sbjct  149  IEKECEAHIVAVLQSLVGQSEDLVVFLSVVQRCWQDFCDQ  188



>ref|XP_010923713.1| PREDICTED: cullin-4-like isoform X2 [Elaeis guineensis]
Length=845

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 141/199 (71%), Gaps = 19/199 (10%)
 Frame = +1

Query  124  APPLHRPPPMKKAKSQ------AVACSLDTNKNGHHHVH---FYPDV-----DEDPSSAS  261
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  262  MEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATL  429
             EDL +  ++A  T    ANLSRKKAT PQ    K+LVIKLVK KPTLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  430  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE  609
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI+  L SLVGQS 
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHISATLSSLVGQSP  212

Query  610  DLVVFLSLVEKCWQDFCDQ  666
            DLVVFLSLVEKCWQDFCDQ
Sbjct  213  DLVVFLSLVEKCWQDFCDQ  231



>ref|XP_010923712.1| PREDICTED: cullin-4-like isoform X1 [Elaeis guineensis]
Length=870

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 141/199 (71%), Gaps = 19/199 (10%)
 Frame = +1

Query  124  APPLHRPPPMKKAKSQ------AVACSLDTNKNGHHHVH---FYPDV-----DEDPSSAS  261
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  262  MEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATL  429
             EDL +  ++A  T    ANLSRKKAT PQ    K+LVIKLVK KPTLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  430  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE  609
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI+  L SLVGQS 
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHISATLSSLVGQSP  212

Query  610  DLVVFLSLVEKCWQDFCDQ  666
            DLVVFLSLVEKCWQDFCDQ
Sbjct  213  DLVVFLSLVEKCWQDFCDQ  231



>gb|KHN47328.1| Cullin-4 [Glycine soja]
Length=777

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 137/201 (68%), Gaps = 38/201 (19%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE  243
            S P KRSS       TAG    P   PPPMKKAKS  +  S D +               
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLRSSSDDH---------------  36

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
                    D   P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  37   --------DAVLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  83

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  84   KLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  143

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLVE+CWQD CDQ
Sbjct  144  SPDLVVFLSLVERCWQDLCDQ  164



>ref|XP_003546083.1| PREDICTED: cullin-4-like [Glycine max]
Length=788

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 121/141 (86%), Gaps = 6/141 (4%)
 Frame = +1

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQ
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQ  153

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLVE+CWQD CDQ
Sbjct  154  SPDLVVFLSLVERCWQDLCDQ  174



>ref|XP_007147910.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
 gb|ESW19904.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
Length=787

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 5/133 (4%)
 Frame = +1

Query  268  DLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  447
            D D P A A     ANLSRKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA LKSAI A
Sbjct  46   DDDLPNARA-----ANLSRKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWAKLKSAICA  100

Query  448  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFL  627
            IFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRIEKECE+HI+ ALQSLVGQS DLVVFL
Sbjct  101  IFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRIEKECESHISAALQSLVGQSPDLVVFL  160

Query  628  SLVEKCWQDFCDQ  666
            SLVE+CWQD CDQ
Sbjct  161  SLVERCWQDLCDQ  173



>ref|XP_008809585.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
 ref|XP_008809586.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
Length=841

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +1

Query  229  PDVDEDPSSASMEDLDSPGASA---TRAATANLSRKKATLPQ--pakklviklvkakpTL  393
            P  +ED      +DL + GAS    T    ANLSRKKAT PQ    K+LVIKLVK KPTL
Sbjct  78   PAEEEDSMLVDQDDLKA-GASTDITTTGVAANLSRKKATPPQPSAKKQLVIKLVKGKPTL  136

Query  394  PTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHI  573
            P NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI+KECE HI
Sbjct  137  PKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRIQKECEVHI  196

Query  574  AVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +  L SLVGQS DLVVFLSLVEKCWQDFCDQ
Sbjct  197  SATLSSLVGQSPDLVVFLSLVEKCWQDFCDQ  227



>ref|XP_003593913.1| Cullin [Medicago truncatula]
 gb|AES64164.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=768

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  330
            MKKAKS +              V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKSSST----------FDDVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  331  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  510
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  511  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQ  178



>ref|XP_003593912.1| Cullin [Medicago truncatula]
 gb|AES64163.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=792

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  330
            MKKAKS +              V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKSSST----------FDDVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  331  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  510
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  511  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQ  178



>ref|XP_003593911.1| Cullin [Medicago truncatula]
Length=794

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 125/172 (73%), Gaps = 15/172 (9%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  330
            MKKAKS +              V F   +D+D     ++  D P   A     ANL+RKK
Sbjct  22   MKKAKSSST----------FDDVVFDSSMDDD-----LKPTDLPRGGAASNMAANLARKK  66

Query  331  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  510
            AT PQPAKKL+I+L K  PT+P+NFE+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDL
Sbjct  67   ATPPQPAKKLLIRLHKGNPTVPSNFEDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDL  126

Query  511  CLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            C+HKMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  127  CIHKMGGNLYQRIEKECEVHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQ  178



>ref|XP_003524860.1| PREDICTED: cullin-4-like [Glycine max]
Length=775

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 126/174 (72%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAKS      +D+  +          V + P++AS    D P A A  AA  NLSR
Sbjct  8    PPMKKAKS------IDSKNDDA--------VLKSPAAAS----DDPNAPALVAA--NLSR  47

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI AIFLKQP  CDLE LYQAVN
Sbjct  48   KKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAIGAIFLKQPVSCDLENLYQAVN  107

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  108  DLCLYKMGGNLYQRIEKECEAHISAALQSLVGQSPDLIVFLSLVERCWQDLCDQ  161



>ref|XP_009101534.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=783

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 133/204 (65%), Gaps = 39/204 (19%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHH---HVHFYPD  234
            S P KRS+    CSA + D +      PPMKK+K            NG H    V F  D
Sbjct  2    SLPTKRST----CSAASTDSSLS---SPPMKKSK------------NGLHASDKVGFSMD  42

Query  235  VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEEN  414
             D  PSSA                 ANLSRKKATLP P KKLVIKL KAKP+LPTNFE+ 
Sbjct  43   EDPAPSSA-----------------ANLSRKKATLPHPTKKLVIKLNKAKPSLPTNFEDT  85

Query  415  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL  594
            TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY+RIEKECE HI+ ALQSL
Sbjct  86   TWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLYERIEKECEEHISSALQSL  145

Query  595  VGQSEDLVVFLSLVEKCWQDFCDQ  666
            VGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  146  VGQDTDLSVFLSLVEKCWQDFCDQ  169



>ref|XP_008383554.1| PREDICTED: cullin-4-like, partial [Malus domestica]
Length=458

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRIEKECE 
Sbjct  7    TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRIEKECER  66

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HIA ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  67   HIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  99



>ref|XP_006398310.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39763.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=539

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 135/201 (67%), Gaps = 23/201 (11%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE  243
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSSYS--SPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
              DL VFLSLVE CWQDFCDQ
Sbjct  159  DTDLSVFLSLVENCWQDFCDQ  179



>ref|XP_006398309.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39762.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=578

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 135/201 (67%), Gaps = 23/201 (11%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE  243
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSS--YSSPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
              DL VFLSLVE CWQDFCDQ
Sbjct  159  DTDLSVFLSLVENCWQDFCDQ  179



>ref|XP_006585082.1| PREDICTED: cullin-4-like isoform X2 [Glycine max]
Length=757

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 119/174 (68%), Gaps = 26/174 (15%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLCL+KMGG+LYQRI KECE HI+VALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  102  DLCLYKMGGNLYQRITKECEEHISVALQSLVGQSPDLIVFLSLVERCWQDLCDQ  155



>ref|XP_003532695.2| PREDICTED: cullin-4-like isoform X1 [Glycine max]
Length=769

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 119/174 (68%), Gaps = 26/174 (15%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLCL+KMGG+LYQRI KECE HI+VALQSLVGQS DL+VFLSLVE+CWQD CDQ
Sbjct  102  DLCLYKMGGNLYQRITKECEEHISVALQSLVGQSPDLIVFLSLVERCWQDLCDQ  155



>emb|CDX77644.1| BnaC07g18980D [Brassica napus]
Length=767

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 106/156 (68%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +1

Query  199  KNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  378
            KNG H     P+   D +  SME+  +P      +A ANLSRKKATLPQP KKLVIKL K
Sbjct  5    KNGLHAPSSQPNA-SDKAVFSMEEDPAP------SAAANLSRKKATLPQPTKKLVIKLNK  57

Query  379  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  558
            AKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV DLCLHK+ G LY+RIEKE
Sbjct  58   AKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVGDLCLHKLEGKLYERIEKE  117

Query  559  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CE HI+ AL+SLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  118  CEEHISAALESLVGQDTDLSVFLSLVEKCWQDFCDQ  153



>ref|XP_006398308.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39761.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=793

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 135/201 (67%), Gaps = 23/201 (11%)
 Frame = +1

Query  64   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDE  243
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSS--YSSPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQ  158

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
              DL VFLSLVE CWQDFCDQ
Sbjct  159  DTDLSVFLSLVENCWQDFCDQ  179



>ref|XP_004486019.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cicer arietinum]
Length=787

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +1

Query  157  KAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKAT  336
            K  S A + S+   K+     H + D   DPSS SM   D   ++A     ANLSRKKAT
Sbjct  6    KRSSGATSTSMKKFKSHSQQQH-HDDAVLDPSSLSMPLDDDLKSNARSVMAANLSRKKAT  64

Query  337  LPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCL  516
             PQP KKL+IK  KAKPTLPTNFEE TWA LKSAI AIFLKQP+ C+ E LYQAV+ LC 
Sbjct  65   PPQPLKKLLIKFHKAKPTLPTNFEEETWANLKSAICAIFLKQPNSCEKENLYQAVSSLCS  124

Query  517  HKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +KMGG+LY+RIEKECE HI+ ALQSLVGQS DLVVFL LVE+CWQD CDQ
Sbjct  125  YKMGGNLYERIEKECEVHISAALQSLVGQSPDLVVFLYLVERCWQDLCDQ  174



>gb|KHN12460.1| Cullin-4 [Glycine soja]
Length=760

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  244  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  423
            D  +A+    D P A A  AA  NLSRKKAT P P KK +I+  K  PTLP NFEE TWA
Sbjct  8    DSKNAAASASDDPNAPALIAA--NLSRKKATPPHPPKKFLIRFHKGVPTLPPNFEEETWA  65

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LKSAI AIF+KQP  CDLE LYQAVNDLCL+KMGG+LYQRI KECE HI+VALQSLVGQ
Sbjct  66   KLKSAIGAIFMKQPVSCDLENLYQAVNDLCLYKMGGNLYQRITKECEEHISVALQSLVGQ  125

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DL+VFLSLVE+CWQD CDQ
Sbjct  126  SPDLIVFLSLVERCWQDLCDQ  146



>ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
Length=791

 Score =   180 bits (456),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 110/174 (63%), Positives = 122/174 (70%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNT-ADKVGFHMEEDPTPAA-------ANLSR  63

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFLKKPFSFDLESLYQAVD  123

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ
Sbjct  124  NLCLHKLEGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQ  177



>emb|CDY43957.1| BnaA02g24350D [Brassica napus]
Length=776

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 124/174 (71%), Gaps = 22/174 (13%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            NG H     P  D+       ED D P  SA     ANLSR
Sbjct  11   PPMKKAK------------NGLHT----PSADKVGFPMEEEDED-PTPSA-----ANLSR  48

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP+KKLVIKL KAKP+LPTNFE+ TW  L+SAI AIFLK P P DLE+LYQAV+
Sbjct  49   KKATLPQPSKKLVIKLNKAKPSLPTNFEDTTWDNLQSAIRAIFLKHPFPFDLERLYQAVD  108

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LCLHK+ G LY+RIEKECE HI+VALQSLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  109  NLCLHKLEGKLYKRIEKECEEHISVALQSLVGQDTDLSVFLSLVEKCWQDFCDQ  162



>ref|XP_006414121.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
 gb|ESQ55574.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
Length=789

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 111/174 (64%), Positives = 122/174 (70%), Gaps = 19/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            NG H      + D D  + SMED  +P A       ANLSR
Sbjct  21   PPMKKAK------------NGLHQTPQSQEDDNDKEAFSMEDDPTPAA-------ANLSR  61

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL KAKPTLPTNFEENTWA L+SAI AIFL +P   D E LYQAV+
Sbjct  62   KKATLPQPTKKLVIKLNKAKPTLPTNFEENTWAKLQSAIQAIFLMKPVTFDFEGLYQAVD  121

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LCLHK+   LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEK WQDFCDQ
Sbjct  122  NLCLHKLEEKLYQQIEKECEEHISAALQSLVGQNTDLSVFLSLVEKRWQDFCDQ  175



>emb|CDY35152.1| BnaA09g17890D [Brassica napus]
Length=786

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 122/175 (70%), Gaps = 29/175 (17%)
 Frame = +1

Query  142  PPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +DLCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  118  DDLCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQ  172



>ref|NP_568658.1| cullin4 [Arabidopsis thaliana]
 sp|Q8LGH4.1|CUL4_ARATH RecName: Full=Cullin-4; Short=AtCUL4 [Arabidopsis thaliana]
 gb|AAM60859.1| cullin [Arabidopsis thaliana]
 gb|AED95353.1| cullin4 [Arabidopsis thaliana]
Length=792

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 107/174 (61%), Positives = 120/174 (69%), Gaps = 19/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCDQ
Sbjct  125  NLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQ  178



>ref|XP_004981510.1| PREDICTED: cullin-4-like isoform X2 [Setaria italica]
Length=831

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 136/223 (61%), Gaps = 23/223 (10%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGHH--  213
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  214  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  363
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  364  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  537
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  538  YQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            Y+RI+KECE HIA  + +LVGQS DLVVFLSLV++ WQDFCDQ
Sbjct  175  YERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTWQDFCDQ  217



>ref|XP_004981509.1| PREDICTED: cullin-4-like isoform X1 [Setaria italica]
Length=839

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 136/223 (61%), Gaps = 23/223 (10%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGHH--  213
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  214  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  363
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  364  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  537
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  538  YQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            Y+RI+KECE HIA  + +LVGQS DLVVFLSLV++ WQDFCDQ
Sbjct  175  YERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTWQDFCDQ  217



>emb|CDY33461.1| BnaA06g36120D [Brassica napus]
Length=761

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 119/162 (73%), Gaps = 17/162 (10%)
 Frame = +1

Query  187  LDTNKNGHHHVHFYPD--VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl  360
            +  +KNG H     P+  +DEDP+ +               A ANLSRKKATLP P KKL
Sbjct  1    MKKSKNGLHAPSSQPNASMDEDPAPS---------------AAANLSRKKATLPHPTKKL  45

Query  361  viklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  540
            VIKL KAKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY
Sbjct  46   VIKLNKAKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLY  105

Query  541  QRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +RIEKECE HI+ ALQSLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  106  ERIEKECEEHISSALQSLVGQDTDLSVFLSLVEKCWQDFCDQ  147



>ref|XP_006836434.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
 gb|ERM99287.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
Length=822

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +1

Query  277  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  456
            S G S T  A ANLSRKKAT PQP KKLVI+  K KP LPTNFEE+TWA LKSAI+AI L
Sbjct  80   SAGCSGTGMA-ANLSRKKATPPQPTKKLVIRPFKDKPKLPTNFEEDTWAKLKSAISAILL  138

Query  457  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLV  636
            KQP  C LE+LYQAVNDLCLHKMGG+LY+RI+KECE HI+  +QSLVGQS DLVVFLSLV
Sbjct  139  KQPVSCSLEELYQAVNDLCLHKMGGNLYKRIQKECEEHISKTIQSLVGQSPDLVVFLSLV  198

Query  637  EKCWQDFCDQ  666
            EKCWQD CDQ
Sbjct  199  EKCWQDLCDQ  208



>gb|KHN46079.1| Cullin-4 [Glycine soja]
Length=764

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = +1

Query  271  LDSPGASA---TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  441
            L SP A++      A   LSRKKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI
Sbjct  16   LKSPAAASDDPNAPALVILSRKKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAI  75

Query  442  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVV  621
             AIFLKQP  CDLE LYQAVNDLCL+KMGG+LYQRIEKECE HI+ ALQSLVGQS DL+V
Sbjct  76   GAIFLKQPVSCDLENLYQAVNDLCLYKMGGNLYQRIEKECEAHISAALQSLVGQSPDLIV  135

Query  622  FLSLVEKCWQDFCDQ  666
            FLSLVE+CWQD CDQ
Sbjct  136  FLSLVERCWQDLCDQ  150



>gb|AAM14063.1| putative cullin [Arabidopsis thaliana]
Length=792

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 106/174 (61%), Positives = 119/174 (68%), Gaps = 19/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKK K            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKTK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCDQ
Sbjct  125  NLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQ  178



>emb|CDX87735.1| BnaC02g32140D [Brassica napus]
Length=780

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 105/156 (67%), Positives = 119/156 (76%), Gaps = 11/156 (7%)
 Frame = +1

Query  199  KNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  378
            KNG H     P  D+      ME+ + P  SA     ANLSRKKATLPQP+KKLVIKL K
Sbjct  22   KNGLH----TPSADK--VGFPMEEEEDPTPSA-----ANLSRKKATLPQPSKKLVIKLNK  70

Query  379  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  558
            AKP+LPTNFE+ TW  L+SAI AIFLK P P DLE+LYQAV++LCLH++ G LY+RIEKE
Sbjct  71   AKPSLPTNFEDTTWDNLQSAIRAIFLKHPFPFDLERLYQAVDNLCLHRLEGKLYKRIEKE  130

Query  559  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CE HI+VALQSLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  131  CEEHISVALQSLVGQDTDLSVFLSLVEKCWQDFCDQ  166



>ref|XP_009114369.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=786

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 121/175 (69%), Gaps = 29/175 (17%)
 Frame = +1

Query  142  PPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            + LCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  118  DALCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQ  172



>ref|XP_010495750.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=743

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 120/174 (69%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQ  177



>ref|XP_010484784.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=784

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 120/174 (69%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQ  177



>gb|KFK31486.1| cullin [Arabis alpina]
Length=793

 Score =   175 bits (444),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 108/176 (61%), Positives = 125/176 (71%), Gaps = 24/176 (14%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHF--YPDVDEDPSSASMEDLDSPGASATRAATANL  318
            PPMKK+K+      L T  +  H  +   +P ++EDP+ A+                ANL
Sbjct  26   PPMKKSKN-----GLHTPPSSQHQSNAAGFP-MEEDPTPAA----------------ANL  63

Query  319  SRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  498
            SRKKATLP P KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE+LYQA
Sbjct  64   SRKKATLPHPTKKLVIKLNKAKPTLPTNFEETTWENLQSAIIAIFLKKPFSFDLERLYQA  123

Query  499  VNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            V++LCLHK+ G LY+RIEKECE HI+ ALQSLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  124  VDNLCLHKLEGKLYERIEKECEEHISAALQSLVGQDTDLSVFLSLVEKCWQDFCDQ  179



>emb|CDY03235.1| BnaC09g19210D [Brassica napus]
Length=790

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 122/178 (69%), Gaps = 32/178 (18%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHH----HVHFYPDVDEDPSSASMEDLDSPGASATRAATA  312
            PPMKK+K            NG H     V F P  DEDP               T +A A
Sbjct  27   PPMKKSK------------NGLHTPSDKVPF-PMEDEDP---------------TPSAAA  58

Query  313  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            NLSRKKATLPQP KKLVIKL KAKPTLPTNFE+ TW  L+SAI AIFLK+P   DLE+LY
Sbjct  59   NLSRKKATLPQPTKKLVIKLNKAKPTLPTNFEDTTWDNLQSAIRAIFLKKPFSFDLERLY  118

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            QAV+DLCLHK+ G LY+R++KECE HI+ AL SLVGQ  DL VFLSLVEKCWQDFCDQ
Sbjct  119  QAVDDLCLHKLEGKLYERMQKECEEHISAALHSLVGQDTDLSVFLSLVEKCWQDFCDQ  176



>ref|XP_010529158.1| PREDICTED: cullin-4 [Tarenaya hassleriana]
Length=788

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 108/175 (62%), Positives = 122/175 (70%), Gaps = 21/175 (12%)
 Frame = +1

Query  142  PPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PPPMKKAK            NG HH    P   +D     M++       + RA  +NLS
Sbjct  23   PPPMKKAK------------NGLHHP---PQPHDDKEVFPMDE------DSARAPASNLS  61

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKKAT PQPAKKLVIKL KAKPTLPTNFEE TW  L+SAI AIF+K+P   DLE LYQAV
Sbjct  62   RKKATPPQPAKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFMKKPVSFDLEGLYQAV  121

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            ++LCLHKM G LYQ+IEKECE HI+ ALQSLVG+S D  VFLSLVEKCWQ+F DQ
Sbjct  122  DNLCLHKMEGKLYQQIEKECEEHISAALQSLVGKSTDFSVFLSLVEKCWQNFSDQ  176



>gb|KHN29857.1| Cullin-4 [Glycine soja]
Length=276

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLPTNFEE+TWA LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMG +L+Q+IEKECE 
Sbjct  7    TLPTNFEEDTWAKLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGVNLHQQIEKECEA  66

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            HI+ ALQSLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  67   HISAALQSLVGQSPDLVVFLSLVERCWQDLCDQ  99



>ref|XP_010441611.1| PREDICTED: cullin-4 [Camelina sativa]
Length=791

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 120/174 (69%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL KAKP+LP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPSLPKNFEETTWQQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            DLC+HK+ G LYQ+IEKECE HI+ ALQSLVGQ+ DL VFLSLVEKCWQDFCDQ
Sbjct  124  DLCMHKLAGKLYQQIEKECEEHISAALQSLVGQNTDLTVFLSLVEKCWQDFCDQ  177



>ref|XP_006281916.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
 gb|EOA14814.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
Length=791

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 119/174 (68%), Gaps = 20/174 (11%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  324
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  325  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KKATLPQP KKLVIKL K KPTLP NFEE TW  L+SAI AIFLK+P    LE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKVKPTLPKNFEETTWENLQSAIRAIFLKKPFSFHLESLYQAVD  123

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            + CLHK+ G LYQ+IEKECE HI+ ALQSLVGQ+ D+ VFLSLVEKCWQDFCDQ
Sbjct  124  NFCLHKLDGKLYQQIEKECEEHISAALQSLVGQNTDMTVFLSLVEKCWQDFCDQ  177



>gb|KFK28509.1| cullin 4 [Arabis alpina]
Length=782

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 9/148 (6%)
 Frame = +1

Query  229  PDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl--viklvkakpTLPTN  402
            P   +D +  SME+   P A       ANLSRKKATLPQP KKL   +  VK KP+LPTN
Sbjct  28   PHSHDDDNDYSMEEDHIPAA-------ANLSRKKATLPQPTKKLVIKLNKVKGKPSLPTN  80

Query  403  FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA  582
            FEE+TWA L+++INAIFL +P P DLE+LYQAV++ CLHK+   LYQRIEKECE HI+ A
Sbjct  81   FEESTWANLQASINAIFLMKPVPYDLERLYQAVDNFCLHKLEEKLYQRIEKECEEHISAA  140

Query  583  LQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LQ+LVGQ+ DL VFLSLVEKCWQDFCDQ
Sbjct  141  LQALVGQNTDLSVFLSLVEKCWQDFCDQ  168



>ref|XP_009128848.1| PREDICTED: cullin-4 [Brassica rapa]
Length=785

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 116/156 (74%), Gaps = 10/156 (6%)
 Frame = +1

Query  199  KNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  378
            KNG H     P  D+       ED D P  SA     ANLSRKKATLPQP+KKLVIKL K
Sbjct  26   KNGLHP----PSADKVGFPMEEEDED-PTPSA-----ANLSRKKATLPQPSKKLVIKLNK  75

Query  379  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  558
            AKP+LPTNFE+ TW  L+SAI AIFLKQP   DLE+LYQAV++LCLHK+ G LYQRI+KE
Sbjct  76   AKPSLPTNFEDTTWDNLQSAIRAIFLKQPFSFDLERLYQAVDNLCLHKLEGKLYQRIQKE  135

Query  559  CETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            CE HI+ ALQSLVGQ  DL VFLSLVE CWQDFCDQ
Sbjct  136  CEEHISAALQSLVGQDTDLSVFLSLVENCWQDFCDQ  171



>emb|CAC85265.1| cullin 4 [Arabidopsis thaliana]
Length=742

 Score =   169 bits (429),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 93/121 (77%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  304  ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLE  483
            A ANLSRKKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE
Sbjct  8    AAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLE  67

Query  484  KLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCD  663
             LYQAV++LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCD
Sbjct  68   SLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCD  127

Query  664  Q  666
            Q
Sbjct  128  Q  128



>gb|EMT18857.1| Cullin-4B [Aegilops tauschii]
Length=758

 Score =   169 bits (428),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka----kpTLPTNFEENTWA  423
            A  ++L +P ASA    TANL RKKATLPQP      +        +P LP NFEE+TWA
Sbjct  4    ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  63

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HI+  + +LVGQ
Sbjct  64   ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHISAKISALVGQ  123

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLV++ WQDFCDQ
Sbjct  124  SPDLVVFLSLVQRTWQDFCDQ  144



>ref|XP_006650698.1| PREDICTED: cullin-4-like [Oryza brachyantha]
Length=829

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 100/188 (53%), Positives = 120/188 (64%), Gaps = 19/188 (10%)
 Frame = +1

Query  151  MKKAK---SQAVACSLDTNKNGHHHVHFYPDV------------DEDPSSASMEDLDSPG  285
            MKKAK   S + +    T KNG   +H  P V            D +   A  E+L +P 
Sbjct  31   MKKAKFPGSSSSSAPGATEKNG---LHVDPAVVARSGGRTNGEEDAEMVLADQEELPAPS  87

Query  286  ASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLKSAINAIFLKQ  462
            AS      ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK AI AIFLKQ
Sbjct  88   ASPPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILKDAITAIFLKQ  147

Query  463  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  642
               CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +LVGQS DLVVFLSLV++
Sbjct  148  KLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISALVGQSPDLVVFLSLVQR  207

Query  643  CWQDFCDQ  666
             WQDFCDQ
Sbjct  208  TWQDFCDQ  215



>dbj|BAK02870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score =   167 bits (424),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 4/141 (3%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka----kpTLPTNFEENTWA  423
            A  ++L +P ASA    TANL RKKATLPQP      +        +P LP NFEE+TWA
Sbjct  78   ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  137

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HI+  + +LVGQ
Sbjct  138  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHISAKISALVGQ  197

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLV++ WQDFCDQ
Sbjct  198  SPDLVVFLSLVQRTWQDFCDQ  218



>ref|XP_003558082.1| PREDICTED: cullin-4 [Brachypodium distachyon]
Length=830

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpT----LPTNFEENTWA  423
            A  ++L +P AS     TANL RKKATLPQP+     +           LP NFEE+TWA
Sbjct  76   ADQDELRAPSASVPGGVTANLFRKKATLPQPSATSATRKPLRIKIGQPKLPKNFEEDTWA  135

Query  424  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ  603
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R++KECE HIA  + +LVGQ
Sbjct  136  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERVKKECEIHIAAKISALVGQ  195

Query  604  SEDLVVFLSLVEKCWQDFCDQ  666
            S DLVVFLSLV + WQDFCDQ
Sbjct  196  SPDLVVFLSLVHRTWQDFCDQ  216



>ref|XP_002466340.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
 gb|EER93338.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
Length=834

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 2/145 (1%)
 Frame = +1

Query  238  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEE  411
            D +   A  ++L +P A A+    ANL RKKATLPQP+       ++   +P LP NFEE
Sbjct  76   DAEMVLADQDELPAPSAPASAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEE  135

Query  412  NTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQS  591
            +TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HIA  + +
Sbjct  136  DTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEIHIAEKISA  195

Query  592  LVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LVGQS DLVVFLSLV++ WQDFCDQ
Sbjct  196  LVGQSPDLVVFLSLVQRTWQDFCDQ  220



>tpg|DAA51790.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=635

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 119/186 (64%), Gaps = 14/186 (8%)
 Frame = +1

Query  151  MKKAKS-QAVACSLDT-NKNGHH--------HVHFYPDVDEDPSSASME--DLDSPGASA  294
            MKKAK   A A S+ T  KNG H              + +ED     ++  +L +P A A
Sbjct  33   MKKAKHPAATASSVGTVEKNGIHLDTAAAAATGGGRTNGEEDAEMVLVDQDELPAPSAPA  92

Query  295  TRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEENTWATLKSAINAIFLKQPD  468
            +    ANL RKKATLPQP+       ++   +P LP NFEE+TW  LK AI AIFLKQ  
Sbjct  93   SAGVAANLFRKKATLPQPSTSARKPLRIRIGQPKLPKNFEEDTWTILKDAITAIFLKQKL  152

Query  469  PCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCW  648
             CD+EKLYQA  DLCLHK+G +LY+RI+KECE HIA  + +LVGQS DLVVFLSLV++ W
Sbjct  153  SCDVEKLYQAAGDLCLHKLGANLYERIKKECEIHIAEKISALVGQSPDLVVFLSLVQRTW  212

Query  649  QDFCDQ  666
            QDFCDQ
Sbjct  213  QDFCDQ  218



>ref|XP_011460204.1| PREDICTED: cullin-4 [Fragaria vesca subsp. vesca]
Length=797

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 110/174 (63%), Gaps = 21/174 (12%)
 Frame = +1

Query  151  MKKAKSQAVACSLDTNKNG-HHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  327
            MKKAKSQ+   S    KNG  HH H   D D+D                 RA   NLSRK
Sbjct  29   MKKAKSQSQPDS----KNGLFHHHHNSSDNDDD---------------GRRAQPDNLSRK  69

Query  328  KATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  504
            KA  PQP KK  +         +P N EE TW  LKSAI AIF K+P  C LE+LYQAV 
Sbjct  70   KAQPPQPGKKQFVIKPFKAKPAVPKNLEEETWEILKSAICAIFEKKPVSCVLEELYQAVY  129

Query  505  DLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +LC+HKMGGSLYQRIEKECE HIA ALQSLVGQS DLVVFLSLVE+CWQD C Q
Sbjct  130  NLCVHKMGGSLYQRIEKECERHIAAALQSLVGQSPDLVVFLSLVERCWQDLCAQ  183



>gb|EEE60060.1| hypothetical protein OsJ_12866 [Oryza sativa Japonica Group]
Length=804

 Score =   162 bits (411),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  432
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  433  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSED  612
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +LVGQS D
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISALVGQSPD  172

Query  613  LVVFLSLVEKCWQDFCDQ  666
            LVVFLSLV++ WQDFCDQ
Sbjct  173  LVVFLSLVQRTWQDFCDQ  190



>gb|AAT75245.1| putative cullin protein [Oryza sativa Japonica Group]
Length=813

 Score =   162 bits (410),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  432
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  433  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSED  612
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +LVGQS D
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISALVGQSPD  172

Query  613  LVVFLSLVEKCWQDFCDQ  666
            LVVFLSLV++ WQDFCDQ
Sbjct  173  LVVFLSLVQRTWQDFCDQ  190



>gb|ABF99238.1| Cullin-4B, putative, expressed [Oryza sativa Japonica Group]
Length=836

 Score =   161 bits (408),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  432
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  85   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  144

Query  433  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSED  612
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +LVGQS D
Sbjct  145  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISALVGQSPD  204

Query  613  LVVFLSLVEKCWQDFCDQ  666
            LVVFLSLV++ WQDFCDQ
Sbjct  205  LVVFLSLVQRTWQDFCDQ  222



>ref|XP_008644442.1| PREDICTED: cullin-4 [Zea mays]
 gb|AFW67428.1| hypothetical protein ZEAMMB73_322823 [Zea mays]
Length=831

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = +1

Query  238  DEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEE  411
            D D    + + L +P   A+    ANL RKKATLPQP+       ++   +P LP NFEE
Sbjct  73   DADMVLVNQDKLPAPSVPASAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEE  132

Query  412  NTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQS  591
            +TW+ LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY RI+KEC  HIA  + +
Sbjct  133  DTWSILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYDRIKKECGIHIAEKISA  192

Query  592  LVGQSEDLVVFLSLVEKCWQDFCDQ  666
            LVGQS DLVVFLSLV++ WQDFCDQ
Sbjct  193  LVGQSPDLVVFLSLVQRTWQDFCDQ  217



>gb|ACA52121.1| cullin 4 [Vitis vinifera]
Length=153

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  451  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLS  630
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRIEKECE+HI  ALQSLVGQS DLVVFLS
Sbjct  1    FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRIEKECESHIRAALQSLVGQSPDLVVFLS  60

Query  631  LVEKCWQDFCDQ  666
            LVEKCWQD CDQ
Sbjct  61   LVEKCWQDLCDQ  72



>ref|XP_001764780.1| predicted protein [Physcomitrella patens]
 gb|EDQ70479.1| predicted protein [Physcomitrella patens]
Length=745

 Score =   153 bits (387),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +1

Query  277  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  456
            SPG       TANLSRKKAT PQPA+KLVIK  K KP LP +FEE TWA L+ A+ AI L
Sbjct  6    SPGI----GTTANLSRKKATPPQPARKLVIKPFKEKPKLPKDFEEVTWAKLREAVTAIHL  61

Query  457  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLV  636
            KQP  C LE+LY+AV DLCLHKM G+LY+R+++ECE+HI+V L+ LVG+S D VVFLS V
Sbjct  62   KQPVNCSLEELYRAVEDLCLHKMAGNLYRRLQQECESHISVKLRDLVGRSPDSVVFLSHV  121

Query  637  EKCWQDFCDQ  666
            E CWQD CDQ
Sbjct  122  ESCWQDHCDQ  131



>ref|XP_010518764.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Tarenaya hassleriana]
Length=788

 Score =   152 bits (385),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 102/175 (58%), Positives = 116/175 (66%), Gaps = 24/175 (14%)
 Frame = +1

Query  142  PPPMKKAKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  321
            PPPMKKAK          N   HH    +P +DED              +   +A ANLS
Sbjct  27   PPPMKKAK----------NGLHHHDKEVFP-MDED-------------PAPAASAAANLS  62

Query  322  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  501
            RKK+T PQPAKKLVIKL KAKP LPTNFEE TWA L+SAI AIF K+    DLE LYQAV
Sbjct  63   RKKSTPPQPAKKLVIKLNKAKPILPTNFEETTWAKLQSAIRAIFKKEAVSFDLEGLYQAV  122

Query  502  NDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            ++LCLHKM G LYQ+IEKECE HI+ AL SLVG+S DL  FLS+V+ CW DF DQ
Sbjct  123  DNLCLHKMEGKLYQQIEKECEDHISAALLSLVGKSTDLSGFLSVVKNCWLDFSDQ  177



>ref|XP_002984123.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
 gb|EFJ14633.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  462
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  463  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  642
            P  C LE+LYQ V DLCLHK+ G+LYQR+++ECETHI+  L +LVGQS D VVFLS VE+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRLQQECETHISAKLNALVGQSPDPVVFLSHVER  144

Query  643  CWQDFCDQ  666
            CWQD CDQ
Sbjct  145  CWQDHCDQ  152



>ref|XP_002972211.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
 gb|EFJ26297.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
Length=766

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  462
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  463  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  642
            P  C LE+LYQ V DLCLHK+ G+LYQR+++ECETHI+  L +LVGQS D VVFLS VE+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRLQQECETHISAKLYALVGQSPDPVVFLSHVER  144

Query  643  CWQDFCDQ  666
            CWQD CDQ
Sbjct  145  CWQDHCDQ  152



>tpg|DAA51791.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=517

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFEE+TW  LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE H
Sbjct  9    LPKNFEEDTWTILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEIH  68

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            IA  + +LVGQS DLVVFLSLV++ WQDFCDQ
Sbjct  69   IAEKISALVGQSPDLVVFLSLVQRTWQDFCDQ  100



>ref|XP_001776334.1| predicted protein [Physcomitrella patens]
 gb|EDQ58833.1| predicted protein [Physcomitrella patens]
Length=768

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +1

Query  274  DSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIF  453
            ++PG       TANLSRKKAT P PAKKLVIK  K KP LP NFEE TW  +K A+ AI 
Sbjct  28   NNPGV----GTTANLSRKKATPPPPAKKLVIKPFKDKPKLPANFEEVTWVKIKEAVTAIH  83

Query  454  LKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSL  633
            LKQP  C LE+LY+AV DLC+HKM G+LY+R++ ECE+HI++ L+ L G+S D VVFLS 
Sbjct  84   LKQPVNCSLEELYRAVEDLCVHKMAGNLYKRLQLECESHISIKLRDLAGRSPDAVVFLSH  143

Query  634  VEKCWQDFCDQ  666
            VE+CWQD C+Q
Sbjct  144  VERCWQDHCNQ  154



>gb|KHG11994.1| Cullin-4 -like protein [Gossypium arboreum]
Length=571

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 108/153 (71%), Gaps = 12/153 (8%)
 Frame = +1

Query  49   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGHHHVHFY  228
            MS P   P KRS      +ATA   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRSI----TNATASSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  52

Query  229  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  399
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  53   QDDNNVLFDPSSMPLHD-DSKSADACAPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  111

Query  400  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  498
            NFE  TWATLKSAI AIFLKQPD CDLEKLYQA
Sbjct  112  NFEVETWATLKSAIIAIFLKQPDSCDLEKLYQA  144



>ref|XP_005825979.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
 gb|EKX38999.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
Length=789

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP  FEE+TW  LK +++A+  +QP     E+LY+AV DLC+HK+G +LY R++ +CE H
Sbjct  89   LPETFEEDTWKKLKMSVHAVHREQPVEQSFEELYKAVEDLCIHKLGPNLYSRLQNDCEEH  148

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   ++SLVGQ +D  +FL  VE CWQ  C+Q
Sbjct  149  IKSEIESLVGQPDDATIFLETVEACWQKHCNQ  180



>gb|EEC76292.1| hypothetical protein OsI_13805 [Oryza sativa Indica Group]
Length=744

 Score =   105 bits (262),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +1

Query  256  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  432
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  433  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKE  558
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI+KE
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKE  154



>emb|CBJ49182.1| conserved unknown protein [Ectocarpus siliculosus]
Length=750

 Score =   100 bits (248),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP  FE++TW  L+ A+ AI  KQP     E+LY+AV DLC+HKMG +LY R+  EC +H
Sbjct  38   LPEQFEDSTWEMLQRAVVAIQTKQPIDTSREELYRAVEDLCVHKMGANLYDRLRDECGSH  97

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFC  660
                ++SLVGQ+ D   FL LV++ WQD C
Sbjct  98   TRREMESLVGQTPDCNAFLQLVDRNWQDHC  127



>gb|KIZ03018.1| cullin 4 [Monoraphidium neglectum]
Length=404

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFE++TWA L+ A++A+  K+   C LE+LY+AV D+C HKM  SLY+R++  C+ H
Sbjct  30   LPANFEQDTWAKLEDAVDAVHCKRTVACSLEELYRAVEDMCSHKMQDSLYRRLQAACDAH  89

Query  571  IAVALQSLVGQSE-DLVVFLSLVEKCWQDFCDQ  666
            I  A+ +L  Q + D V FL   +  WQD+C Q
Sbjct  90   IQRAMGTLQDQVQLDAVSFLDRADAVWQDYCAQ  122



>ref|XP_005644988.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20444.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=733

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +1

Query  316  LSRKKATLPQpakklvi-klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  492
            +SR KA  PQ A + ++ K +K++P LP +FE  TW  L+ A+ A+  K+P  C LE+LY
Sbjct  1    MSRTKANGPQAAPRKLVIKPLKSRPQLPADFEARTWGKLREAVLAVHAKRPVSCSLEELY  60

Query  493  QAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL-VGQSEDLVVFLSLVEKCWQDFCDQ  666
              V D+CLHKM   LY  ++KEC+ H++  L  L   Q  D V+FL  V  CW+D CDQ
Sbjct  61   GLVEDMCLHKMADRLYVNLQKECDRHVSEQLTKLATDQIMDPVLFLGKVAACWKDHCDQ  119



>gb|KJB66937.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=662

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            MGGSLYQRIEKECE HI+ AL+SLVGQS DLVVFLSLVEKCWQD CDQ
Sbjct  1    MGGSLYQRIEKECEEHISTALRSLVGQSPDLVVFLSLVEKCWQDLCDQ  48



>ref|XP_002947918.1| hypothetical protein VOLCADRAFT_57881 [Volvox carteri f. nagariensis]
 gb|EFJ50906.1| hypothetical protein VOLCADRAFT_57881 [Volvox carteri f. nagariensis]
Length=755

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFEE TW+ L+  I A+  K+P  C LE+LY AV D+C+HKM   LY R+++EC++H
Sbjct  4    LPANFEEATWSKLRDCIMAVHCKRPVSCSLEELYTAVQDMCMHKMADKLYSRLQQECDSH  63

Query  571  IAVALQSLVG-QSEDLVVFLSLVEKCWQDFCDQ  666
            I+  + SL    S + V FL  V   WQD C Q
Sbjct  64   ISAHVSSLSDCLSLEAVPFLDRVAAVWQDHCSQ  96



>ref|XP_001703219.1| cullin [Chlamydomonas reinhardtii]
 gb|EDO96515.1| cullin [Chlamydomonas reinhardtii]
Length=782

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFEE+TW+ L+  I A+  K+P    LE+LY AV D+C+HKM   LY R++KEC+ H
Sbjct  41   LPANFEESTWSKLRDCIIAVHCKRPVSNSLEELYTAVQDMCMHKMADKLYTRLQKECDAH  100

Query  571  IAVALQSLVG-QSEDLVVFLSLVEKCWQDFCDQ  666
            IA  + SL      D V +L  V+  WQD C Q
Sbjct  101  IAAHVGSLGDCLGLDAVPYLDRVDSVWQDHCSQ  133



>ref|XP_006449701.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62941.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=662

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            MGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  1    MGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQ  48



>gb|KDO78193.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=662

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            MGG+LYQRIEKECE HI+ A++SLVGQS DLVVFLSLVE+CWQD CDQ
Sbjct  1    MGGNLYQRIEKECEEHISAAIRSLVGQSPDLVVFLSLVERCWQDLCDQ  48



>ref|XP_002504743.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66001.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP +FEE++W  L +A++A+  K+P     E LY+ V D+CLHK+G  LY R+   CE+H
Sbjct  45   LPADFEEDSWRMLSNAVDAVHQKRPVSESFETLYRRVEDVCLHKLGAGLYARLRASCESH  104

Query  571  IAVALQSLVGQ--SEDLVVFLSLVEKCWQDFCD  663
            +   + +L G+  +ED V FL+ V+  W D CD
Sbjct  105  VRERVATLRGRDGAEDPVAFLNRVDDVWGDHCD  137



>ref|XP_006823839.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like [Saccoglossus 
kowalevskii]
Length=808

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 64/189 (34%), Positives = 89/189 (47%), Gaps = 15/189 (8%)
 Frame = +1

Query  145  PPMKKAKSQAVACSLDTN-------KNGHHHVHFYPDVDEDPSSASMEDLDS----PGAS  291
            P     KS  +   L+TN       +N HH  +      +D  + S    DS    P  S
Sbjct  2    PLTSTEKSPFIKTELETNLKKRRPDENNHHLQNSSKKFRDDSPNESSPMADSTQRRPNFS  61

Query  292  ATRAATANLSRKKATL----PQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  459
            A        + + + L    P   KKLVIK  + KP LP N++E TW  LK A+ AI   
Sbjct  62   ALNPTNNGFTNRTSPLANTKPGSTKKLVIKNFRVKPELPENYQERTWGKLKEAVQAIHKH  121

Query  460  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVE  639
                  LE+LYQAV ++C HKM  SLY +++  CE H+   +   +G S D V +L ++ 
Sbjct  122  TSIKYSLEELYQAVENMCSHKMSASLYDKLKIVCEEHVKAQISLFIGDSTDSVSYLKILN  181

Query  640  KCWQDFCDQ  666
             CW D C Q
Sbjct  182  NCWLDHCRQ  190



>ref|XP_004349795.2| Cullin 4 [Capsaspora owczarzaki ATCC 30864]
Length=837

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+E+ TW  L++A+ A+   +P    LE LY+AV +LCL   G +LY+R+  ECE+H
Sbjct  134  LPPNYEQETWQKLQAAVRAVHEARPIDSYLEVLYEAVENLCLLGGGATLYERLTAECESH  193

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            + +  + L   SED V FLS+V+ CWQ  C+Q
Sbjct  194  LRLEAEKLSVASEDPVTFLSVVDACWQAHCEQ  225



>gb|KJE89856.1| Cullin 4 [Capsaspora owczarzaki ATCC 30864]
Length=833

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+E+ TW  L++A+ A+   +P    LE LY+AV +LCL   G +LY+R+  ECE+H
Sbjct  134  LPPNYEQETWQKLQAAVRAVHEARPIDSYLEVLYEAVENLCLLGGGATLYERLTAECESH  193

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            + +  + L   SED V FLS+V+ CWQ  C+Q
Sbjct  194  LRLEAEKLSVASEDPVTFLSVVDACWQAHCEQ  225



>ref|XP_006598170.1| PREDICTED: cullin-4-like [Glycine max]
Length=123

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  MGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            MG +L+Q+IEKECE HI+ ALQSLVGQS DLVVF SLVE+CWQD CDQ
Sbjct  1    MGVNLHQQIEKECEAHISAALQSLVGQSPDLVVFRSLVERCWQDLCDQ  48



>ref|XP_003729103.1| PREDICTED: cullin-4A-like [Strongylocentrotus purpuratus]
Length=776

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+++ TW  LK A+ AI   +P    LE+LYQAV ++C HKM  SLY ++++ CE H
Sbjct  102  LPANYQQQTWDRLKEAVQAIHKSRPIKYSLEELYQAVENMCSHKMSASLYDQLKEVCEQH  161

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +A        +  D + +L  +  CWQD C Q
Sbjct  162  VASQTGQFTSEMTDSLTYLKQLNTCWQDHCRQ  193



>ref|XP_008171287.1| PREDICTED: cullin-4B isoform X2 [Chrysemys picta bellii]
Length=780

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  43   TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  102

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  103  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  162

Query  655  FCDQ  666
             C Q
Sbjct  163  HCRQ  166



>ref|XP_010139394.1| PREDICTED: cullin-4B [Buceros rhinoceros silvestris]
Length=885

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  KAKP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKAKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  655  FCDQ  666
             C Q
Sbjct  268  HCRQ  271



>ref|XP_009899852.1| PREDICTED: cullin-4B [Picoides pubescens]
Length=887

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKEKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009073198.1| PREDICTED: cullin-4B [Acanthisitta chloris]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_010287736.1| PREDICTED: cullin-4B [Phaethon lepturus]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_003208504.1| PREDICTED: cullin-4B [Meleagris gallopavo]
Length=884

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  147  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  206

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  207  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  266

Query  655  FCDQ  666
             C Q
Sbjct  267  HCRQ  270



>ref|XP_010162624.1| PREDICTED: cullin-4B [Caprimulgus carolinensis]
Length=886

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  655  FCDQ  666
             C Q
Sbjct  269  HCRQ  272



>ref|XP_005022179.1| PREDICTED: cullin-4B [Anas platyrhynchos]
Length=886

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  655  FCDQ  666
             C Q
Sbjct  269  HCRQ  272



>ref|XP_009968477.1| PREDICTED: cullin-4B [Tyto alba]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_010020149.1| PREDICTED: cullin-4B [Nestor notabilis]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009915406.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus albicilla]
 ref|XP_010567268.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus leucocephalus]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009887578.1| PREDICTED: cullin-4B [Charadrius vociferus]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009871272.1| PREDICTED: cullin-4B [Apaloderma vittatum]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009578947.1| PREDICTED: cullin-4B [Fulmarus glacialis]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009487693.1| PREDICTED: cullin-4B [Pelecanus crispus]
 ref|XP_009470592.1| PREDICTED: cullin-4B [Nipponia nippon]
 ref|XP_009634699.1| PREDICTED: cullin-4B [Egretta garzetta]
 ref|XP_009816067.1| PREDICTED: cullin-4B [Gavia stellata]
 ref|XP_009705121.1| PREDICTED: cullin-4B [Cariama cristata]
 ref|XP_010125781.1| PREDICTED: cullin-4B [Chlamydotis macqueenii]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009273579.1| PREDICTED: cullin-4B [Aptenodytes forsteri]
 ref|XP_009329115.1| PREDICTED: cullin-4B [Pygoscelis adeliae]
 ref|XP_010309825.1| PREDICTED: cullin-4B [Balearica regulorum gibbericeps]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_005432498.1| PREDICTED: cullin-4B [Falco cherrug]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_005148357.1| PREDICTED: cullin-4B [Melopsittacus undulatus]
Length=887

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009943501.1| PREDICTED: cullin-4B [Opisthocomus hoazin]
Length=888

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  655  FCDQ  666
             C Q
Sbjct  271  HCRQ  274



>ref|XP_005045907.1| PREDICTED: cullin-4B [Ficedula albicollis]
Length=888

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  655  FCDQ  666
             C Q
Sbjct  271  HCRQ  274



>ref|XP_005504485.1| PREDICTED: cullin-4B [Columba livia]
Length=887

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_008638702.1| PREDICTED: cullin-4B [Corvus brachyrhynchos]
 ref|XP_010405981.1| PREDICTED: cullin-4B [Corvus cornix cornix]
Length=885

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  655  FCDQ  666
             C Q
Sbjct  268  HCRQ  271



>ref|XP_009670270.1| PREDICTED: cullin-4B [Struthio camelus australis]
Length=886

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  209  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  268

Query  655  FCDQ  666
             C Q
Sbjct  269  HCRQ  272



>ref|XP_008491853.1| PREDICTED: cullin-4B [Calypte anna]
Length=887

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_006260081.1| PREDICTED: cullin-4B [Alligator mississippiensis]
Length=890

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  153  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  212

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  213  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  272

Query  655  FCDQ  666
             C Q
Sbjct  273  HCRQ  276



>ref|XP_006028559.1| PREDICTED: cullin-4B [Alligator sinensis]
Length=891

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  154  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  213

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  214  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  273

Query  655  FCDQ  666
             C Q
Sbjct  274  HCRQ  277



>ref|XP_010150094.1| PREDICTED: cullin-4B [Eurypyga helias]
Length=885

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  655  FCDQ  666
             C Q
Sbjct  268  HCRQ  271



>ref|XP_009088610.1| PREDICTED: cullin-4B [Serinus canaria]
Length=887

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_009981623.1| PREDICTED: cullin-4B [Tauraco erythrolophus]
Length=888

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  655  FCDQ  666
             C Q
Sbjct  271  HCRQ  274



>ref|XP_009564621.1| PREDICTED: cullin-4B [Cuculus canorus]
Length=885

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  208  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  267

Query  655  FCDQ  666
             C Q
Sbjct  268  HCRQ  271



>ref|XP_007060188.1| PREDICTED: cullin-4B [Chelonia mydas]
Length=883

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  655  FCDQ  666
             C Q
Sbjct  266  HCRQ  269



>ref|XP_007436244.1| PREDICTED: cullin-4B [Python bivittatus]
Length=908

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  171  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  230

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  231  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  290

Query  655  FCDQ  666
             C Q
Sbjct  291  HCRQ  294



>ref|XP_005484500.1| PREDICTED: cullin-4B [Zonotrichia albicollis]
 ref|XP_005419871.1| PREDICTED: cullin-4B [Geospiza fortis]
 ref|XP_005526275.1| PREDICTED: cullin-4B [Pseudopodoces humilis]
 ref|XP_008928928.1| PREDICTED: cullin-4B [Manacus vitellinus]
Length=887

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_005241130.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Falco peregrinus]
Length=887

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_010206238.1| PREDICTED: cullin-4B [Colius striatus]
Length=888

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  655  FCDQ  666
             C Q
Sbjct  271  HCRQ  274



>ref|XP_002196531.1| PREDICTED: cullin-4B [Taeniopygia guttata]
Length=888

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  211  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  270

Query  655  FCDQ  666
             C Q
Sbjct  271  HCRQ  274



>ref|XP_005307468.2| PREDICTED: cullin-4B isoform X1 [Chrysemys picta bellii]
Length=883

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  655  FCDQ  666
             C Q
Sbjct  266  HCRQ  269



>ref|XP_006115461.1| PREDICTED: cullin-4B [Pelodiscus sinensis]
Length=882

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  145  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  204

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  205  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  264

Query  655  FCDQ  666
             C Q
Sbjct  265  HCRQ  268



>ref|XP_010210224.1| PREDICTED: cullin-4B [Tinamus guttatus]
Length=883

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S D V+FL  ++KCWQD
Sbjct  206  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  265

Query  655  FCDQ  666
             C Q
Sbjct  266  HCRQ  269



>gb|ESA04652.1| hypothetical protein GLOINDRAFT_85233, partial [Rhizophagus irregularis 
DAOM 181602]
Length=769

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+EE TW+ L++A+ AIF  Q     LE+LY+A  +LCLHKM  SLY+R+  E E H
Sbjct  54   LPDNYEEVTWSKLQAAVQAIFNYQRIGTSLEELYKACENLCLHKMAPSLYKRLAGEIEEH  113

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            + V    L     +    L +V KCWQ  C+Q
Sbjct  114  LKVEKTKLENNLNENDTLLIVVNKCWQAHCEQ  145



>ref|XP_004545810.1| PREDICTED: cullin-4B-like [Maylandia zebra]
 ref|XP_005722969.1| PREDICTED: cullin-4B-like [Pundamilia nyererei]
Length=865

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  219

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  251



>ref|XP_003445252.1| PREDICTED: cullin-4B [Oreochromis niloticus]
Length=868

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  163  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  222

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  223  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  254



>ref|XP_005913219.1| PREDICTED: cullin-4B-like [Haplochromis burtoni]
Length=865

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  219

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  251



>ref|XP_009506519.1| PREDICTED: cullin-4B, partial [Phalacrocorax carbo]
Length=719

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  14   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  73

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQD C Q
Sbjct  74   IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQ  105



>ref|XP_011478226.1| PREDICTED: cullin-4B [Oryzias latipes]
Length=860

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  158  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKVSAKLYKQLRAACEDH  217

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  218  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  249



>ref|XP_008935860.1| PREDICTED: cullin-4B [Merops nubicus]
Length=881

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  144  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYIDETWQKLKGAVEAIQNSTSIKY  203

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+   LY+++   CE HI   +      S D V+FL  ++KCWQD
Sbjct  204  NLEELYQAVENLCSYKISSKLYKQLRHICEDHIKAQIHQFREDSLDSVLFLKKIDKCWQD  263

Query  655  FCDQ  666
             C Q
Sbjct  264  HCRQ  267



>ref|XP_006803308.1| PREDICTED: cullin-4B-like [Neolamprologus brichardi]
Length=674

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  159  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQLRAVCEDH  218

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  219  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  250



>dbj|BAB64445.1| hypothetical protein [Macaca fascicularis]
Length=324

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  208  LPENYTDETWQKLKEAVEAIQNSSSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  267

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  268  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  299



>ref|XP_003800032.1| PREDICTED: cullin-4A [Otolemur garnettii]
Length=759

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L+ A+ A+       C+LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  54   LPDNYTQDTWQKLREAVRAVQSSTSVRCNLEELYQAVENLCSHKVSPTLYKQLRQVCEDH  113

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  114  VQAQILQFREDSLDSVLFLKKMNACWQDHCRQ  145



>ref|XP_010764721.1| PREDICTED: cullin-4B [Notothenia coriiceps]
Length=861

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  156  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  215

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   ++     + D V+FL  ++KCWQD C Q
Sbjct  216  IKSQIEQFREDALDSVLFLKKIDKCWQDHCRQ  247



>ref|XP_003229259.1| PREDICTED: cullin-4B [Anolis carolinensis]
Length=897

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  192  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  251

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQD C Q
Sbjct  252  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQ  283



>ref|XP_010730305.1| PREDICTED: cullin-4B [Larimichthys crocea]
Length=893

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  162  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  221

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  222  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  253



>ref|XP_003970600.1| PREDICTED: cullin-4B-like [Takifugu rubripes]
Length=862

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  157  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  216

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  217  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  248



>ref|XP_005799582.1| PREDICTED: cullin-4B-like [Xiphophorus maculatus]
Length=867

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  162  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  221

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  222  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  253



>dbj|BAC41443.3| mKIAA0695 protein [Mus musculus]
Length=737

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  61   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  120

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  121  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  152



>ref|XP_420335.2| PREDICTED: cullin-4B [Gallus gallus]
Length=883

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  178  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  237

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQD C Q
Sbjct  238  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQ  269



>ref|XP_008418856.1| PREDICTED: cullin-4B [Poecilia reticulata]
Length=872

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  167  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  226

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  227  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  258



>ref|XP_007569758.1| PREDICTED: cullin-4B [Poecilia formosa]
Length=868

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  163  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDH  222

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  223  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  254



>ref|XP_008274104.1| PREDICTED: cullin-4B [Stegastes partitus]
Length=870

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  165  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  224

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  225  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  256



>ref|XP_010073509.1| PREDICTED: cullin-4B [Pterocles gutturalis]
Length=885

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  180  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  239

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQD C Q
Sbjct  240  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQ  271



>ref|XP_006877535.1| PREDICTED: cullin-4B isoform X2 [Chrysochloris asiatica]
Length=717

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>ref|XP_004713104.1| PREDICTED: cullin-4B isoform X1 [Echinops telfairi]
Length=893

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +1

Query  247  PSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWAT  426
            PS AS+   +    S+T A++   S+     P  AKKLVIK  K KP LP N+ + TW  
Sbjct  143  PSVASVHHTNGLAKSSTTASSFANSK-----PGSAKKLVIKNFKDKPKLPENYTDETWQK  197

Query  427  LKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQS  606
            LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S
Sbjct  198  LKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEHIKAQIHQFREDS  257

Query  607  EDLVVFLSLVEKCWQDFCDQ  666
             D V+FL  ++KCWQ+ C Q
Sbjct  258  LDSVLFLKKIDKCWQNHCRQ  277



>ref|XP_004713106.1| PREDICTED: cullin-4B isoform X3 [Echinops telfairi]
Length=717

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>ref|XP_004713105.1| PREDICTED: cullin-4B isoform X2 [Echinops telfairi]
Length=891

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +1

Query  247  PSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWAT  426
            PS AS+   +    S+T A++   S+     P  AKKLVIK  K KP LP N+ + TW  
Sbjct  143  PSVASVHHTNGLAKSSTTASSFANSK-----PGSAKKLVIKNFKDKPKLPENYTDETWQK  197

Query  427  LKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQS  606
            LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE HI   +      S
Sbjct  198  LKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEHIKAQIHQFREDS  257

Query  607  EDLVVFLSLVEKCWQDFCDQ  666
             D V+FL  ++KCWQ+ C Q
Sbjct  258  LDSVLFLKKIDKCWQNHCRQ  277



>ref|XP_009556241.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4A [Cuculus canorus]
Length=773

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 69/128 (54%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  462
            GA A+ + T   +    T P    +L++     +P LP N+ ++TW  L  A+ AI    
Sbjct  32   GARASSSTTRQAATALITRPAAGSQLLVFSFTERPKLPDNYTQDTWQKLHEAVEAIQSSI  91

Query  463  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  642
                +LE+LYQAV +LC +K+  +LY+++ + CE H+   +      S D +VFL  + K
Sbjct  92   SIKYNLEELYQAVENLCSYKVSATLYKQLRQVCEDHVKAQILQFREDSLDSLVFLKKINK  151

Query  643  CWQDFCDQ  666
            CWQD C Q
Sbjct  152  CWQDHCRQ  159



>ref|XP_004379638.1| PREDICTED: cullin-4B isoform 2 [Trichechus manatus latirostris]
Length=717

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>ref|XP_008154342.1| PREDICTED: cullin-4B isoform X2 [Eptesicus fuscus]
Length=717

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>ref|XP_007254497.1| PREDICTED: cullin-4B-like [Astyanax mexicanus]
Length=863

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 61/148 (41%), Positives = 77/148 (52%), Gaps = 17/148 (11%)
 Frame = +1

Query  274  DSPGASATRAATANL-------------SRKKATL----PQpakklviklvkakpTLPTN  402
            DSP AS ++A +A L             S   AT     P  AKKLVIK  K KP LP N
Sbjct  102  DSPTASCSKAKSALLAAGVAHHANGLTKSAGSATFTNSKPGAAKKLVIKNFKEKPKLPEN  161

Query  403  FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA  582
            +   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE HI   
Sbjct  162  YTHETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISPKLYKQLRAVCEDHIKAQ  221

Query  583  LQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +      S D V+FL  ++KCWQD C Q
Sbjct  222  IDQFREDSLDSVLFLKKIDKCWQDHCRQ  249



>ref|XP_006632966.1| PREDICTED: cullin-4B-like [Lepisosteus oculatus]
Length=860

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = +1

Query  283  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  462
            G + T   +A  S  K   P  AKKLVIK  K KP LP N+   TW  LK A+ AI    
Sbjct  122  GLTKTSTGSATFSNSK---PGAAKKLVIKNFKEKPKLPENYTNETWQKLKGAVEAIQNST  178

Query  463  PDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEK  642
                +LE+LYQAV +LC HK+  +LY+++   CE HI   +      + D V+FL  ++K
Sbjct  179  SIKYNLEELYQAVENLCSHKISANLYKQLRVVCEDHIKAQIHQFREDALDSVLFLKKIDK  238

Query  643  CWQDFCDQ  666
            CWQD C Q
Sbjct  239  CWQDHCRQ  246



>ref|XP_007891612.1| PREDICTED: cullin-4B [Callorhinchus milii]
Length=847

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  142  LPDNYTNETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKVSANLYKQLRQVCEDH  201

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQD C Q
Sbjct  202  IKAQIHQFREDSLDSVLFLKKIDKCWQDHCRQ  233



>ref|XP_003131149.1| PREDICTED: cullin-4A [Sus scrofa]
Length=761

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE+H
Sbjct  56   LPDNYTQDTWHKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVAPTLYQQLREACESH  115

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V FL  +  CWQD C Q
Sbjct  116  VQAQILQFREDSLDSVFFLKKINTCWQDHCRQ  147



>ref|XP_006003900.1| PREDICTED: cullin-4B [Latimeria chalumnae]
Length=845

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  140  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISSNLYKQLRQVCEDH  199

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  200  IKAQIHQFREDTLDSVLFLKKIDKCWQDHCRQ  231



>ref|XP_006885131.1| PREDICTED: cullin-4B-like isoform X2 [Elephantulus edwardii]
Length=717

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEEH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKSQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>dbj|BAB28222.2| unnamed protein product [Mus musculus]
Length=915

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  210  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  269

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  270  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  301



>ref|XP_005687851.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4A [Capra hircus]
Length=737

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  32   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  91

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  92   VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  123



>ref|XP_001656862.1| AAEL003466-PB [Aedes aegypti]
 ref|XP_001656863.1| AAEL003466-PA [Aedes aegypti]
 gb|EAT45256.1| AAEL003466-PB [Aedes aegypti]
 gb|EAT45257.1| AAEL003466-PA [Aedes aegypti]
Length=759

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +1

Query  388  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET  567
            TLP N++E+TW  L++A+ AI    P    LE+LYQAV ++C HKM   LY  +    E 
Sbjct  51   TLPENYQEHTWQKLRAAVVAIQTSTPIEYSLEELYQAVENMCSHKMDSQLYVNLTALAEQ  110

Query  568  HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            H+   +   + +S D +V+L  + +CWQ  C Q
Sbjct  111  HVKANITPFLAESVDKLVYLKKMNECWQSHCQQ  143



>ref|XP_010981119.1| PREDICTED: cullin-4A [Camelus dromedarius]
Length=761

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  56   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQVCEAH  115

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  116  VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  147



>ref|XP_007530425.1| PREDICTED: cullin-4B isoform X2 [Erinaceus europaeus]
Length=717

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  72   IKSQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  103



>ref|XP_005438905.1| PREDICTED: cullin-4A [Falco cherrug]
Length=822

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/171 (30%), Positives = 87/171 (51%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  AKSQAVACSLDTNKNGHHHVHFYPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKA  333
            ++ +A A SL  + +G +     P +   P++    +  SPGA A   R+A A    +  
Sbjct  41   SRWRAAAASLRLHNHGENGAEPKPTL---PAAGHRAEGKSPGAQAPGERSAPAAGGPEAE  97

Query  334  TLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  513
               + A   ++     +P LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC
Sbjct  98   NRHRGAFNYLLSSFTERPKLPDNYTQDTWQKLHEAVGAIQSSVSIKYNLEELYQAVENLC  157

Query  514  LHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
             +K+  +LY+++ + CE H+   +      S D ++FL  + KCWQD C Q
Sbjct  158  SYKVSATLYKQLRQVCEDHVKAQILPFREDSLDSLLFLKKINKCWQDHCRQ  208



>pdb|4A0C|C Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex
 pdb|4A0C|E Chain E, Structure Of The Cand1-Cul4b-Rbx1 Complex
Length=741

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  36   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  95

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  96   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  127



>ref|NP_001120891.1| cullin 4B [Xenopus (Silurana) tropicalis]
 gb|AAI66184.1| cul4b protein [Xenopus (Silurana) tropicalis]
Length=847

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  142  LPENYTDETWQKLKGAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  201

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  202  IKAQIHQFREDALDSVLFLKKIDKCWQDHCRQ  233



>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
 pdb|4A0L|H Chain H, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic 
Site Containing Dna-Duplex
Length=726

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  21   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  80

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  81   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  112



>ref|XP_006076682.1| PREDICTED: cullin-4A [Bubalus bubalis]
Length=723

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  18   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  77

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  78   VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  109



>dbj|BAE36141.1| unnamed protein product [Mus musculus]
Length=917

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  212  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  271

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  272  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  303



>ref|NP_001116316.1| cullin-4B [Danio rerio]
Length=864

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  159  LPENYTNETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRVVCEDH  218

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  219  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  250



>ref|XP_001510185.3| PREDICTED: cullin-4B [Ornithorhynchus anatinus]
Length=779

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  74   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  133

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++ CWQD C Q
Sbjct  134  IKAQIHQFREDSLDSVLFLKKIDTCWQDHCRQ  165



>ref|XP_005969110.1| PREDICTED: cullin-4A [Pantholops hodgsonii]
Length=729

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  25   LPDNYTQDTWQKLHEAVEAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  84

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  85   VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  116



>ref|XP_008324704.1| PREDICTED: cullin-4B [Cynoglossus semilaevis]
Length=821

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++   CE H
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISAKLYKQLRAVCEDH  219

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      + D V+FL  ++KCWQD C Q
Sbjct  220  IKAQIDQFREDALDSVLFLKKIDKCWQDHCRQ  251



>ref|XP_005998125.1| PREDICTED: cullin-4A [Latimeria chalumnae]
Length=753

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  48   LPDNYTQDTWQKLNEAVRAIQASTSIKYNLEELYQAVENLCSYKVSPTLYKQLRQVCEDH  107

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL+ + KCWQD C Q
Sbjct  108  VKAQIHQFREDSLDSVLFLTKINKCWQDHCRQ  139



>dbj|BAC27992.1| unnamed protein product [Mus musculus]
 gb|AAP84984.1| cullin 4B [Mus musculus]
Length=970

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  265  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  324

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  325  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  356



>gb|EWM25493.1| ubiquitin-protein cullin 4 [Nannochloropsis gaditana]
Length=828

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/96 (42%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP NFE+ TW  L+ A+ A+  K       E+LY+AV +LC+HKMG  LY R+  EC  H
Sbjct  53   LPENFEDATWEVLRQAVVAVQSKTAVAISYEELYRAVENLCVHKMGARLYDRLRMECARH  112

Query  571  IAVALQSLV-GQSE---DLVVFLSLVEKCWQDFCDQ  666
            +A  + +L  G  E   D  +FL+ V+  WQD C+ 
Sbjct  113  VAAVVGTLASGGVEGFMDPALFLAKVDDVWQDHCEH  148



>ref|XP_006218259.1| PREDICTED: cullin-4A [Vicugna pacos]
Length=742

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  55   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQVCEAH  114

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  115  VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  146



>ref|NP_001103612.1| cullin-4B [Mus musculus]
 ref|NP_082564.3| cullin-4B [Mus musculus]
 sp|A2A432.1|CUL4B_MOUSE RecName: Full=Cullin-4B; Short=CUL-4B [Mus musculus]
 gb|EDL29019.1| cullin 4B [Mus musculus]
Length=970

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  265  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH  324

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  325  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  356



>ref|XP_009196472.1| PREDICTED: cullin-4B isoform X5 [Papio anubis]
 ref|XP_009437857.1| PREDICTED: cullin-4B isoform X3 [Pan troglodytes]
Length=719

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_010950632.1| PREDICTED: cullin-4A [Camelus bactrianus]
Length=762

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  56   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQVCEAH  115

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  116  VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  147



>ref|XP_004022403.1| PREDICTED: cullin-4B isoform 2 [Ovis aries]
 ref|XP_005891590.1| PREDICTED: cullin-4B isoform X3 [Bos mutus]
 ref|XP_005954003.1| PREDICTED: cullin-4B-like isoform X3 [Pantholops hodgsonii]
 ref|XP_006191374.1| PREDICTED: cullin-4B-like isoform X3 [Camelus ferus]
 ref|XP_006215963.1| PREDICTED: cullin-4B isoform X3 [Vicugna pacos]
 ref|XP_008017655.1| PREDICTED: cullin-4B isoform X8 [Chlorocebus sabaeus]
 ref|XP_008988098.1| PREDICTED: cullin-4B isoform X6 [Callithrix jacchus]
 ref|XP_009196474.1| PREDICTED: cullin-4B isoform X7 [Papio anubis]
 ref|XP_009437859.1| PREDICTED: cullin-4B isoform X4 [Pan troglodytes]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_005319407.1| PREDICTED: cullin-4B isoform X2 [Ictidomys tridecemlineatus]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_004685824.1| PREDICTED: cullin-4B isoform X2 [Condylura cristata]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>gb|EAX11877.1| cullin 4B, isoform CRA_b [Homo sapiens]
 dbj|BAH12944.1| unnamed protein product [Homo sapiens]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_004285635.1| PREDICTED: cullin-4B isoform 2 [Orcinus orca]
 ref|XP_004325657.1| PREDICTED: cullin-4B-like isoform 2 [Tursiops truncatus]
 ref|XP_007464487.1| PREDICTED: cullin-4B isoform X2 [Lipotes vexillifer]
Length=717

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_008988097.1| PREDICTED: cullin-4B isoform X5 [Callithrix jacchus]
Length=738

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  12   LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  71

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  +++CWQ+ C Q
Sbjct  72   IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQ  103



>ref|XP_004012417.1| PREDICTED: cullin-4A [Ovis aries]
Length=740

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  35   LPDNYTQDTWQKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  94

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  95   VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  126



>gb|EGW01006.1| Cullin-4B [Cricetulus griseus]
Length=834

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct  129  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH  188

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            I   +      S D V+FL  ++KCWQ+ C Q
Sbjct  189  IRAQIHQFREDSLDSVLFLKKIDKCWQNHCRQ  220



>gb|KFW86599.1| Cullin-4B [Manacus vitellinus]
Length=887

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  474
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  475  DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQD  654
            +LE+LYQAV +LC +K+  +LY+++ + CE HI   +         +V+FL  ++KCWQD
Sbjct  210  NLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREYPFLVVLFLKKIDKCWQD  269

Query  655  FCDQ  666
             C Q
Sbjct  270  HCRQ  273



>ref|XP_006883869.1| PREDICTED: cullin-4A [Elephantulus edwardii]
Length=762

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct  57   LPDNYTQDTWQKLHEAVKAIQSSTSIKYNLEELYQAVENLCSHKVSSTLYRQLHQVCEDH  116

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  117  VQAQILQFREDSLDSVLFLKKINTCWQDHCRQ  148



>ref|XP_010829841.1| PREDICTED: cullin-4A, partial [Bison bison bison]
Length=727

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  33   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  92

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  93   VQAQILQFREDSLDSVLFLKKMNTCWQDHCRQ  124



>tpg|DAA23688.1| TPA: cullin 4A [Bos taurus]
Length=723

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  18   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  77

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  78   VQAQILQFREDSLDSVLFLKKMNTCWQDHCRQ  109



>ref|XP_875362.3| PREDICTED: cullin-4A [Bos taurus]
 ref|XP_002692061.2| PREDICTED: cullin-4A [Bos taurus]
Length=738

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  391  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH  570
            LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC HK+  +LYQ++ + CE H
Sbjct  33   LPDNYTQDTWQKLHEAVRAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYQQLRQACEGH  92

Query  571  IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQ  666
            +   +      S D V+FL  +  CWQD C Q
Sbjct  93   VQAQILQFREDSLDSVLFLKKMNTCWQDHCRQ  124



Lambda      K        H        a         alpha
   0.313    0.127    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960