BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021G01

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                301   8e-98   Erythranthe guttata [common monkey flower]
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    288   8e-93   Sesamum indicum [beniseed]
emb|CDP01043.1|  unnamed protein product                                276   8e-88   Coffea canephora [robusta coffee]
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             271   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    271   5e-86   Glycine max [soybeans]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             270   8e-86   
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    270   2e-85   Prunus mume [ume]
gb|AFK47008.1|  unknown                                                 269   2e-85   Lotus japonicus
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             269   5e-85   Phaseolus vulgaris [French bean]
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             266   3e-84   Prunus persica
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               266   3e-84   Glycine soja [wild soybean]
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    265   5e-84   Cicer arietinum [garbanzo]
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    266   5e-84   Vitis vinifera
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    265   1e-83   Populus euphratica
gb|KDO80936.1|  hypothetical protein CISIN_1g018003mg                   258   9e-83   Citrus sinensis [apfelsine]
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             259   2e-82   
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        260   4e-82   Medicago truncatula
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   258   2e-81   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             259   2e-81   
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   259   3e-81   Citrus sinensis [apfelsine]
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    258   5e-81   
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   258   7e-81   Citrus sinensis [apfelsine]
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    258   9e-81   Eucalyptus grandis [rose gum]
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    255   5e-80   Nelumbo nucifera [Indian lotus]
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    247   5e-77   Fragaria vesca subsp. vesca
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    246   2e-76   
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    248   3e-76   
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         242   8e-75   Jatropha curcas
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    242   1e-74   
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    241   2e-74   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    240   7e-74   
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    235   3e-72   
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    234   5e-72   
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    234   7e-72   Eucalyptus grandis [rose gum]
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    234   1e-71   Eucalyptus grandis [rose gum]
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             233   2e-71   Eutrema salsugineum [saltwater cress]
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    233   3e-71   
ref|XP_002889176.1|  predicted protein                                  232   5e-71   
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    231   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    230   4e-70   
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    229   4e-70   
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     228   5e-70   Eucalyptus grandis [rose gum]
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             229   6e-70   
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    228   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    228   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    226   9e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    225   1e-68   
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...    223   2e-68   
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    225   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    225   4e-68   Camelina sativa [gold-of-pleasure]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    224   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    224   8e-68   Tarenaya hassleriana [spider flower]
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    224   9e-68   
gb|KJB59929.1|  hypothetical protein B456_009G281700                    223   1e-67   Gossypium raimondii
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    223   1e-67   Brassica rapa
emb|CDY26853.1|  BnaA02g18780D                                          223   2e-67   Brassica napus [oilseed rape]
emb|CDY14625.1|  BnaC02g24880D                                          220   2e-66   Brassica napus [oilseed rape]
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    220   2e-66   
gb|KHG01878.1|  hypothetical protein F383_23026                         220   3e-66   Gossypium arboreum [tree cotton]
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    215   2e-65   
gb|KJB59930.1|  hypothetical protein B456_009G281700                    214   4e-65   Gossypium raimondii
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    215   2e-64   Elaeis guineensis
emb|CDX88421.1|  BnaC06g38650D                                          215   3e-64   
gb|KJB59931.1|  hypothetical protein B456_009G281700                    214   4e-64   Gossypium raimondii
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    214   6e-64   Phoenix dactylifera
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    212   3e-63   Cucumis melo [Oriental melon]
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    209   5e-63   
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    209   2e-62   
ref|XP_010105909.1|  putative methyltransferase                         207   2e-62   
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    209   2e-62   
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    209   4e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    209   1e-61   
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    206   2e-61   Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    206   2e-61   
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    206   6e-61   Brassica rapa
emb|CDX87473.1|  BnaA07g34000D                                          206   1e-60   
emb|CBI25578.3|  unnamed protein product                                200   7e-59   Vitis vinifera
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    200   8e-59   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    200   8e-59   Vitis vinifera
emb|CDP10502.1|  unnamed protein product                                200   1e-58   Coffea canephora [robusta coffee]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    200   2e-58   Setaria italica
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    198   5e-58   Populus euphratica
gb|KJB14720.1|  hypothetical protein B456_002G140100                    199   6e-58   Gossypium raimondii
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    197   1e-57   
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    197   2e-57   
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    196   3e-57   Elaeis guineensis
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    196   3e-57   Solanum tuberosum [potatoes]
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    196   6e-57   Nicotiana sylvestris
gb|KJB53959.1|  hypothetical protein B456_009G013400                    193   6e-57   Gossypium raimondii
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    195   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    195   8e-57   
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          195   9e-57   Sorghum bicolor [broomcorn]
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   193   2e-56   Citrus sinensis [apfelsine]
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             194   2e-56   Citrus clementina [clementine]
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   193   2e-56   Citrus sinensis [apfelsine]
gb|ABR16838.1|  unknown                                                 194   2e-56   Picea sitchensis
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   193   2e-56   Citrus sinensis [apfelsine]
ref|XP_002324579.2|  methyltransferase-related family protein           194   2e-56   
gb|KJB53958.1|  hypothetical protein B456_009G013400                    194   3e-56   Gossypium raimondii
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   194   3e-56   Citrus sinensis [apfelsine]
gb|ACJ84583.1|  unknown                                                 194   3e-56   Medicago truncatula
gb|AFK46366.1|  unknown                                                 194   3e-56   Medicago truncatula
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    192   4e-56   Setaria italica
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    193   5e-56   Solanum lycopersicum
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    193   5e-56   Solanum lycopersicum
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    192   7e-56   Sesamum indicum [beniseed]
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    192   7e-56   
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    192   7e-56   Populus euphratica
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    192   8e-56   Fragaria vesca subsp. vesca
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          192   1e-55   Sorghum bicolor [broomcorn]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    192   1e-55   Setaria italica
ref|NP_001132053.1|  uncharacterized LOC100193465                       192   1e-55   Zea mays [maize]
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        192   2e-55   Zea mays [maize]
gb|ACF85541.1|  unknown                                                 192   2e-55   Zea mays [maize]
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    191   2e-55   Solanum tuberosum [potatoes]
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    191   3e-55   Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    191   3e-55   Fragaria vesca subsp. vesca
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         191   3e-55   Jatropha curcas
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    189   4e-55   
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    191   5e-55   Vitis vinifera
ref|XP_010099510.1|  putative methyltransferase                         190   7e-55   Morus notabilis
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    190   9e-55   Zea mays [maize]
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    190   1e-54   Brachypodium distachyon [annual false brome]
gb|KJB27062.1|  hypothetical protein B456_004G275300                    189   1e-54   Gossypium raimondii
gb|KJB27061.1|  hypothetical protein B456_004G275300                    189   1e-54   Gossypium raimondii
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    190   1e-54   
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    190   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    189   2e-54   Glycine max [soybeans]
gb|EEC83568.1|  hypothetical protein OsI_29220                          189   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    189   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306578.1|  methyltransferase-related family protein           186   3e-54   
ref|NP_001061786.1|  Os08g0411200                                       189   3e-54   
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...    187   4e-54   
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          188   5e-54   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    187   5e-54   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    188   5e-54   Elaeis guineensis
gb|EEE68668.1|  hypothetical protein OsJ_27281                          189   5e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006381066.1|  methyltransferase-related family protein           187   6e-54   
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    187   1e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB53960.1|  hypothetical protein B456_009G013400                    186   1e-53   Gossypium raimondii
gb|EMT07919.1|  Putative methyltransferase                              187   2e-53   
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    187   2e-53   Cicer arietinum [garbanzo]
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                186   2e-53   Erythranthe guttata [common monkey flower]
gb|KHG21340.1|  hypothetical protein F383_03824                         188   2e-53   Gossypium arboreum [tree cotton]
gb|KHG26587.1|  hypothetical protein F383_01046                         186   4e-53   Gossypium arboreum [tree cotton]
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               185   8e-53   Glycine soja [wild soybean]
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             184   2e-52   Prunus persica
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    184   2e-52   Pyrus x bretschneideri [bai li]
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            183   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    183   3e-52   
dbj|BAJ94151.1|  predicted protein                                      183   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              181   3e-52   
ref|NP_001242875.1|  uncharacterized protein LOC100798970               183   4e-52   
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                     180   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    183   4e-52   Tarenaya hassleriana [spider flower]
dbj|BAJ91607.1|  predicted protein                                      183   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   182   7e-52   Citrus sinensis [apfelsine]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    181   1e-51   
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    180   1e-51   Wolffia arrhiza
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    182   1e-51   
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...    179   1e-51   Eucalyptus grandis [rose gum]
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    182   2e-51   Eucalyptus grandis [rose gum]
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             181   2e-51   Selaginella moellendorffii
gb|EMT30153.1|  Putative methyltransferase                              182   3e-51   
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660    187   3e-51   
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    181   3e-51   
emb|CDY57579.1|  BnaC04g56820D                                          180   5e-51   Brassica napus [oilseed rape]
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   177   7e-51   Citrus sinensis [apfelsine]
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    180   7e-51   Brassica rapa
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             176   8e-51   
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                     178   1e-50   Eucalyptus grandis [rose gum]
ref|NP_001058196.1|  Os06g0646000                                       179   1e-50   
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    179   1e-50   Cucumis melo [Oriental melon]
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    179   1e-50   Cucumis melo [Oriental melon]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                     177   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    178   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    178   2e-50   Glycine max [soybeans]
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    178   3e-50   
ref|XP_001778776.1|  predicted protein                                  176   5e-50   
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             177   8e-50   Eutrema salsugineum [saltwater cress]
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    176   1e-49   Cucumis sativus [cucumbers]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       176   2e-49   Cucumis sativus [cucumbers]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             176   2e-49   Capsella rubella
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    176   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    175   5e-49   Camelina sativa [gold-of-pleasure]
ref|NP_181637.2|  uncharacterized methyltransferase                     175   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    174   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    172   2e-48   Fragaria vesca subsp. vesca
dbj|BAF93193.1|  putative methyltransferase-like                        167   3e-48   Hordeum vulgare [barley]
emb|CDY06948.1|  BnaA04g23670D                                          178   5e-48   
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    172   6e-48   Arabis alpina [alpine rockcress]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             172   9e-48   
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800          165   1e-46   
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    166   3e-46   
gb|EMT00494.1|  Putative methyltransferase                              170   8e-46   
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               161   4e-45   Glycine soja [wild soybean]
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    161   7e-45   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        160   3e-44   Medicago truncatula
gb|EMT14235.1|  Putative methyltransferase                              163   1e-43   
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    155   1e-41   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    155   1e-41   
gb|KGN60339.1|  hypothetical protein Csa_3G895850                       144   2e-38   Cucumis sativus [cucumbers]
gb|AAD12007.1|  hypothetical protein                                    144   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    145   9e-38   
ref|XP_010042876.1|  PREDICTED: uncharacterized methyltransferase...    140   9e-38   
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...    142   1e-36   Coccomyxa subellipsoidea C-169
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             137   1e-34   Volvox carteri f. nagariensis
ref|XP_001694737.1|  predicted protein                                  135   2e-34   Chlamydomonas reinhardtii
emb|CAN77779.1|  hypothetical protein VITISV_004172                     139   7e-34   Vitis vinifera
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857              129   6e-32   
ref|XP_009595293.1|  PREDICTED: uncharacterized methyltransferase...    119   2e-29   Nicotiana tomentosiformis
ref|XP_009595292.1|  PREDICTED: uncharacterized methyltransferase...    119   2e-29   Nicotiana tomentosiformis
gb|AFW76187.1|  hypothetical protein ZEAMMB73_680706                    118   6e-29   
dbj|BAC99645.1|  hypothetical protein                                   120   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EPS57983.1|  hypothetical protein M569_16834                         110   7e-27   Genlisea aurea
gb|ACF86599.1|  unknown                                                 102   4e-23   Zea mays [maize]
ref|XP_003056709.1|  predicted protein                                  105   5e-23   Micromonas pusilla CCMP1545
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                       102   1e-22   Triticum urartu
emb|CDP12319.1|  unnamed protein product                              99.8    2e-22   Coffea canephora [robusta coffee]
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502             104   4e-22   
ref|XP_002500021.1|  predicted protein                                  100   2e-21   Micromonas commoda
ref|XP_007510827.1|  predicted protein                                98.2    1e-20   Bathycoccus prasinos
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369             100   2e-20   
ref|XP_003057905.1|  predicted protein                                95.9    3e-20   Micromonas pusilla CCMP1545
gb|KGN60338.1|  hypothetical protein Csa_3G895840                     94.7    3e-20   Cucumis sativus [cucumbers]
ref|XP_005842697.1|  hypothetical protein CHLNCDRAFT_136276           91.3    6e-19   Chlorella variabilis
ref|XP_005713645.1|  unnamed protein product                          92.4    9e-19   Chondrus crispus [carageen]
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg           90.9    1e-18   
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           90.5    2e-18   
gb|EJK66010.1|  hypothetical protein THAOC_13088                      93.2    2e-18   Thalassiosira oceanica
ref|XP_002506188.1|  predicted protein                                92.0    2e-18   Micromonas commoda
ref|XP_003080221.1|  methyltransferase-related (ISS)                  91.7    3e-18   Ostreococcus tauri
ref|XP_005536724.1|  hypothetical protein, conserved                  92.0    5e-18   Cyanidioschyzon merolae strain 10D
ref|XP_002185698.1|  predicted protein                                90.5    1e-17   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007514982.1|  predicted protein                                90.1    1e-17   Bathycoccus prasinos
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           89.4    2e-17   Guillardia theta CCMP2712
ref|XP_009602551.1|  PREDICTED: uncharacterized methyltransferase...  84.0    2e-16   
ref|XP_001418638.1|  predicted protein                                84.0    4e-16   Ostreococcus lucimarinus CCE9901
gb|EWM24600.1|  phosphatidylethanolamine n                            84.7    1e-15   Nannochloropsis gaditana
gb|EEE66113.1|  hypothetical protein OsJ_22149                        83.2    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AFW76188.1|  hypothetical protein ZEAMMB73_680706                  82.0    2e-15   
ref|XP_006473932.1|  PREDICTED: uncharacterized methyltransferase...  80.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 83.6    2e-15   Nannochloropsis gaditana CCMP526
ref|XP_006474605.1|  PREDICTED: uncharacterized methyltransferase...  80.1    4e-15   Citrus sinensis [apfelsine]
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  81.6    2e-14   Ectocarpus siliculosus
ref|XP_002306577.1|  hypothetical protein POPTR_0005s17000g           75.1    1e-13   
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  76.3    5e-13   Galdieria sulphuraria
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           77.0    7e-13   Emiliania huxleyi CCMP1516
ref|XP_008450988.1|  PREDICTED: uncharacterized methyltransferase...  68.6    1e-11   
ref|XP_008462788.1|  PREDICTED: uncharacterized protein LOC103501079  69.3    2e-11   
ref|XP_008450953.1|  PREDICTED: uncharacterized methyltransferase...  68.6    2e-11   
ref|XP_010040340.1|  PREDICTED: uncharacterized methyltransferase...  64.7    7e-10   
gb|KCW45298.1|  hypothetical protein EUGRSUZ_L01042                   63.9    1e-09   Eucalyptus grandis [rose gum]
ref|XP_002503324.1|  chloroplast envelope protein translocase family  67.4    1e-09   Micromonas commoda
gb|KIE07218.1|  hypothetical protein DA73_0239355                     65.1    2e-09   Tolypothrix bouteillei VB521301
ref|WP_006561654.1|  type 11 methyltransferase                        60.8    9e-08   Oscillochloris trichoides
emb|CEF97980.1|  Methyltransferase type 11                            60.8    1e-07   Ostreococcus tauri
ref|XP_003079346.1|  non-transporter ABC protein (ISS)                61.2    2e-07   
gb|EFL22653.1|  methyltransferase domain protein                      60.1    3e-07   Streptomyces himastatinicus ATCC 53653
ref|WP_039937297.1|  hypothetical protein                             59.7    4e-07   Streptomyces himastatinicus
dbj|BAH19476.1|  AT2G41040                                            54.3    4e-06   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA49105.1|  TPA: hypothetical protein ZEAMMB73_519956            53.5    6e-06   
ref|WP_012615803.1|  type 11 methyltransferase                        53.9    3e-05   Chloroflexus aggregans
ref|WP_031116772.1|  MULTISPECIES: hypothetical protein               53.9    3e-05   
ref|WP_040813287.1|  hypothetical protein                             51.6    9e-05   
ref|WP_008743153.1|  methyltransferase                                52.8    9e-05   Streptomyces sp. Mg1
ref|XP_007514207.1|  predicted protein                                50.1    3e-04   Bathycoccus prasinos
ref|WP_012828704.1|  type 11 methyltransferase                        50.1    6e-04   Haliangium ochraceum
ref|WP_037079988.1|  hypothetical protein                             49.3    8e-04   
ref|WP_020404212.1|  hypothetical protein                             49.7    8e-04   Gracilimonas tropica
ref|WP_018127486.1|  hypothetical protein                             49.7    8e-04   Balneola vulgaris



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 180/234 (77%), Gaps = 14/234 (6%)
 Frame = +3

Query  33   MATAGLGY----VSAVLVTRKLGYNS-----KFSFSPLTPKAN---RLFAVKIRALST--  170
            MA AG G     + A L+  +L +N      +   SPL+  A    RLF  K+RA S+  
Sbjct  5    MAIAGTGNNTSSLPAALLPSRLRFNPMPSCLRVVKSPLSIPARIRRRLFTDKVRASSSAA  64

Query  171  TFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYS  350
              +E  P  ++DEKK+ IR N+LACPIC++   WNGD  LSL S+A+S+LEC TC+K YS
Sbjct  65   VVIETTPDPIVDEKKLNIRKNVLACPICFERVIWNGDSNLSLESVARSSLECKTCKKLYS  124

Query  351  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL  530
            G ++H+DLTI GGGK YGE + ASTELFR PLVSFLYERGWRQSFS+WGGFPGPEKEFEL
Sbjct  125  GKDSHLDLTITGGGKVYGEPMPASTELFRFPLVSFLYERGWRQSFSIWGGFPGPEKEFEL  184

Query  531  MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++DYLKPV+GG+IIDASCGSG+FSRLFAKSGLFSLVVALDFSETMLQQCY+FIK
Sbjct  185  IKDYLKPVLGGSIIDASCGSGMFSRLFAKSGLFSLVVALDFSETMLQQCYDFIK  238



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   288 bits (738),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            RL   ++RA S   VE KP  ++ E K+ IR N+LACPICY+   WNGDP LSL S+A+S
Sbjct  48   RLLTHEVRASSAATVETKPDPVVKETKLNIRKNILACPICYERLIWNGDPDLSLESVARS  107

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
             L+CSTCRK YSG  +H+DLTI G GK YG+ +AASTE+FR PLVSFLYERGWRQSFS W
Sbjct  108  TLQCSTCRKTYSGEGSHLDLTITGRGKVYGDPVAASTEIFRSPLVSFLYERGWRQSFSFW  167

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
            GGFPGPEKE+ L+++YLKPV+GGNIIDASCGSG+FSRLFAKSGLFSLVVALDFSE+MLQQ
Sbjct  168  GGFPGPEKEYVLVKEYLKPVLGGNIIDASCGSGMFSRLFAKSGLFSLVVALDFSESMLQQ  227

Query  675  CYEFIK  692
            CY+FIK
Sbjct  228  CYDFIK  233



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  108  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  287
            F P T K N   A +IRA ST  VE KP  ++DEKK++   N LACPICY    +  D  
Sbjct  38   FIPQTIK-NAFAATRIRATSTLLVETKPDTILDEKKLDSCKNTLACPICYTPLIYTADSS  96

Query  288  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  467
                S A+ NL C TCRK YSGN+TH+DLTI  G K YGEA+ ASTELFR P VSFLYER
Sbjct  97   FPADSAARPNLRCRTCRKAYSGNDTHLDLTITSGSKGYGEAMPASTELFRFPFVSFLYER  156

Query  468  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL  647
            GWRQSFS+WGGFPGPEKEFEL++DYL PV+GG I+DASCGSG+FSRLFAKSGLFSLVVAL
Sbjct  157  GWRQSFSIWGGFPGPEKEFELIKDYLNPVLGGTIVDASCGSGMFSRLFAKSGLFSLVVAL  216

Query  648  DFSETMLQQCYEFIK  692
            DFSE ML+QC EFI 
Sbjct  217  DFSEAMLRQCSEFIN  231



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 168/223 (75%), Gaps = 4/223 (2%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  203
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G KAY +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  179

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            NI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QCYEFIK
Sbjct  180  NILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQCYEFIK  222



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 155/188 (82%), Gaps = 6/188 (3%)
 Frame = +3

Query  147  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  308
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR+PL+SFLYERGWRQ+FS
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRVPLISFLYERGWRQTFS  157

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML  668
            +WGGFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRLFAKSGLFS +VALD+SE ML
Sbjct  158  VWGGFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRLFAKSGLFSFIVALDYSENML  217

Query  669  QQCYEFIK  692
            QQCYEFI+
Sbjct  218  QQCYEFIQ  225



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 168/223 (75%), Gaps = 4/223 (2%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  203
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G KAY +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  179

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            NI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QCYEFIK
Sbjct  180  NILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQCYEFIK  222



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 168/229 (73%), Gaps = 11/229 (5%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLF-----AVKIRALSTTFVE----D  185
            MAT  +G ++   +  +LG NS+     L P    +F     A+  RA ST F+E    D
Sbjct  1    MATV-IGNITPAFLLSRLG-NSRPCVVKLRPCTAPVFRRSFAAITARAASTAFIEVESTD  58

Query  186  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  365
                ++  +      N+LACPIC+D F+ + DPGLS++S + S+ +CSTC+K Y GN+TH
Sbjct  59   TNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASGSSFQCSTCKKTYFGNQTH  118

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DLT A G K YGE++  STELFR PLVSFLYERGWRQSFS+WGGFPGPEKEFEL++D+L
Sbjct  119  IDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSVWGGFPGPEKEFELIKDFL  178

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            KPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+Q YEFIK
Sbjct  179  KPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLKQTYEFIK  227



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 166/225 (74%), Gaps = 5/225 (2%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKA-NRLFAVKIRALSTT--FVEDKPVR--  197
            MAT  +      L T  L   ++ +   L+P      F +++RA ST    V+ KP    
Sbjct  1    MATTRIAATGMYLRTPTLSSFTRTTRRRLSPTVFPSKFPLQLRAFSTASPIVDPKPTDSI  60

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  377
            ++D+K+V   +N LACP+C+D+ TW GD GLS+ S+  S+L+CSTC+K Y GN+TH+DLT
Sbjct  61   VVDDKEVRRSSNSLACPVCFDSLTWTGDSGLSVDSIPVSSLQCSTCQKTYVGNQTHLDLT  120

Query  378  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  557
               G K YG+ + ASTELFR+PL+SFLYERGWRQ+FS+WGGFPGPEKEFELM+ +L PV+
Sbjct  121  ATSGAKNYGDLMPASTELFRVPLISFLYERGWRQTFSVWGGFPGPEKEFELMKGFLNPVL  180

Query  558  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GGNIIDASC SGLFSRLFAKSGLFSLVVALD+SE ML QCYEFI+
Sbjct  181  GGNIIDASCASGLFSRLFAKSGLFSLVVALDYSENMLAQCYEFIQ  225



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 4/223 (2%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVE---DKPVRLI  203
            +A AG+  +S  L + K      FS S    K     ++++RA ST  +    +    ++
Sbjct  28   VAVAGMCTLSPTLSSFK-HPTRLFSASDFAAKLRFPPSIRLRASSTAVINTETNSTESVV  86

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
             EK+V    N LACP+CYD+  WNG PGLS+ +++ S+ +C TC+K Y GN+TH+DLT  
Sbjct  87   VEKEVGNSCNSLACPVCYDSLAWNGGPGLSIDTISGSSFQCGTCQKTYVGNQTHIDLTAT  146

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
            GG K+YGE + ASTELFR+PL+SFLYERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GG
Sbjct  147  GGAKSYGETMPASTELFRVPLISFLYERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGG  206

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            NI+DASC SGLFSRLFAKSGLFS VVALD+SE MLQQCYEFI+
Sbjct  207  NIVDASCASGLFSRLFAKSGLFSFVVALDYSENMLQQCYEFIQ  249



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +3

Query  144  AVKIRALSTTFVEDKPVR----LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  311
            A+  RA ST F+E +P      ++  +      N+LACPIC+D F+ + DPGLS++S + 
Sbjct  41   AITARAASTAFIEVEPRDTNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASG  100

Query  312  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  491
            S+ +CSTC+K Y GN+TH+DLT A G K YGE++  STELFR PLVSFLYERGWRQSFS+
Sbjct  101  SSFQCSTCKKTYFGNQTHIDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSV  160

Query  492  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  671
            WGGFPGPEKEFEL +D+LKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE ML+
Sbjct  161  WGGFPGPEKEFELTKDFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLK  220

Query  672  QCYEFIK  692
            Q YEFIK
Sbjct  221  QTYEFIK  227



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 155/189 (82%), Gaps = 7/189 (4%)
 Frame = +3

Query  147  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  308
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR-LPLVSFLYERGWRQSF  485
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR +PL+SFLYERGWRQ+F
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRQVPLISFLYERGWRQTF  157

Query  486  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETM  665
            S+WGGFPGPEKEFELM+ +LKP++GGNIIDASC SGLFSRLFAKSGLFS +VALD+SE M
Sbjct  158  SVWGGFPGPEKEFELMKGFLKPILGGNIIDASCASGLFSRLFAKSGLFSFIVALDYSENM  217

Query  666  LQQCYEFIK  692
            LQQCYEFI+
Sbjct  218  LQQCYEFIQ  226



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 156/195 (80%), Gaps = 5/195 (3%)
 Frame = +3

Query  108  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  287
            F P T K    F ++++A S+T   D      D   V   +N LACPICY++  W  DPG
Sbjct  22   FFPATAK----FPLRLQASSSTAFIDT-TNQTDSVAVTRSSNPLACPICYNSLIWITDPG  76

Query  288  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  467
            LS+ ++ +S+L+CSTC+K Y+GN+TH+DLT+  G K+YGE++ ASTELFR+PL+SFLYER
Sbjct  77   LSVDTIPRSSLQCSTCQKTYNGNQTHLDLTVTSGAKSYGESMPASTELFRMPLISFLYER  136

Query  468  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL  647
            GWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASCGSGLFSRLFAKSGLFS VVAL
Sbjct  137  GWRQTFSVWGGFPGPEKEFELMKSFLKPVLGGNIIDASCGSGLFSRLFAKSGLFSSVVAL  196

Query  648  DFSETMLQQCYEFIK  692
            D+SE ML+QCYEFI+
Sbjct  197  DYSENMLRQCYEFIQ  211



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 159/214 (74%), Gaps = 6/214 (3%)
 Frame = +3

Query  66   VLVTRKLGYNSKFSFSPL--TPKANRLFAVKIRALST---TFVEDKPVRLIDEKKVEIRT  230
            V V  +LG      F PL   P  N +FA K+RA ST     VE KP  +  EK++ I  
Sbjct  11   VFVPGQLGQPRDPFFKPLFSPPTVNFVFAAKLRASSTPAAVVVETKPDPISVEKEISIGK  70

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
            ++LACPICY  FTWNGD GLS+ SM  S+  CS+C+K   GNETH+DLT+A G K Y E+
Sbjct  71   SILACPICYQPFTWNGDLGLSVESMPGSSFHCSSCKKACFGNETHLDLTVATGAKEYDES  130

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
            + A+TE+FR PL+SFLYERGWRQ+F +WGGFPG EKEFEL + YLKPV+GG I+DASCGS
Sbjct  131  MPAATEIFRTPLISFLYERGWRQNF-IWGGFPGLEKEFELAKGYLKPVLGGTIVDASCGS  189

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GLFSR FAKSGLFSLVVALDFSE ML+QCYEFIK
Sbjct  190  GLFSRTFAKSGLFSLVVALDFSENMLRQCYEFIK  223



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 168/223 (75%), Gaps = 4/223 (2%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  203
            MA++ LG +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  31   MASSILGNLSSAFLPSQLSKSSRPLFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  90

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
             EK V    N++ACP+CY+  T  G   LS+ S   S+L CSTC+K YSG ETH++LT+A
Sbjct  91   VEKDVSSSKNIVACPVCYEPVTLIGANVLSVDSARGSSLLCSTCKKTYSGKETHLELTVA  150

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K+Y +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GG
Sbjct  151  SGSKSYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGG  209

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            NI+DASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QCYEF++
Sbjct  210  NILDASCGSGLFSRLFAKSGLFSLVTALDYSENMLKQCYEFVQ  252



>gb|KDO80936.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=232

 Score =   258 bits (660),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 161/200 (81%), Gaps = 3/200 (2%)
 Frame = +3

Query  96   SKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV-RLIDEKKVEIRTNLLACPICYDAFTW  272
            ++F FSP TPK  +L  ++  + STTF++  P   +I EK++   +N LACP+CY++ TW
Sbjct  18   TRFFFSP-TPKL-QLRLLRASSSSTTFLDTNPTDSVIVEKEITRSSNPLACPVCYNSLTW  75

Query  273  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  452
              +P LS+ +++ S+L+CSTC+K Y+ ++TH++LT       YGE++ ASTELFR PLVS
Sbjct  76   TTNPALSIDTISGSSLQCSTCQKTYTSDQTHLELTTISKANNYGESMPASTELFRTPLVS  135

Query  453  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS  632
            FLYERGWRQ+FS+WGGFPGPEKEFE M+ +LKPV+GGNIIDASCGSGLFSRLFAKSGLFS
Sbjct  136  FLYERGWRQTFSVWGGFPGPEKEFEQMKGFLKPVLGGNIIDASCGSGLFSRLFAKSGLFS  195

Query  633  LVVALDFSETMLQQCYEFIK  692
            LVVALD+SE ML+QCYEF++
Sbjct  196  LVVALDYSENMLRQCYEFVQ  215



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGMGTHFDMTAASGSKDYGELMTPTTEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   258 bits (659),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  196

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  197  KSGLFSLVVALDYSENMLKQCYEFVQ  222



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 163/230 (71%), Gaps = 16/230 (7%)
 Frame = +3

Query  51   GYVSAVLVTRKLGYNSKFSFSP-LTPKANRLFAVKIRALST-------TFVEDKPVRL--  200
            G +++V   R+ G + +F+  P  T    +L A  +RA S+        FVE K      
Sbjct  8    GGLASVFAPRRRGSSRRFALKPGETSFQRQLLAPNVRASSSSSSSSSSAFVETKQPPSPP  67

Query  201  ------IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  362
                  +D++K+    N+LACPICY+  T+ GD  LS+ S + S LEC TC+K Y GNET
Sbjct  68   SPPEATVDKEKLGSNQNVLACPICYEPLTFTGDLVLSVDSASGSTLECGTCKKTYVGNET  127

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            H DLT A G K YGE +A STELFR PLVS+LYERGWRQSFS+WGGFPGPEKEFEL + +
Sbjct  128  HFDLTAASGTKEYGEPMALSTELFRTPLVSYLYERGWRQSFSVWGGFPGPEKEFELTKGF  187

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LKPV+GGNI+DASCGSGLFSRLFAKSGLFSLV+ALD+SE ML+QCYEFI+
Sbjct  188  LKPVLGGNIVDASCGSGLFSRLFAKSGLFSLVIALDYSENMLKQCYEFIQ  237



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 150/220 (68%), Gaps = 3/220 (1%)
 Frame = +3

Query  42   AGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVED---KPVRLIDEK  212
            A +  VS V + R++G +      P+       FA  IRA ST    D   KP  ++D  
Sbjct  3    AIISRVSTVFLPRQIGDSRHCFLKPVKTTVRIPFAATIRASSTATSIDFEIKPDVIVDRM  62

Query  213  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  392
            +     ++ ACPICYD  TWNGDPGL +     S  +C TC K Y  N+ ++DLT A G 
Sbjct  63   ESSTSKDIFACPICYDPLTWNGDPGLPVKFTPGSRFQCRTCTKTYFNNKQYLDLTAASGA  122

Query  393  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  572
            K YGE+   STELFR PLVSFLYERGWRQSFS +GGFPGP+KEFE+ +DYLKPV+GG I+
Sbjct  123  KEYGESTPPSTELFRTPLVSFLYERGWRQSFSFFGGFPGPDKEFEMAKDYLKPVLGGKIV  182

Query  573  DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            DASCGSGLFSRLFAKSGLFS VVALDFSE ML+QCY+FI 
Sbjct  183  DASCGSGLFSRLFAKSGLFSSVVALDFSENMLKQCYDFIN  222



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 161/226 (71%), Gaps = 14/226 (6%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTP-----KANRLFAVKIRALSTTFVEDKPVR  197
            MAT  L   S + +  +LG +   SF    P     K +    + +RA ST FVE  P  
Sbjct  1    MATTKL--TSNLSLPSQLGNSRPDSFKLSNPFTVSFKRSSFPTITVRASSTAFVETTPSE  58

Query  198  LID-EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
             I+ + +  I  +LLACPIC+D F+          S + S+ ECSTC+K YS NETH+DL
Sbjct  59   PIEVQNEATICNDLLACPICFDRFS------SKGESGSGSSFECSTCKKTYSSNETHLDL  112

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
            T+A G K YGE++ ASTE FR+PL+SFLYERGWRQSFS+WGGFPGPEKEFEL++D +KPV
Sbjct  113  TLASGAKNYGESMPASTEFFRIPLISFLYERGWRQSFSVWGGFPGPEKEFELIKDCIKPV  172

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +GG+IIDASCGSGLFSRLFAKSGLFS VVALD+SE ML+QCYEFI+
Sbjct  173  LGGSIIDASCGSGLFSRLFAKSGLFSHVVALDYSENMLKQCYEFIE  218



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  165  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  341
            S   VE +P   I  +   I +N +LACPICYD  + +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGALVEVEPTEPIVVQNDGISSNNILACPICYDPLSSSGDPGLSVESASGSSFQCGTCKK  110

Query  342  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  521
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  522  FELMQDYLKPVM-GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FEL +D+LKPV+ GGNIIDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  171  FELTKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKECYGFIQ  228



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = +3

Query  165  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  341
            S   VE +P   I  +   I +N +LACPICYD F+ +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGAVVEVEPTEPIVVQNGGISSNNILACPICYDPFSSSGDPGLSVESASGSSFQCGTCKK  110

Query  342  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  521
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  522  FELMQDYLKPVM-GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FEL++D+LKPV+ GGNIIDASCGSG+FSRLFAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  171  FELIKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYSENMLKECYGFIQ  228



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 4/189 (2%)
 Frame = +3

Query  132  NRLFAVKIRALSTT-FVEDKPVR-LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSM  305
            +R FA KIRA S T FVE KP   ++ EK+     N+LACPICY+  +  GD  LS+ + 
Sbjct  37   HRNFAAKIRASSATAFVETKPADPVVVEKEANTGKNILACPICYEPLSLIGDSVLSVDT-  95

Query  306  AQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  485
            A S L+C  C+K YSG ETH++LT+A G + Y +    +TE FR PL+SFLYERGWRQSF
Sbjct  96   AGSILQCGCCKKSYSGKETHIELTVASGLRTYDDTKPLATEFFRTPLISFLYERGWRQSF  155

Query  486  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETM  665
             +WGGFPGPEKEF+L+++YLKPV+G NIIDASCGSGLFSRLFAKSGLFSLVVALD+SE M
Sbjct  156  -IWGGFPGPEKEFDLIKNYLKPVLGKNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENM  214

Query  666  LQQCYEFIK  692
            L+QCYEFIK
Sbjct  215  LRQCYEFIK  223



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 155/220 (70%), Gaps = 6/220 (3%)
 Frame = +3

Query  51   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  212
            G + +V    +LG + +F   S  T    R+ A K+RA S+ ++E +P        + ++
Sbjct  8    GNLVSVFSASQLGSSRRFVLRSGETSFERRVLAPKLRASSSAYIETRPPPPPLESTVRQE  67

Query  213  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  392
            K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTTTGGT  127

Query  393  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  572
            K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+GGNI+
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLGGNIV  187

Query  573  DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QCYEFI+
Sbjct  188  DASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQCYEFIQ  227



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 163/230 (71%), Gaps = 16/230 (7%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLT-PKANRL-FAVKIRALST-----TFVEDKP  191
            MA A + Y     +  + G + +F F+P T P   R  FA K+RA S+       +E KP
Sbjct  1    MAAATISY----YLPNQFGNSRQFLFNPYTRPIFKRSNFAAKVRASSSTSTSTALLESKP  56

Query  192  VRLIDEKKVEIR---TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  362
               +  +K E+    TN++ACPICY+  +  GD  LS+  + + +L C +C+K Y G ET
Sbjct  57   ADAVVVEKEEVSRSSTNIIACPICYEPLSLIGDRLLSVD-IGECSLRCGSCKKIYYGKET  115

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            H++LT+A G   Y +A+  +TE FRL L+SFLYERGWRQ+F +WGGFPGPEKEFEL++DY
Sbjct  116  HIELTVASGASKYDDAMPLATEFFRLSLISFLYERGWRQNF-IWGGFPGPEKEFELIKDY  174

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LKPV+GGNIIDASCGSGLFSRLFAKSGLFSLVVALD+SE MLQQCY+FIK
Sbjct  175  LKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVVALDYSENMLQQCYDFIK  224



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 163/242 (67%), Gaps = 22/242 (9%)
 Frame = +3

Query  24   LTTMATAGLGYVSAVLVTRKLGYNSKFSFSPLT-PKANRLFAVKIRALSTTFVEDKPVRL  200
            +TT+ T    +  A+  ++  G +++F F P T P   R    K+RA ST FVE KP   
Sbjct  1    MTTVITGN--FRPAIFPSQLNGNSARFLFRPFTTPVFKRSLTAKVRAFSTAFVETKPTEP  58

Query  201  IDEKKVEIR--TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
            + E+K +    +N LACPICYD     G+    + S A SNL+C+TC+K Y GNETH+DL
Sbjct  59   VVEEKEDTGGGSNGLACPICYDPLIRIGESTSYVGSTAGSNLQCNTCKKTYRGNETHLDL  118

Query  375  TIAGGGKAYGEALAASTELF----------------RLPLVSFLYERGWRQSFSLWGGFP  506
              + G K Y E++  +TE+F                + P+VSFLYERGWRQ+F L+GGFP
Sbjct  119  VASSGSKQYDESMPLATEVFSTTWIIYNVALTANVLKTPVVSFLYERGWRQNF-LFGGFP  177

Query  507  GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            GPEKEF++ ++YLKPV+GGNIIDASCGSGLFSRLFAKSGLFSLV ALD+SE ML+QCYEF
Sbjct  178  GPEKEFDMAKNYLKPVLGGNIIDASCGSGLFSRLFAKSGLFSLVFALDYSENMLRQCYEF  237

Query  687  IK  692
            I+
Sbjct  238  IE  239



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 150/229 (66%), Gaps = 15/229 (7%)
 Frame = +3

Query  39   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALST-------TFVED  185
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T       T   D
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  186  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  365
                L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  +
Sbjct  59   SNPDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIY  118

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ + YL
Sbjct  119  LDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAKGYL  177

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            KP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQCY FI 
Sbjct  178  KPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQCYNFIN  226



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 152/232 (66%), Gaps = 18/232 (8%)
 Frame = +3

Query  39   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  182
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  183  DKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  356
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  357  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
              ++DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ +
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAK  177

Query  537  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             YLKP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQCY FI 
Sbjct  178  GYLKPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQCYNFIN  229



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 152/220 (69%), Gaps = 6/220 (3%)
 Frame = +3

Query  51   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  212
            G   +V    +LG + +F   S  T    R+ A K+RA  + +VE +P        + ++
Sbjct  8    GNSVSVFGASQLGSSRQFVLRSGETSFERRVLAPKLRASYSAYVETRPPPPPLESTVRQE  67

Query  213  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  392
            K+    N LACPIC++   + GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLRFTGDPVLSVNSASGSTLQCGTCKKAYVGNETHFDLTTTGGT  127

Query  393  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  572
            K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+GGNI+
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFESLLGSPGPEKEFELIMGFLKPVLGGNIV  187

Query  573  DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QCYEFI+
Sbjct  188  DASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQCYEFIQ  227



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 158/223 (71%), Gaps = 7/223 (3%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKA---NRLFAVKIRALSTTFVEDKPVRLI  203
            MAT       AV    +LG   + +F+ +   +    R+ A ++RA   T   D P+ ++
Sbjct  1    MATLAGSNFLAVARPSQLGPRRRVAFTSVPGSSIFSRRVHAARVRAAVQTATPD-PI-VV  58

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            DEK V  +  +LACPICY   T  G P LS+ ++++S L CSTC+K Y GN+TH++L  +
Sbjct  59   DEK-VASKKGILACPICYHPLTHAG-PALSMDNLSESTLLCSTCKKTYLGNKTHLELVAS  116

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y EA+A +TE FRLPL+S++YERGWRQ FS  GG+PGP+KEFEL++ YL+PV+GG
Sbjct  117  SGAKEYTEAMAPATEFFRLPLISYIYERGWRQGFSAVGGWPGPQKEFELIKGYLEPVLGG  176

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            NIIDASCGSG F+RLF KSGLFSLVVALD+SE ML++CYEFIK
Sbjct  177  NIIDASCGSGPFTRLFTKSGLFSLVVALDYSENMLRECYEFIK  219



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
            +++++K     N+LACPICY++  W   P GL   + + + L+C+TC+K YSGNETH+DL
Sbjct  58   VVEKEKNRGEKNILACPICYNSLAWISQPNGLVEPTASGTQLQCNTCKKSYSGNETHLDL  117

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
             +A G   Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  118  AVASGSNQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  176

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +GGNIIDASCGSG+FSRLFA+S LFSLV+ALD+SE ML+QCYEF+ 
Sbjct  177  LGGNIIDASCGSGMFSRLFARSELFSLVIALDYSENMLRQCYEFLN  222



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 152/232 (66%), Gaps = 18/232 (8%)
 Frame = +3

Query  39   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  182
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  183  DKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  356
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  357  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
              ++DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ +
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAK  177

Query  537  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             YLKP  GG IIDASCGSGLFSRLFAKSG+FSLV+ALDFSE MLQQCY FI 
Sbjct  178  GYLKPSTGGTIIDASCGSGLFSRLFAKSGMFSLVIALDFSENMLQQCYNFIN  229



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
            +I+++K      +LACPICY++  W   P GL  S+ + + L+C+TC++ YSGNETH+DL
Sbjct  60   VIEKEKTRGEKKVLACPICYNSLAWISQPNGLIESATSGTQLQCNTCKRSYSGNETHLDL  119

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
             +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  120  AVASGSKTYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  178

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +GGNIIDASCGSG+FSRLFA+S LFSLV+ALD+SE ML+QCYE + 
Sbjct  179  LGGNIIDASCGSGMFSRLFARSELFSLVIALDYSENMLRQCYELLN  224



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 8/155 (5%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
            N+LACPICYD F+ +GD GLS+        +C TC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDLGLSI-------FQCRTCKKTYFGNETHIDLTTASGAKDYGES  126

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCG  587
               STE+FR PLVS+LYERGWRQSF++WGGFPGPEKEFEL++D+ KPV+ GGN+IDASCG
Sbjct  127  KPISTEMFRTPLVSYLYERGWRQSFNVWGGFPGPEKEFELIKDFFKPVLGGGNVIDASCG  186

Query  588  SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            SG+FSRLFAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  187  SGMFSRLFAKSGLFSLVVALDYSENMLKECYGFIQ  221



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +3

Query  228  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  407
             N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE
Sbjct  73   NNILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGE  132

Query  408  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASC  584
            ++   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDASC
Sbjct  133  SMPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASC  192

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  193  GSGLFSRRFAKSGLFSLVVALDYSENMLKECYGFIQ  228



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +3

Query  228  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  407
             N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE
Sbjct  73   NNILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGE  132

Query  408  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASC  584
            ++   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDASC
Sbjct  133  SMPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASC  192

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  193  GSGLFSRRFAKSGLFSLVVALDYSENMLKECYGFIQ  228



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  201  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  380
            + ++K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT 
Sbjct  4    VRQEKLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTT  63

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
             GG K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+G
Sbjct  64   TGGTKEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLG  123

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNI+DASCGSGLFSRLFAKSGLFS V+ALD+SE ML+QCYEFI+
Sbjct  124  GNIVDASCGSGLFSRLFAKSGLFSRVIALDYSENMLKQCYEFIQ  167



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  380
            + +K      +LACPICY++F W   P GL  S  + + L+C+TC++ YSGNETH+DL +
Sbjct  56   NNEKNRGEKKILACPICYNSFAWISQPNGLVESGASGAQLQCNTCKRSYSGNETHLDLAV  115

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G K Y E +  +TELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  116  ASGSKQYSEPMPLATELFRTPLVSFLYERGWRQNF-VWGGFPGPEKEFEMAKDYLKPVLG  174

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  175  GNIIDASCGSGMFSRLFARSELFSLVVALDYSENMLRQCYELLN  218



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  67   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  126

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  127  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  185

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  186  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  229



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  125

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  126  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  184

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  185  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  228



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   226 bits (577),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 126/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  65   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  124

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  125  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  183

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  184  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  227



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 126/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  125

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  126  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  184

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  185  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  228



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 139/206 (67%), Gaps = 21/206 (10%)
 Frame = +3

Query  81   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVRL-IDEKKVEIRTNLLACPIC  254
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  255  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  434
            Y   TW GD  LS+                  G  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSI------------------GMGTHFDMTAASGSKDYGELMTPTTEFF  119

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDASCGSGLFSR+FA
Sbjct  120  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFA  178

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFSLVVALD+SE ML+QCYEF++
Sbjct  179  KSGLFSLVVALDYSENMLKQCYEFVQ  204



>ref|XP_010534072.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 155/229 (68%), Gaps = 10/229 (4%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTF-VEDKPVR---L  200
            M T   G  S VL+   +  +   SF+ +  +     +  IRA S    +E KP      
Sbjct  3    MLTVIAGRFSPVLLPPGISSSRFSSFNSVARRRTLFVSRSIRASSAAVSIETKPKEDPVP  62

Query  201  IDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS----NLECSTCRKKYSGNETH  365
            + EK+     N+LACPIC+++      P G+ +  + +S    +L+C TC+K YSG ETH
Sbjct  63   VAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIRESTLGTSLQCVTCKKNYSGCETH  122

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGGFPGPE+EFE+ +DYL
Sbjct  123  LDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGGFPGPEREFEMAKDYL  181

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            KP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QCYEF+ 
Sbjct  182  KPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQCYEFVN  230



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  69   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  128

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  129  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  187

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  188  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  231



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 3/164 (2%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  380
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  70   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  129

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  130  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  188

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GNIIDASCGSG+FSRLFA+S LFSLVVALD+SE ML+QCYE + 
Sbjct  189  GNIIDASCGSGMFSRLFARSQLFSLVVALDYSENMLRQCYELLN  232



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 131/170 (77%), Gaps = 4/170 (2%)
 Frame = +3

Query  192  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  362
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LKPV+GGNIIDASCGSG+FSRLF +S LFSLV+ALD+SE ML+QCYE + 
Sbjct  178  LKPVLGGNIIDASCGSGMFSRLFTRSDLFSLVIALDYSENMLRQCYELLN  227



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 155/229 (68%), Gaps = 10/229 (4%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTF-VEDKPVR---L  200
            M T   G  S VL+   +  +   SF+ +  +     +  IRA S    +E KP      
Sbjct  3    MLTVIAGRFSPVLLPPGISSSRFSSFNSVARRRTLFVSRSIRASSAAVSIETKPKEDPVP  62

Query  201  IDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS----NLECSTCRKKYSGNETH  365
            + EK+     N+LACPIC+++      P G+ +  + +S    +L+C TC+K YSG ETH
Sbjct  63   VAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIRESTLGTSLQCVTCKKNYSGCETH  122

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGGFPGPE+EFE+ +DYL
Sbjct  123  LDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGGFPGPEREFEMAKDYL  181

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            KP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QCYEF+ 
Sbjct  182  KPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQCYEFVN  230



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 7/184 (4%)
 Frame = +3

Query  153  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            IRA S    +E KP      + EK+     N+LACPIC+++      P  +  S   ++L
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQP--NGESTLGTSL  100

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGG
Sbjct  101  QCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGG  159

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGPE+EFE+ +DYLKP +GG IIDASCGSG+FSRLFA+SGLFS V+ALD+SE ML+QCY
Sbjct  160  FPGPEREFEMAKDYLKPALGGKIIDASCGSGMFSRLFARSGLFSQVIALDYSENMLRQCY  219

Query  681  EFIK  692
            EF+ 
Sbjct  220  EFVN  223



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 144/205 (70%), Gaps = 10/205 (5%)
 Frame = +3

Query  93   NSKFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LACPICY  257
            +++F F P T     R    K+RA    FVE KP   I  +K E         LACPICY
Sbjct  22   SARFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGGGSCGLACPICY  77

Query  258  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  437
            +  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  78   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  137

Query  438  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAK  617
             P+VSFLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAK
Sbjct  138  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAK  196

Query  618  SGLFSLVVALDFSETMLQQCYEFIK  692
            SGLFS V+ALD+SE MLQQCYEFI+
Sbjct  197  SGLFSQVIALDYSENMLQQCYEFIE  221



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = +3

Query  216  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  392
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGNETH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNETHLDLAVASGS  113

Query  393  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  572
              Y E +  STE+FR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTEIFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  573  DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            DASCGSG+FSRLFA+S LFS VVALD+SE ML+QCY+F+ 
Sbjct  173  DASCGSGMFSRLFARSELFSRVVALDYSENMLKQCYDFLN  212



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = +3

Query  216  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  392
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGN+TH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNDTHLDLAVASGS  113

Query  393  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  572
              Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  573  DASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            DASCGSG+FSRLFA+S LFS VVALD+SE ML+QCY+F+ 
Sbjct  173  DASCGSGMFSRLFARSELFSRVVALDYSENMLKQCYDFLN  212



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  216  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  395
            VE   ++LACPICY++      P   L   A + L+C+TC+  YSGNETH+DL +A G  
Sbjct  54   VEKEKDILACPICYNSLALISQPN-GLVGSAGTQLQCNTCKGSYSGNETHLDLAVASGSN  112

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  575
             Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ ++YLKPV+GGNIID
Sbjct  113  QYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAREYLKPVLGGNIID  171

Query  576  ASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ASCGSG+FSRLFAKS LFS V+ALD+SE ML+QCYEF+ 
Sbjct  172  ASCGSGMFSRLFAKSELFSRVIALDYSENMLKQCYEFLN  210



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 124/156 (79%), Gaps = 8/156 (5%)
 Frame = +3

Query  228  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  407
             N+LACPICYD F+ +GDPGLS+         CSTC+K Y GNETH+DLT A G K YGE
Sbjct  73   NNILACPICYDPFSSSGDPGLSV-------FHCSTCKKTYFGNETHIDLTTASGAKXYGE  125

Query  408  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASC  584
            ++   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDASC
Sbjct  126  SMPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDASC  185

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FAKSGLFSLVVALD+SE ML++CY FI+
Sbjct  186  GSGLFSRRFAKSGLFSLVVALDYSENMLKECYGFIQ  221



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 143/205 (70%), Gaps = 10/205 (5%)
 Frame = +3

Query  93   NSKFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LACPICY  257
            +++F F P T     R    K+RA    FVE KP   I  +K E         LACPICY
Sbjct  22   SAQFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGSGSCGLACPICY  77

Query  258  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  437
            +      D  + + S   +NL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  78   NLLMVITDSPIYVGSTVGTNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  137

Query  438  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAK  617
             P+VSFLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG IIDASCGSG+F+RLFAK
Sbjct  138  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIIDASCGSGMFTRLFAK  196

Query  618  SGLFSLVVALDFSETMLQQCYEFIK  692
            SGLFS V+ALD+SE ML+QCYEFIK
Sbjct  197  SGLFSQVIALDYSENMLRQCYEFIK  221



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 134/185 (72%), Gaps = 8/185 (4%)
 Frame = +3

Query  150  KIRALSTTFVEDKPVRLIDEKKVE----IRTNLLACPICYDAFTWNGDPGLSLSSMAQSN  317
            ++ A S   VE   V LI+   V+      TN+LA PICYD F+   DPGL + S + S+
Sbjct  16   QLAAASGAVVE---VELIEPIMVQNDGISSTNILAGPICYDPFSSXXDPGLFVESASGSS  72

Query  318  LECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWG  497
             +C TC+K Y GNETH+ LT A   K YGE++  + E+FR PLV +LYE+GWRQSF++WG
Sbjct  73   FQCGTCKKTYFGNETHIXLTTASSAKNYGESMPVAXEMFRTPLVLYLYEKGWRQSFTVWG  132

Query  498  GFPGPEKEFELMQDYLKPVM-GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
            GFPG EKEFEL +D+LKPV+ GGNIIDASC SG+F RLFAKSGLFSLVV LD+SE ML +
Sbjct  133  GFPGLEKEFELTKDFLKPVLGGGNIIDASCWSGMFXRLFAKSGLFSLVVDLDYSENMLNE  192

Query  675  CYEFI  689
            CY FI
Sbjct  193  CYGFI  197



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 142/205 (69%), Gaps = 11/205 (5%)
 Frame = +3

Query  81   KLGYNS-KFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICY  257
            +L  NS +F F P T     +F   + A +   VE       +E      +  LACPICY
Sbjct  17   QLSKNSARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICY  67

Query  258  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  437
            +  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  68   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  127

Query  438  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAK  617
             P+VSFLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAK
Sbjct  128  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAK  186

Query  618  SGLFSLVVALDFSETMLQQCYEFIK  692
            SGLFS V+ALD+SE MLQQCYEFI+
Sbjct  187  SGLFSQVIALDYSENMLQQCYEFIE  211



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 130/186 (70%), Gaps = 3/186 (2%)
 Frame = +3

Query  141  FAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
             + +IRA S  T  VE  PV LI + KV    N L CP+CY       +   ++ S A S
Sbjct  31   LSARIRASSSATASVEADPVALIPDAKVSTGINNLGCPVCYYPLISQSNASQTIESTAGS  90

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
             +EC  C+K Y  N T++DLT+AGG K Y E +   TELFR  LVSFLYERGWRQ+F +W
Sbjct  91   YVECHICKKAYFSNGTYLDLTVAGGSKEYTETMPGGTELFRSQLVSFLYERGWRQNF-IW  149

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
            GGFPGP++EFE+ + YL P +GG I+DASCGSGLFSRLFA+SG++SLVVALDFSE ML Q
Sbjct  150  GGFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRLFAESGMYSLVVALDFSENMLLQ  209

Query  675  CYEFIK  692
            C EFIK
Sbjct  210  CDEFIK  215



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 133/184 (72%), Gaps = 6/184 (3%)
 Frame = +3

Query  147  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSLSSMAQ-SNL  320
            +  RA S +      V  + EK+   + N+LACPICY++       P  S  S A  ++L
Sbjct  40   ISARASSASVETKSSVDYVVEKE---KKNILACPICYNSLAALISQPHESAESPASGTHL  96

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C TC K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGWRQ+F +WGG
Sbjct  97   QCKTCNKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGWRQNF-MWGG  155

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGPEKEFE+ ++YLK V+GGNIIDASCGSG+FSRLFAKS  F++V ALD+SE ML+QCY
Sbjct  156  FPGPEKEFEMAKEYLKHVLGGNIIDASCGSGIFSRLFAKSEHFAMVYALDYSENMLRQCY  215

Query  681  EFIK  692
            EF+K
Sbjct  216  EFLK  219



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 140/200 (70%), Gaps = 10/200 (5%)
 Frame = +3

Query  93   NSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTW  272
            +++F F P T     +F   + A +   VE       +E      +  LACPICY+  T 
Sbjct  22   SARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICYNPLTV  72

Query  273  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  452
              D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR P+VS
Sbjct  73   ISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFRTPVVS  132

Query  453  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS  632
            FLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DASCGSG+F+RLFAKSGLFS
Sbjct  133  FLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDASCGSGMFTRLFAKSGLFS  191

Query  633  LVVALDFSETMLQQCYEFIK  692
             V+ALD+SE MLQQCYEFI+
Sbjct  192  QVIALDYSENMLQQCYEFIE  211



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = +3

Query  123  PKANRLFAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  296
            P A    +V+IRA S  T  VE  PV  I + KV    N L CP+CY       +   ++
Sbjct  23   PSAKPPLSVRIRASSSVTASVEANPVDPIPDAKVSTGMNNLGCPVCYYPLISKSNASQTV  82

Query  297  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  476
            +S A S++EC  C+K Y  N  ++DLT++ G K Y E + A TELFR  LVSFLYERGWR
Sbjct  83   ASPAGSDVECHICKKDYFNNGIYLDLTVSSGSKEYTETVPAGTELFRSQLVSFLYERGWR  142

Query  477  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS  656
            Q+F +WGGFPGP++EFE+ + YL P +GG I+DASCGSGLFSRLFA+SG++SLVVALDFS
Sbjct  143  QNF-IWGGFPGPQREFEMAKVYLTPTIGGTIVDASCGSGLFSRLFAESGMYSLVVALDFS  201

Query  657  ETMLQQCYEFIK  692
            E ML QC EFIK
Sbjct  202  ENMLLQCDEFIK  213



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = +3

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  377
            +ID++  +I+ N+LAC IC    T   D GLS+ S     LEC TC+K ++G+E+H+DLT
Sbjct  67   MIDKEVNKIK-NILACSICRGPLTAAADSGLSVESTNGYQLECGTCKKSFTGSESHLDLT  125

Query  378  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  557
            I GG  + GE++ A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+
Sbjct  126  ITGGINS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVL  184

Query  558  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GG+IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QCY FIK
Sbjct  185  GGSIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQCYGFIK  229



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +3

Query  300  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  479
            S++ S+ +C TC+K Y GNETH+DLT A G K YGE+   STE+FR PLVS+LYERGWRQ
Sbjct  33   SVSGSSFQCRTCKKTYFGNETHIDLTTASGAKDYGESKPVSTEMFRTPLVSYLYERGWRQ  92

Query  480  SFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS  656
            SF++WGGFPGPEKEFEL++D+LKPV+ GGNIIDASCGSG+FSRLFAKSGLFSLVVALD+S
Sbjct  93   SFTVWGGFPGPEKEFELIKDFLKPVLGGGNIIDASCGSGMFSRLFAKSGLFSLVVALDYS  152

Query  657  ETMLQQCYEFIK  692
            E ML++CY FI+
Sbjct  153  ENMLKECYGFIQ  164



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
            N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE+
Sbjct  34   NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GES  92

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
            + A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG+IIDASCGS
Sbjct  93   MPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDASCGS  152

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            G+FSR+FAKSGLFS VVALD+SE ML+QCYEFIK
Sbjct  153  GMFSRIFAKSGLFSSVVALDYSENMLRQCYEFIK  186



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            S  S++ S+L+CSTCRK Y G ETH++LT A G K YGE +  +TELFR  LVSFLYERG
Sbjct  6    SRESVSGSSLQCSTCRKTYFGIETHLELTAASGAKNYGEPMPIATELFRTQLVSFLYERG  65

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQSFS+WGGFPGPEKEFEL + +L+PV GGNI+DASCGSGLFSRLFAKSGLFS VVALD
Sbjct  66   WRQSFSVWGGFPGPEKEFELTKKFLEPVFGGNIVDASCGSGLFSRLFAKSGLFSRVVALD  125

Query  651  FSETMLQQCYEFIK  692
            +SE ML+QCYEFI 
Sbjct  126  YSENMLRQCYEFIN  139



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 137/197 (70%), Gaps = 8/197 (4%)
 Frame = +3

Query  114  PLTPKANRLFAVKIRA--LSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDP  284
            P+    +RL +VK  A  L  + +    V  + EK+   +  +LACPICY++       P
Sbjct  16   PIGLSVSRLLSVKYAAQRLPVSVLISARVDYVVEKE---KKKILACPICYNSLAALISQP  72

Query  285  GLSLSSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  461
              S    A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLY
Sbjct  73   HESAEYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLY  132

Query  462  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVV  641
            ERGWRQ+F +WGGFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRLFAKS  F++V 
Sbjct  133  ERGWRQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVY  191

Query  642  ALDFSETMLQQCYEFIK  692
            ALD+SE ML+QCYEF+K
Sbjct  192  ALDYSENMLRQCYEFLK  208



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = +3

Query  147  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLEC  326
            +++R  S   +E  P  +  +K  +   ++L CPICY+  TW+GD  LS+ +++ + L+ 
Sbjct  42   LRLRVSSIAVIETTPESVTTDKNSDTNKSILGCPICYEPLTWSGDSTLSIETVSGTTLQS  101

Query  327  STCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFP  506
             T +K Y  N+   DLT + G K Y E++   TE F  P +S+LYERGWRQ+F L GG+P
Sbjct  102  QTSKKTYYENKFIFDLTTSSGAKDYVESMPLVTEFFSTPFMSYLYERGWRQNFGL-GGYP  160

Query  507  GPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            G +KEFE+ ++Y KPV+GGNI+DASCGSGLFSRLFAKSGLFS VVALD+SE MLQQCYEF
Sbjct  161  GADKEFEMAKEYFKPVLGGNIVDASCGSGLFSRLFAKSGLFSRVVALDYSEAMLQQCYEF  220

Query  687  IK  692
            +K
Sbjct  221  VK  222



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            D +  +I+ N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI 
Sbjct  89   DNEDNKIK-NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTIT  147

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
            GG  + GE++ A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG
Sbjct  148  GGTDS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGG  206

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +IIDASCGSG+FSR+FAKSGLFS VVALD+SE ML+QCYEFIK
Sbjct  207  SIIDASCGSGMFSRIFAKSGLFSSVVALDYSENMLRQCYEFIK  249



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = +3

Query  177  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  356
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  357  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  537  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             YL+P  GG I+DASCGSGLFSRLFAKSG++SLVVALDFSE MLQ C +FIK
Sbjct  136  YYLRPAKGGTIVDASCGSGLFSRLFAKSGIYSLVVALDFSENMLQHCNKFIK  187



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = +3

Query  177  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  356
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  357  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  537  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             YL+P  GG I+DASCGSGLFSRLFAKSG++SLVVALDFSE MLQ C +FIK
Sbjct  136  YYLRPAKGGTIVDASCGSGLFSRLFAKSGIYSLVVALDFSENMLQHCNKFIK  187



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = +3

Query  129  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  296
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  297  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  473
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  474  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDF  653
            RQ+F +WGGFPGPEKEFE+  +YLK V+GGNIIDASCGSGLFSRLFAKS  F++V ALD+
Sbjct  148  RQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVYALDY  206

Query  654  SETMLQQCYEFIK  692
            SE ML+QCYEF+K
Sbjct  207  SENMLRQCYEFLK  219



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 138/193 (72%), Gaps = 9/193 (5%)
 Frame = +3

Query  129  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  296
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  297  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  473
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASATHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  474  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDF  653
            RQ+F +WGGFPGPEKEFE+ +++LK V+GGNIIDASCGSGLFSRLFAKS  F++V ALD+
Sbjct  148  RQNF-MWGGFPGPEKEFEMAKEHLKHVLGGNIIDASCGSGLFSRLFAKSEHFAMVYALDY  206

Query  654  SETMLQQCYEFIK  692
            SE ML+QCYEF+K
Sbjct  207  SENMLRQCYEFLK  219



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  34   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  90

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  91   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  149

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QCY
Sbjct  150  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQCY  209

Query  681  EFIK  692
            +FIK
Sbjct  210  DFIK  213



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QCY
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQCY  211

Query  681  EFIK  692
            +FIK
Sbjct  212  DFIK  215



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 127/184 (69%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML QCY
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLHQCY  211

Query  681  EFIK  692
            +FIK
Sbjct  212  DFIK  215



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 131/201 (65%), Gaps = 5/201 (2%)
 Frame = +3

Query  90   YNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT  269
            YNS  S  PL   + + F   IRA S   +E  P   I E K  ++ +L ACPICYD   
Sbjct  19   YNS-LSHPPLRCSSPQQFRQIIRATSAVALE--PEAQI-ESKEGLKIDLFACPICYDPLV  74

Query  270  WNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV  449
              G  G +L ++ +S  +C TC K YS    ++DLT+  G K Y E   A TELFR PLV
Sbjct  75   RKGPSGFNLPAIYRSGFKCRTCNKTYSSKNIYLDLTVTAGSKDYNEFKPAGTELFRSPLV  134

Query  450  SFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLF  629
            SFLYERGWRQ+F+   GFPGP+ EF++ Q+Y +PV GG ++D SCGSGLFSR FAKSG +
Sbjct  135  SFLYERGWRQNFN-RSGFPGPDDEFKMAQEYFQPVEGGVLVDVSCGSGLFSRKFAKSGTY  193

Query  630  SLVVALDFSETMLQQCYEFIK  692
            S VVALDFSE ML QCY+FIK
Sbjct  194  SKVVALDFSENMLLQCYDFIK  214



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 118/162 (73%), Gaps = 6/162 (4%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  386
            E   E + + LACPICY  F    DP     S   S+LECSTC+K Y   + + DLT+A 
Sbjct  69   EPAPETKLSKLACPICYYPFVSASDP-----SGDASSLECSTCKKVYPNKQDYWDLTVAV  123

Query  387  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  566
            G   Y E+  A+TE+FR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YL P +GG 
Sbjct  124  GSTEYSESKPAATEIFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLNPTIGGT  182

Query  567  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC E++K
Sbjct  183  IVDASCGSGLFSRLFVKSGLYSLVVALDFSENMLKQCNEYVK  224



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 130/204 (64%), Gaps = 9/204 (4%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
             L +NS FS S L   + R F   IRA S   +E        E   +    + ACP+CY+
Sbjct  20   HLSHNSLFSPSRLRFTSLR-FPSTIRATSAVVLEP-------ELSTQQNQAIFACPVCYE  71

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G PG +L ++ QS+ +C  C K YS  + ++DLTI  G K Y E     TELFR 
Sbjct  72   PLIRKGPPGFNLPAIYQSSFKCKKCTKTYSSKDNYLDLTITAGMKDYTEINPVRTELFRS  131

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQSF+   GFPGP++EFE+ Q+Y KP  GG ++D SCGSGLFSR FAKS
Sbjct  132  PLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKPAGGGLLVDVSCGSGLFSRKFAKS  190

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S V+ALDFSE ML+QCY++IK
Sbjct  191  GAYSKVIALDFSENMLRQCYDYIK  214



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 134/221 (61%), Gaps = 41/221 (19%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPV-----------RLIDEKKVEIRTNLLACPICYDAFTWNGDPG  287
             A K+   ST FVE  P             ++ EK+     N+LACPICYD  TW     
Sbjct  40   LAAKVLVSSTAFVETHPTICKQQNLYQWEPVVVEKEDSGSDNVLACPICYDPLTWTVGSP  99

Query  288  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  467
              + S + SNL+  TC+K Y GN+TH+DL  +GG K Y  ++  +TELFR P+VSFLYER
Sbjct  100  SYVGSKSGSNLQSKTCKKSYFGNQTHLDLVASGGSKQYDNSMPLATELFRTPVVSFLYER  159

Query  468  GWRQSFSLWGGFPG----------------------PEKE-------FELMQDYLKPVMG  560
            GWRQ+F ++GGFPG                      P+ E       FE+ + YLKPV+G
Sbjct  160  GWRQNF-IFGGFPGSIMKLFWNIYQNIRIFEASSSYPKVEGRSACLDFEMAKKYLKPVLG  218

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYE  683
            GNI+DASCGSGLFSRLFAKSGLFS VVALD+SE ML+QCYE
Sbjct  219  GNIVDASCGSGLFSRLFAKSGLFSQVVALDYSENMLRQCYE  259



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 128/193 (66%), Gaps = 8/193 (4%)
 Frame = +3

Query  129  ANRLFAVKIRA-LSTTFVEDKPVRLIDEKKVEI----RTNLLACPICYDAFTWNGDPGLS  293
            A R+    +RA  S   V   P  ++ E  VE     + + LACPICY     + D  L 
Sbjct  43   AKRVLRSSLRASASPDVVSTVPDEVVAEPSVEPEAEKKLSKLACPICYYPLASSSDQSLP  102

Query  294  LSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  473
            L+    S+L+CSTC+K Y     + D+T+A G   Y E+   STELFR PLVSFLYERGW
Sbjct  103  LN--VASSLQCSTCKKFYPNRGDYWDMTVAVGSTVYSESTTVSTELFRTPLVSFLYERGW  160

Query  474  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDF  653
            RQ+F +WGGFPGPE+E+E  + YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDF
Sbjct  161  RQNF-IWGGFPGPEREYETAKAYLKPTAGGIIVDASCGSGLFSRLFVKSELYSLVVALDF  219

Query  654  SETMLQQCYEFIK  692
            SE ML+QC EFIK
Sbjct  220  SENMLKQCNEFIK  232



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 129/192 (67%), Gaps = 6/192 (3%)
 Frame = +3

Query  117  LTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  296
            L+P + R F ++  A + T   D  V     K+  +  +LLACPICY+  T  G  GL+L
Sbjct  35   LSPPSLRGFRLRATAAALTVEPDTQV-----KQDSLELDLLACPICYEPLTRKGPSGLNL  89

Query  297  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  476
             ++ +S  +C  C K +S  + ++DLTI  G K Y E     TELFR P+VSFLYERGWR
Sbjct  90   PAIYRSGFKCLKCNKSFSSKDVYLDLTITSGTKEYNEFKPTRTELFRSPIVSFLYERGWR  149

Query  477  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS  656
            Q+F+   GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR FAKSG +S V+ALDFS
Sbjct  150  QNFN-RSGFPGPDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFS  208

Query  657  ETMLQQCYEFIK  692
            E ML+QC+EFIK
Sbjct  209  ENMLRQCFEFIK  220



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = +3

Query  165  STTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKK  344
            S+  VE  P  LI + KV    N+LACPICY +F    +  LS++S   S +EC  C+K 
Sbjct  13   SSPAVEANPEDLIPDTKVGTGLNILACPICYRSFIDQNNSSLSITSPDGSCIECHGCKKA  72

Query  345  YSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEF  524
            Y  N  ++DLTI GG K Y + L   T  FR   +S+LYERGWRQSF  WGGFPG ++E 
Sbjct  73   YLNNGIYLDLTITGGLKEYDQTLPFLTGFFRSSWISYLYERGWRQSFR-WGGFPGLQREI  131

Query  525  ELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            E+ ++YL+P  GG I+DASCGSGLFSR FAKSG++SLVVALDFSE MLQ C +FIK
Sbjct  132  EMAKNYLRPAKGGTIVDASCGSGLFSRQFAKSGMYSLVVALDFSENMLQHCNKFIK  187



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 134/213 (63%), Gaps = 6/213 (3%)
 Frame = +3

Query  54   YVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTN  233
            + S V + R +  NSK      T  ++  +  +IRA S   VE +   L    +V     
Sbjct  17   HRSLVPIQRGVSLNSKIRVP--TRFSSNGYTSRIRATSAVAVEPE---LRTPAQVVTEAE  71

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  413
            L ACPICY+     G  G ++ ++ +S  +C  C K YS    ++DLT+  G K Y E+ 
Sbjct  72   LFACPICYEPLIRKGPSGFNVPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESK  131

Query  414  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  593
               TELFR P+VSFLYERGWRQSF+  GGFPGP++EF++ QDY K   GG ++D SCGSG
Sbjct  132  PTGTELFRSPVVSFLYERGWRQSFN-RGGFPGPDEEFKMAQDYFKVAEGGVLVDVSCGSG  190

Query  594  LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LFSR FAKSG++S V+ALDFSE ML+QCY+FIK
Sbjct  191  LFSRKFAKSGVYSRVIALDFSENMLRQCYDFIK  223



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 126/188 (67%), Gaps = 4/188 (2%)
 Frame = +3

Query  129  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  308
            ++R F  +IRA S   VE +  R + +   E  T L ACPICY+     G  G ++ ++ 
Sbjct  40   SSRGFTSRIRASSAIAVEPES-RTLGQDATE--TELFACPICYEPLMRKGPSGFNVPAIY  96

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR PLVSFLYERGWRQ+F+
Sbjct  97   RSGFKCRKCNKSYSSKSIYLDLTITSGTKEYSESKPARTELFRSPLVSFLYERGWRQAFN  156

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML  668
               GFPGP++EF++ Q+Y K   GG +ID SCGSGLFSR FAKSG +S VVALDFSE ML
Sbjct  157  R-SGFPGPDEEFKMAQEYFKVAEGGVVIDVSCGSGLFSRKFAKSGAYSRVVALDFSENML  215

Query  669  QQCYEFIK  692
            +QCY+FIK
Sbjct  216  RQCYDFIK  223



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query  111  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  281
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  282  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  461
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  462  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVV  641
            ERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAKSGTYSGVI  204

Query  642  ALDFSETMLQQCYEFIK  692
            ALDFSE ML+QC +FIK
Sbjct  205  ALDFSENMLRQCNDFIK  221



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 138/224 (62%), Gaps = 6/224 (3%)
 Frame = +3

Query  33   MATAGLGYVSAVLVTRK---LGYNSKFSFSPLTPKANRLFAVKIRALST-TFVEDKPVRL  200
            MAT     +    ++R    L  NS+F   P     +R  +  IRA ST T   ++  R 
Sbjct  1    MATTPSSALHQTFLSRNYSPLRRNSQFGH-PRLRLPSRHHSHPIRATSTVTLPPERRSRA  59

Query  201  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  380
             + +   +   LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+
Sbjct  60   EEIQSSGVDLELLACPVCYEPLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDVYLDLTV  119

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
              G K Y E     TELFR PLVSFLYERGWRQ+F+L  GFPGP++EF++ QDY K   G
Sbjct  120  TAGLKEYVEVQPIQTELFRSPLVSFLYERGWRQNFNL-SGFPGPDEEFKMAQDYFKSAEG  178

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            G ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q YEF K
Sbjct  179  GVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQSYEFFK  222



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGAYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 117/162 (72%), Gaps = 6/162 (4%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  386
            E   E +   LACPICY         G S  S   S+LECSTC+K Y   + + DLT++ 
Sbjct  71   EPAAETKLRKLACPICYYPLA-----GSSDQSDDASSLECSTCKKSYPNKQDYWDLTVSV  125

Query  387  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  566
            G   Y E++ A+TELFR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YLKP  GG 
Sbjct  126  GSIEYSESMPAATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTFGGT  184

Query  567  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC E+IK
Sbjct  185  IVDASCGSGLFSRLFVKSGLYSLVVALDFSENMLKQCNEYIK  226



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCNKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 121/180 (67%), Gaps = 5/180 (3%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA +T    D  V    +  VE   ++L+CPICY      G  GL++S +++S  +C  
Sbjct  57   IRAAATVEAPDVKV----DSNVETTVDVLSCPICYKPLIRKGPSGLNMSFISRSGFQCGN  112

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K YS  + ++DLT+  G   Y E    +TELFR PLVSF+YERGWRQ+F+  GGFPGP
Sbjct  113  CKKAYSTRDVYIDLTVTAGSSEYDEYRPLTTELFRSPLVSFVYERGWRQNFA-SGGFPGP  171

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF + Q  L+P  GG ++DASCGSGLFSR FA  GL+S VVALDFSE ML QCYEFIK
Sbjct  172  DEEFRMAQKILEPAAGGLLVDASCGSGLFSRRFANCGLYSGVVALDFSENMLHQCYEFIK  231



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 115/167 (69%), Gaps = 1/167 (1%)
 Frame = +3

Query  192  VRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVD  371
            +R      +E    + ACP+CY+     G PG +L ++ +S+ +C  C K YS  + ++D
Sbjct  45   IRATSAVALEPNQAIFACPVCYEPLIRKGPPGFNLPAIYRSSFKCKKCTKTYSSKDNYLD  104

Query  372  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  551
            LTI  G K Y E     TELFR PLVSFLYERGWRQSF+   GFPGP++EFE+ Q+Y KP
Sbjct  105  LTITAGMKDYTEINPVRTELFRSPLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKP  163

Query  552  VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
              GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY++IK
Sbjct  164  ARGGLLVDVSCGSGLFSRKFAKSGAYSKVIALDFSENMLRQCYDYIK  210



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 126/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query  111  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  281
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  282  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  461
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  462  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVV  641
            ERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVSCGSGLFSRKFAKSGTYSGVI  204

Query  642  ALDFSETMLQQCYEFIK  692
            ALDFSE ML+QC +FIK
Sbjct  205  ALDFSENMLRQCNDFIK  221



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 131/194 (68%), Gaps = 7/194 (4%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  197

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  198  FSENMLRQCYDFIK  211



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 122/180 (68%), Gaps = 2/180 (1%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCYDFIK  220



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 122/180 (68%), Gaps = 2/180 (1%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCYDFIK  220



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  9    DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  68

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG
Sbjct  69   SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  127

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  128  ILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  170



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 122/184 (66%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            F  +IRA S    E +   L    +  +   L ACPICY+  T  G  G ++ ++ +S  
Sbjct  38   FTSRIRATSAVVAEPE---LRTPAQDSMEAELFACPICYEPLTRKGPSGFNVPAIYRSGF  94

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C  C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  95   KCRKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  153

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QCY
Sbjct  154  FPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGAYSRVVALDFSENMLRQCY  213

Query  681  EFIK  692
            +FIK
Sbjct  214  DFIK  217



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 123/187 (66%), Gaps = 10/187 (5%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDK---PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  311
            F  +IRA S   VE +   P + + E +      L ACPICY+     G  G ++ ++ +
Sbjct  40   FTSRIRATSAVAVEPELRTPAQDVAEAE------LFACPICYEPLIRKGPSGFNVPAVYR  93

Query  312  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  491
            S  +C  C K YS    ++DLT+  G K Y E+    TELFR P+VSFLYERGWRQSF+ 
Sbjct  94   SGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPTGTELFRSPVVSFLYERGWRQSFN-  152

Query  492  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  671
             GGFPGP++EF + QDY K   GG ++D SCGSGLFSR FAKSG++S V+ALDFSE ML+
Sbjct  153  RGGFPGPDEEFNMAQDYFKVAEGGVLVDVSCGSGLFSRKFAKSGVYSKVIALDFSENMLR  212

Query  672  QCYEFIK  692
            QCY+FIK
Sbjct  213  QCYDFIK  219



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 132/219 (60%), Gaps = 13/219 (6%)
 Frame = +3

Query  63   AVLVTRKLGYNSKFSFSPLTPKANR---------LFAVKIRALSTTFVEDKPVRLIDEKK  215
            AV     L +    +F P  P+  R         + + +IRA S   +E +   L  E +
Sbjct  2    AVAAQASLRFYQNSAFFPRNPRLFRDSRLRPPPGVCSARIRASSAVALEPE---LTTEAQ  58

Query  216  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  395
                 +L ACPICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   DTTDVDLFACPICYEPLIRKGPSGFNLPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTK  118

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  575
             Y E   A TELFR PLVSF+YERGWRQ+F+   GFPGP++EF + Q+Y KP  GG ++D
Sbjct  119  EYNEFKPAGTELFRSPLVSFVYERGWRQNFN-RSGFPGPDEEFNMAQEYFKPAEGGVLVD  177

Query  576  ASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  178  VSCGSGLFSRKFAKSGAYSRVIALDFSENMLRQCYDFIK  216



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 121/171 (71%), Gaps = 6/171 (4%)
 Frame = +3

Query  180  EDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNE  359
            +++   L+ E   E++ + LACPICY  F    D      S   S+LECSTC+K Y   +
Sbjct  34   DEEVAELLVETVPEMKLSKLACPICYYPFVSASD-----QSGDASSLECSTCKKVYPNKQ  88

Query  360  THVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQD  539
             + DLT+A G   Y E++ A+TELFR  LVSFLYERGWRQ+F  WGGFPG  +EFE+ + 
Sbjct  89   DYWDLTVAVGSTEYTESMPAATELFRTSLVSFLYERGWRQTFR-WGGFPGRTREFEMAKT  147

Query  540  YLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            YL P +GG I+DASCGSGLFSRLF KSGL+SLVVALDFSE ML+QC E+++
Sbjct  148  YLNPTIGGTIVDASCGSGLFSRLFIKSGLYSLVVALDFSENMLKQCKEYVE  198



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 130/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
             L +NS+F  + L     R F   IRA S   +E +   L  ++   +  +  ACPICY 
Sbjct  18   HLFHNSRFPATRLRFTYLR-FPSTIRATSAVSLEPE---LSTQQSQTLEVDPFACPICYQ  73

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  G +L ++ +S  +C+ C K YS  E ++DLTI  G K Y E     TELFR 
Sbjct  74   PLIRKGPTGFNLPAIYRSGFKCNRCNKTYSSKENYLDLTITAGMKDYTEVKPVRTELFRS  133

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  GG ++D SCGSGLFSR FAKS
Sbjct  134  PLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPTEGGLLVDVSCGSGLFSRKFAKS  192

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S V+ALDFSE ML+QCY+FIK
Sbjct  193  GTYSKVIALDFSENMLRQCYDFIK  216



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 131/204 (64%), Gaps = 10/204 (5%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
            +L +NS      L+P   R  ++ IRA + T  +    +      +E     L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQSSSTQKSQSSGIE----FLSCPVCYE  70

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  71   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  130

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKS
Sbjct  131  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKS  189

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+QCY+F+K
Sbjct  190  GSYSGVVALDFSENMLRQCYDFLK  213



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = +3

Query  222  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  401
            + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y
Sbjct  68   METEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTAGTKEY  127

Query  402  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  581
             E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EFE+ QDY +PV GG ++D S
Sbjct  128  SEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFEMAQDYFQPVAGGILLDVS  186

Query  582  CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            CGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  187  CGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  223



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  64   DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  123

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG
Sbjct  124  SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  182

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  183  ILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  225



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  184

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  185  ILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  227



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  54   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  113

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  114  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  172

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  173  ILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  215



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  56   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  115

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  563
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  116  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  174

Query  564  NIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  175  ILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  217



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 124/184 (67%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +  +IRA S   VE + +R   +   E    L ACPICY+     G  G ++ ++ +S  
Sbjct  42   YTSRIRATSAVAVEPE-LRTPAQDATE--AELFACPICYEPLIRKGPSGFNVPAIYRSGF  98

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +CS C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  99   KCSKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  157

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY
Sbjct  158  FPGPDEEFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGAYSRVIALDFSENMLRQCY  217

Query  681  EFIK  692
            +FIK
Sbjct  218  DFIK  221



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 132/204 (65%), Gaps = 8/204 (4%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKS
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKS  191

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+QCY+F+K
Sbjct  192  GSYSGVVALDFSENMLRQCYDFLK  215



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 132/204 (65%), Gaps = 8/204 (4%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D SCGSGLFSR FAKS
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVSCGSGLFSRKFAKS  191

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+QCY+F+K
Sbjct  192  GSYSGVVALDFSENMLRQCYDFLK  215



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = +3

Query  81   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  260
             L  NS+  F P    ++  F   IRA S   +E + +   +E+   +  +  ACPICY+
Sbjct  21   HLSRNSRI-FHPRLQFSSLRFHSTIRATSAVALE-RDLGKQEEQSQTLEVDPFACPICYE  78

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G PG +LS++ +S  +C  C K Y+  + ++DLTI    K Y E   A +ELFR 
Sbjct  79   PLIRKGPPGFNLSAIYRSGFKCKKCNKTYTSKDKYLDLTITAAMKEYTEVKPARSELFRS  138

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y K   GG ++D SCGSGLFSR FAKS
Sbjct  139  PLVSFLYERGWRQNFNR-SGFPGPDEEFKMAQEYFKQAEGGLLVDVSCGSGLFSRKFAKS  197

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S V+ALDFSE ML+QCY+FIK
Sbjct  198  GTYSKVIALDFSENMLRQCYDFIK  221



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
            ++ ACP+CY+     G PG +LS++ +S  +C  C K YS  + ++DLTI    K Y E 
Sbjct  14   DVFACPVCYEPLIRKGPPGFNLSAIYRSGFKCKKCNKTYSSKDNYLDLTITASMKEYTEV  73

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
              A TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  GG ++D SCGS
Sbjct  74   KPARTELFRSPLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPAEGGILVDVSCGS  132

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GLFSR FA SG +S VVALDFSE ML+QCY+FIK
Sbjct  133  GLFSRKFATSGTYSKVVALDFSENMLRQCYDFIK  166



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 126/184 (68%), Gaps = 4/184 (2%)
 Frame = +3

Query  141  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            F  +IRA S   +E +    ++     +  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRIRASSAVALEPESSTQLNNG---LEFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C +C K YS  + ++DLTI  G K Y E     TELFR PLVSFLYERGWRQ+F+   G
Sbjct  93   KCRSCNKSYSSKDMYLDLTITAGSKDYNELQPNRTELFRSPLVSFLYERGWRQNFN-QSG  151

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPG ++EF++ Q+Y +PV+GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QCY
Sbjct  152  FPGRDEEFKMAQEYFEPVIGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQCY  211

Query  681  EFIK  692
            +FIK
Sbjct  212  DFIK  215



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 123/180 (68%), Gaps = 2/180 (1%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA S+  +  +P   ++E +    + + ACP+CY+     G  GL+L ++ +S  +C  
Sbjct  47   IRATSSV-IALEPSSSVEENRSSEVSEVFACPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  105

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  106  CNKSYSSKDIYLDLTVTAGLRDYTEVKPAGTELFRSPLVSFLYERGWRQNFN-RSGFPGP  164

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF++ Q Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  165  DEEFKMAQGYFKSVEGGLLVDVSCGSGLFSRKFAKSGTYSAVIALDFSENMLRQCYDFIK  224



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 6/158 (4%)
 Frame = +3

Query  219  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  398
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  399  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  578
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YLKP +GG I+DA
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTIGGTIVDA  184

Query  579  SCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            SCGSGLFSRLF KSGL+SLVVALDFSE ML+QC ++IK
Sbjct  185  SCGSGLFSRLFIKSGLYSLVVALDFSENMLKQCNQYIK  222



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 130/196 (66%), Gaps = 14/196 (7%)
 Frame = +3

Query  111  SPLTPKANRLFAVKI--RALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDP  284
            S L   A++ F   +   A++   VE +PV  + +         LACPICY     + D 
Sbjct  52   SALRASASQAFTAGVPDEAVAEPLVEAEPVAELGK---------LACPICYYPLVSSLDQ  102

Query  285  GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYE  464
              S  S + S+LEC TC+K YS  + + DLT+A G   Y E++ A+TELFR  LVSFLYE
Sbjct  103  --SAPSKSDSSLECPTCKKVYSDEDGYWDLTVAVGSTEYSESMPAATELFRTQLVSFLYE  160

Query  465  RGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVA  644
            RGWRQ+F +WGGFPG E+EFE+ + YLKP  GG I+DASCGSGLFSRLF  S ++SLVVA
Sbjct  161  RGWRQNF-IWGGFPGLEREFEMAKTYLKPTTGGIIVDASCGSGLFSRLFVTSEIYSLVVA  219

Query  645  LDFSETMLQQCYEFIK  692
            LDFSE ML+QC EFIK
Sbjct  220  LDFSENMLKQCKEFIK  235



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 4/186 (2%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFNRR  150

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
             GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR F KSG +S V+ALDFSE ML+Q
Sbjct  151  -GFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSRKFVKSGTYSGVIALDFSENMLRQ  209

Query  675  CYEFIK  692
            C +FI+
Sbjct  210  CNDFIE  215



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 124/186 (67%), Gaps = 4/186 (2%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
             GFPGP++EF + Q+Y KPV GG ++D SCGSGLFSR F KSG +S V+ALDFSE ML+Q
Sbjct  150  RGFPGPDEEFRMAQEYFKPVEGGILVDVSCGSGLFSRKFVKSGTYSGVIALDFSENMLRQ  209

Query  675  CYEFIK  692
            C +FI+
Sbjct  210  CNDFIE  215



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 132/204 (65%), Gaps = 3/204 (1%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVE-IRTNLLACPICYD  260
            L +N++F   P     +R  +  IRA ST  ++ +     +E +   +   LLACP+CY+
Sbjct  25   LHHNTQFR-PPHLCLTSRHSSHPIRATSTVTLQPERRSTAEEGQSSGVDLELLACPVCYE  83

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  84   PLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  143

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            P+VSFLYERGWRQ+F+   GFPGP++EF++ QDY K   GG ++D SCGSGLFSR FAKS
Sbjct  144  PIVSFLYERGWRQNFNRR-GFPGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKS  202

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+Q YEF K
Sbjct  203  GTYSGVVALDFSENMLRQSYEFFK  226



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  413
            + ACP+CY+     G PG++L ++ +S  +CS C+K ++  +  +DLT+  G K Y E  
Sbjct  76   VFACPVCYEPLIRKGPPGINLPAIYRSGFKCSKCKKSFTSKDIFLDLTVTSGTKEYSELK  135

Query  414  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  593
             A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG +ID SCGSG
Sbjct  136  PARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGGILIDVSCGSG  194

Query  594  LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LF+R FAKSG +S VVALDFSE ML+QCYE+IK
Sbjct  195  LFTRKFAKSGAYSAVVALDFSENMLRQCYEYIK  227



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDQAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKSYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF++ Q+Y +   GG I+D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  160  DEEFKMAQEYFESAKGGLIVDVSCGSGLFSRKFAKSGAYSGVIALDFSENMLRQCYEFIK  219



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 124/184 (67%), Gaps = 7/184 (4%)
 Frame = +3

Query  159  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  52   SVTPEFVTASPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  111

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  112  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  170

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC 
Sbjct  171  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQCN  230

Query  681  EFIK  692
            E++K
Sbjct  231  EYVK  234



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 6/190 (3%)
 Frame = +3

Query  123  PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSS  302
            P+++R   +++ A +   VE +  R+     ++++  LLACPICY+     G  GL++ S
Sbjct  42   PRSSR--GLRVSATAALSVEQE-TRVQHNDSMDLQ--LLACPICYEPLIRKGPAGLNVPS  96

Query  303  MAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQS  482
            + +S  +C  C K ++  + ++DLTI  G   Y E   A TELFR PLVSFLYERGWRQ+
Sbjct  97   IYRSGFKCQKCNKSFTSKDVYLDLTITSGTTEYSEFKPARTELFRSPLVSFLYERGWRQN  156

Query  483  FSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSET  662
            F+   GFPG ++EF + Q+Y KPV GG ++D SCGSGLFSR FAKSG FS VVALDFSE 
Sbjct  157  FN-RSGFPGLDEEFNMAQEYFKPVAGGLLVDVSCGSGLFSRKFAKSGSFSAVVALDFSEN  215

Query  663  MLQQCYEFIK  692
            ML+QCYEFIK
Sbjct  216  MLRQCYEFIK  225



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +3

Query  357  ETHVDLTIAGGGKAYGE-ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELM  533
            ETH++LT+A G K YG+ A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFELM
Sbjct  6    ETHLELTVASGSKGYGDIAMPLATEFFRTPFMSFLYERGWRQNF-VWGGFPGPEKEFELM  64

Query  534  QDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +DYLKPV+GGNI+DASCGSGLFSRLF KSGLFSLV+ALD+SE MLQQCYEFIK
Sbjct  65   KDYLKPVLGGNILDASCGSGLFSRLFTKSGLFSLVMALDYSENMLQQCYEFIK  117



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 124/184 (67%), Gaps = 7/184 (4%)
 Frame = +3

Query  159  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC 
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQCN  228

Query  681  EFIK  692
            E++K
Sbjct  229  EYVK  232



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 122/183 (67%), Gaps = 6/183 (3%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVE---IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLE  323
            IRA ST  V   P R    ++++   +   +LACPICY+     G PGL+L ++ +S  +
Sbjct  43   IRATST--VALPPERRSRAEEIQSSGVDLEVLACPICYEPLIRRGPPGLNLRAIYRSGFK  100

Query  324  CSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGF  503
            C  C K YS  + ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GF
Sbjct  101  CRKCDKXYSSKDXYLDLTVTAGLKEYVEVQPXXTELFRSPLVSFLYERGWRQNFN-RSGF  159

Query  504  PGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYE  683
            PGP++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q YE
Sbjct  160  PGPDEEFKMAQDYFKSAEGGVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQSYE  219

Query  684  FIK  692
            F K
Sbjct  220  FFK  222



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  222  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  401
            ++ NL ACPICY+     G  GL+L ++ +S  +C TCRK YS  +  +DLT+  G K Y
Sbjct  42   LQYNLFACPICYEPLIRKGPSGLTLPAVYRSGFKCQTCRKSYSSKDVFLDLTVTSGTKDY  101

Query  402  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  581
             E     TELFR PLVSFLYERGWRQ+FS   GFPGP++EF++ Q++ +P  GG ++D S
Sbjct  102  NEFKPPRTELFRSPLVSFLYERGWRQTFS-GSGFPGPDEEFKMAQEFFEPAAGGLLVDVS  160

Query  582  CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            CGSGLFSR FA SG +S V+ALDFSE ML+QCY+FIK
Sbjct  161  CGSGLFSRKFADSGSYSGVIALDFSENMLRQCYDFIK  197



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 116/170 (68%), Gaps = 6/170 (4%)
 Frame = +3

Query  198  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  362
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  137

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC+EFIK
Sbjct  138  FKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQCFEFIK  187



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 121/186 (65%), Gaps = 6/186 (3%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
              +C  C K +S  + ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFNR-  161

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
             GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML Q
Sbjct  162  SGFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQ  221

Query  675  CYEFIK  692
            C+EFIK
Sbjct  222  CFEFIK  227



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 124/184 (67%), Gaps = 7/184 (4%)
 Frame = +3

Query  159  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPG E+EFE+ Q YLKP  GG I+DASCGSGLFSRLF KS L+SLVVALDFSE ML+QC 
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDASCGSGLFSRLFVKSELYSLVVALDFSENMLKQCN  228

Query  681  EFIK  692
            E++K
Sbjct  229  EYVK  232



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 113/165 (68%), Gaps = 1/165 (1%)
 Frame = +3

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  377
            L  ++   +  +  ACPICY      G  G +L ++ +S  +C+ C K YS  E ++DLT
Sbjct  23   LSTQQSQTLEVDPFACPICYQPLIRKGPKGFNLPAIYRSGFKCNRCNKTYSSKENYLDLT  82

Query  378  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  557
            I  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  
Sbjct  83   ITAGMKDYTEVKPVRTELFRSPLVSFLYERGWRQNFNQ-SGFPGPDEEFKMAQEYFKPTE  141

Query  558  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  142  GGLLVDVSCGSGLFSRKFAKSGTYSKVIALDFSENMLRQCYDFIK  186



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  222  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  401
            ++ +LLACPIC++     G PGL+L ++ +S  +C TC K YS    ++DLT+  G + Y
Sbjct  62   VQNDLLACPICFETLMRRGPPGLNLEAIYRSGFKCQTCNKSYSSKNVYLDLTVTAGSEEY  121

Query  402  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  581
             E    STELFR P+VSFLYERGWRQ+F+   GFPG E+EF++ Q+Y KP  GG ++D S
Sbjct  122  SENKPTSTELFRSPVVSFLYERGWRQNFN-RSGFPGLEEEFKMAQEYFKPAEGGLLVDVS  180

Query  582  CGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            CGSGLFSR FA+ G +S V+ALDFSE ML+QCY+F K
Sbjct  181  CGSGLFSRKFAECGTYSGVIALDFSENMLRQCYDFTK  217



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  386
            ++   + T L +CP+CY+     G PGL+L ++ +S  +C  C K YS  +  +DLT+  
Sbjct  18   QQNQTVETELFSCPVCYEPLIRKGPPGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTT  77

Query  387  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  566
            G + Y E     TELFR PLVSFLYERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG 
Sbjct  78   GLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGT  136

Query  567  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC +FIK
Sbjct  137  LVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCNDFIK  178



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 113/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  225  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  404
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  75   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKEYS  134

Query  405  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  584
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY KPV GG ++D SC
Sbjct  135  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFKPVAGGILVDVSC  193

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FA SG +S V+ALDFSE ML+QCY++I+
Sbjct  194  GSGLFSRKFASSGAYSAVIALDFSENMLRQCYDYIR  229



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 123/189 (65%), Gaps = 3/189 (2%)
 Frame = +3

Query  126  KANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSM  305
            ++++     IRA S   V +    L  +  +  + +L ACPICY+     G  G +LS++
Sbjct  39   RSHQTQRTTIRATSAAVVVESD--LTTQHDLNTQVDLFACPICYEPLIRKGPVGFNLSAI  96

Query  306  AQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  485
             +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F
Sbjct  97   YRSGFKCKRCQKAYTSKDGYLDLTVTSGLRDYTEVQPVRTELFRSPLVSFLYERGWRQNF  156

Query  486  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETM  665
                GFPGPE+EF++ Q+Y +P  GG IID SCGSGLFSR FA SG +S VVALDFSE M
Sbjct  157  R-QSGFPGPEEEFKMAQEYFEPAKGGLIIDVSCGSGLFSRKFANSGTYSGVVALDFSENM  215

Query  666  LQQCYEFIK  692
            L+QC +FIK
Sbjct  216  LRQCNDFIK  224



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 131/219 (60%), Gaps = 13/219 (6%)
 Frame = +3

Query  63   AVLVTRKLGYNSKFSFSPLTPKANRLFAVK---------IRALSTTFVEDKPVRLIDEKK  215
            AV +   L ++    F P +P  +R   ++         IRA S   ++ +  R   E +
Sbjct  2    AVALQPSLRFHHNSPFFPKSPHLSRNSQIRPNPSFATASIRASSAVALDTESSR---EAQ  58

Query  216  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  395
                  L AC ICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   STSDVELFACAICYEPLIRKGPSGFNLQAIYRSGFKCRNCNKSYSSKNLYLDLTVTSGTK  118

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  575
             Y E   A TELFR PLVSF+YERGWRQ+F+  G FPGP++EF + Q+Y KP  GG +ID
Sbjct  119  EYNEFQPAGTELFRSPLVSFVYERGWRQNFNSRG-FPGPDEEFSMAQEYFKPAEGGVLID  177

Query  576  ASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             SCGSGLFSR FAKSG +S VVALDFSE ML+QC++FIK
Sbjct  178  VSCGSGLFSRKFAKSGSYSRVVALDFSENMLRQCFDFIK  216



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 134/226 (59%), Gaps = 1/226 (0%)
 Frame = +3

Query  15   PGELTTMATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV  194
            P  L  +A   L  +   L  +   ++    F P    +++ F + +RA S   +E    
Sbjct  48   PFSLMAIAPPSLRPLHKSLFPKYPSFSHDSPFRPSLHFSSKPFRLTVRASSAVALEQDLR  107

Query  195  RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
                ++   + T L +CP+CY+     G  GL+L ++ +S  +C  C K +S  +  +DL
Sbjct  108  TQGTQQNQTVETELFSCPVCYEPLIRKGPLGLNLDAIYRSGFKCKKCNKSFSSKDVFLDL  167

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
            T+  G + Y E     TELFR PLVSFLYERGWRQ+F+L  GFPG ++EF + Q+Y KP 
Sbjct  168  TVTAGLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPGADEEFRMAQEYFKPA  226

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             GG ++D SCGSGLFSR FA+SG +S V+ALDFSE ML+QC +FIK
Sbjct  227  EGGTLVDVSCGSGLFSRKFAQSGTYSGVIALDFSENMLRQCNDFIK  272



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  386
            +K     T+L +CP+CY+     G PGL+L+++ +S  +C  C K YS  +T++DLT+  
Sbjct  55   QKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRSGFKCKQCDKSYSSKDTYLDLTVTA  114

Query  387  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  566
            G + Y E   A TELFR P VSF+YERGWRQ+F+   GFPGP++EF + Q+Y KPV GG 
Sbjct  115  GLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFNRR-GFPGPDEEFRMAQEYFKPVEGGI  173

Query  567  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++D SCGSGLFSR FAKS  +S V+ALDFSE ML+QC +FI+
Sbjct  174  LVDVSCGSGLFSRKFAKSRTYSGVIALDFSENMLRQCNDFIE  215



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FI+
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCYDFIE  219



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  260
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPRRRSPAEESQSSGGDLELLACPICYE  80

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKS
Sbjct  141  PLVSFLYERGWRQNFNRR-GFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKS  199

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+Q YEF K
Sbjct  200  GTYSGVVALDFSENMLRQSYEFFK  223



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  260
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKS
Sbjct  141  PLVSFLYERGWRQNFNRR-GFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKS  199

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+Q YEF K
Sbjct  200  GTYSGVVALDFSENMLRQSYEFFK  223



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  413
            LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E  
Sbjct  79   LLACPVCYEPLIRKGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVK  138

Query  414  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSG  593
             A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY K   GG ++D SCGSG
Sbjct  139  PAGTELFRNPLVSFLYERGWRQNFNR-SGFPGLDEEFKMAQDYFKSAEGGVLLDVSCGSG  197

Query  594  LFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            LFSR FAKSG +S VVALDFSE ML+QCY+F+K
Sbjct  198  LFSRKFAKSGTYSGVVALDFSENMLRQCYDFLK  230



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  260
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKS  620
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D SCGSGLFSR FAKS
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVSCGSGLFSRKFAKS  199

Query  621  GLFSLVVALDFSETMLQQCYEFIK  692
            G +S VVALDFSE ML+Q YEF K
Sbjct  200  GTYSGVVALDFSENMLRQSYEFFK  223



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 107/141 (76%), Gaps = 4/141 (3%)
 Frame = +3

Query  192  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  362
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  543  LKPVMGGNIIDASCGSGLFSR  605
            LKPV+GGNIIDASCGSG+FSR
Sbjct  178  LKPVLGGNIIDASCGSGMFSR  198



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            +RA S   +E     L  ++   + T+L +CP+CY+     G  GL+L ++ +S  +C  
Sbjct  43   VRASSAVALEPD---LSSQRNQTVDTDLFSCPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  99

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C K YS  + ++DLTI  G + Y E     TELFR P VSF+YERGWRQ+F+   GFPGP
Sbjct  100  CNKSYSSKDVYLDLTITAGLRDYTEVKPVGTELFRSPFVSFVYERGWRQNFNR-SGFPGP  158

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF + Q+Y KP  GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QC +FI+
Sbjct  159  DEEFRMAQEYFKPAEGGILVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCNDFIE  218



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  225  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  404
            +T + ACPICY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPICYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  405  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  584
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  183

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FA SG +S V+ALDFSE ML+QCY++IK
Sbjct  184  GSGLFSRKFASSGAYSSVIALDFSENMLRQCYDYIK  219



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  1    ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  60

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
                TELFR PLVS +YERGWRQ+F    GFPGP++E ++  +YL+P  GG I+D SCGS
Sbjct  61   PPTGTELFRNPLVSLIYERGWRQNFER-SGFPGPDEELKMALEYLRPAFGGVIVDVSCGS  119

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GLF+R  AK G F+ V+ALDFSE+ML+QC EF+K
Sbjct  120  GLFTRRLAKCGSFAAVIALDFSESMLRQCAEFVK  153



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFL+ERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLHERGWRQNFR-QSGFPGP  159

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FI+
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCYDFIE  219



>gb|KCW45297.1| hypothetical protein EUGRSUZ_L01041 [Eucalyptus grandis]
Length=239

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +3

Query  102  FSFSPLTPKANRLFA-----------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  248
            F+  PL P+  RL               +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  249  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  428
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  608
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR 
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRK  186

Query  609  FAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FAKSG +S V+ALD+SE ML+QCY+FIK
Sbjct  187  FAKSGTYSGVIALDYSENMLRQCYDFIK  214



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 1/165 (1%)
 Frame = +3

Query  198  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  377
            LI  K   + T++ ACP+CY+     G PG++L ++ +S  +C  C K YS  + ++DLT
Sbjct  60   LITPKTQTLETDIFACPVCYEPLVRKGPPGINLQAIYRSGFKCRECEKTYSSKDGYLDLT  119

Query  378  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  557
            +      + E    +TELFR PLVSFLYERGWRQ+F+   GFPGP++EF + Q+Y +   
Sbjct  120  VTADSGNFDEVKPITTELFRSPLVSFLYERGWRQNFNR-SGFPGPDEEFRMAQEYFRSAE  178

Query  558  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+QC +FIK
Sbjct  179  GGLLVDVSCGSGLFSRKFAKSGKYSAVVALDFSENMLRQCNDFIK  223



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +3

Query  225  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  404
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  405  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  584
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  183

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GSGLFSR FA SG +S V+ALDFSE ML+QCY++IK
Sbjct  184  GSGLFSRKFASSGAYSSVIALDFSENMLRQCYDYIK  219



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 127/194 (65%), Gaps = 12/194 (6%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPGP++E     +Y K   GG ++D SCGSGLFSR FAKSG +S VVALD
Sbjct  139  WRQNFN-RSGFPGPDEE-----EYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALD  192

Query  651  FSETMLQQCYEFIK  692
            FSE ML+QCY+FIK
Sbjct  193  FSENMLRQCYDFIK  206



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 115/170 (68%), Gaps = 7/170 (4%)
 Frame = +3

Query  198  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  362
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  136

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML QC+EFIK
Sbjct  137  FKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQCFEFIK  186



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 113/167 (68%), Gaps = 7/167 (4%)
 Frame = +3

Query  207  EKKVEIRTN------LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  368
            EK+ E R N        +CP+CY      G PGL+LS++ +S   C +C K +S   T++
Sbjct  63   EKESESRGNETSESDKFSCPVCYRPLIRTGPPGLNLSAIYRSGFLCKSCNKPFSSRNTYL  122

Query  369  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  548
            DLT+  G K Y E+  + TELFR P VSFLYERGWRQ+F    GFPG ++EF + Q+Y K
Sbjct  123  DLTVTSGAKEYNESKPSRTELFRSPFVSFLYERGWRQNFR-NSGFPGLDEEFRMAQEYFK  181

Query  549  PVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
            PV GG ++D SCGSGLF R FA SG++S V+ALDFSE ML+QCY+FI
Sbjct  182  PVEGGFLLDVSCGSGLFLRKFASSGVYSGVIALDFSENMLRQCYDFI  228



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 120/186 (65%), Gaps = 7/186 (4%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  494
              +C  C K +S  + ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFNR-  160

Query  495  GGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
             GFPGP++EF + Q+Y K V GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML Q
Sbjct  161  SGFPGPDEEFNMAQEYFKTVAGGLLVDVSCGSGLFSRKFAKSGSYSAVIALDFSENMLHQ  220

Query  675  CYEFIK  692
            C+EFIK
Sbjct  221  CFEFIK  226



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +3

Query  102  FSFSPLTPKANRLFA-----------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  248
            F+  PL P+  RL               +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  249  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  428
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  608
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR 
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRK  186

Query  609  FAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FAKSG +S V+ALD+SE ML+QCY+FIK
Sbjct  187  FAKSGTYSGVIALDYSENMLRQCYDFIK  214



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = +3

Query  207  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  386
            +K   + + + +CPICY++    G  GL+L +M  S  +C+ C+K YS N   +DLT+  
Sbjct  68   QKDQTLESEIFSCPICYESLIRRGPSGLNLEAMHGSGFKCNRCKKSYSSNGNFLDLTLTA  127

Query  387  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  566
            G + Y E     TELFR PLVSFLYERGWRQ+F    GFPG E+EF++ Q+Y KP  GG 
Sbjct  128  GLRNYIEVKPRQTELFRSPLVSFLYERGWRQNFK-HSGFPGQEEEFKMAQEYFKPAEGGL  186

Query  567  IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++D SCGSGLFSR FAKSG +S V+ALD+SE ML QCY+FIK
Sbjct  187  LLDVSCGSGLFSRKFAKSGTYSGVIALDYSENMLCQCYDFIK  228



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  410
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  71   ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  130

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
                TELFR PLVS +YERGWRQ+F    GFPGP++E ++  +YL+P  GG I+D SCGS
Sbjct  131  PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGPDEELKMALEYLRPAFGGVIVDVSCGS  189

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GLF+R  AK G F+ V+ALDFSE+ML+QC EF+K
Sbjct  190  GLFTRRLAKCGSFAAVIALDFSESMLRQCAEFVK  223



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = +3

Query  186  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  365
            +P     E+     T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  
Sbjct  120  EPAETKTEQNDTSETEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVF  179

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DLT+  G K Y E   A TELFR PLVS+LYERGWRQ+F+   GFPG ++EF++ QDY 
Sbjct  180  LDLTVTSGMKEYSELKPARTELFRSPLVSYLYERGWRQNFNR-SGFPGRDEEFQMAQDYF  238

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            + V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+QCY++IK
Sbjct  239  QSVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLRQCYDYIK  287



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  150  KIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECS  329
            +IRA S    E  PV    +        + ACP+CY+     G PGL+L ++ +S  +C 
Sbjct  40   RIRASSAVATE--PVTSTQQNNA-FEFEVFACPVCYEPLIRKGPPGLNLPAIYRSGFQCQ  96

Query  330  TCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  509
             C KKYS  + ++DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  97   RCNKKYSSRDIYLDLTVIAGTKEYTEFKPARTELFRSPLVSFLYERGWRQNFNR-SGFPG  155

Query  510  PEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
            P++EF++  +Y KP  GG ++D SCGSGLFSR FA+SG +S V+ALDFSE ML+QCY+FI
Sbjct  156  PDEEFKMALEYFKPAEGGLLVDVSCGSGLFSRKFAESGTYSGVIALDFSENMLRQCYDFI  215

Query  690  K  692
            K
Sbjct  216  K  216



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 5/169 (3%)
 Frame = +3

Query  198  LIDEKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  365
            L  E KV+   N    + ACP+CY+     G  G++L ++ +S  +CS C K ++  +  
Sbjct  57   LPRESKVQQSNNSETEVFACPVCYEPLIRKGPSGINLPAIYRSGFKCSKCNKSFTSKDIF  116

Query  366  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
            +DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY 
Sbjct  117  LDLTVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYF  175

Query  546  KPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFI+
Sbjct  176  QSVTGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLRQCYEFIQ  224



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 124/188 (66%), Gaps = 3/188 (2%)
 Frame = +3

Query  132  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  308
            +R  +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ 
Sbjct  45   SRFTSASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIY  103

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
            +S  +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+
Sbjct  104  RSGFKCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFA  163

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML  668
               GFPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML
Sbjct  164  R-SGFPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENML  222

Query  669  QQCYEFIK  692
            +QC EFIK
Sbjct  223  RQCNEFIK  230



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  372  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  551
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  552  VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            V+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QCYEF++
Sbjct  60   VLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQCYEFVQ  106



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = +3

Query  204  DEKKVE-IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  380
            D+K+ E + T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+
Sbjct  70   DKKETETVETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTV  129

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
              G  ++ E    +TELFR PLVSFLYERGWRQ+F+   GFPGP++EF + ++Y K   G
Sbjct  130  TAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SGFPGPDEEFRMAEEYFKEAEG  188

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            G ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFIK
Sbjct  189  GVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCNEFIK  232



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +3

Query  372  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  551
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  552  VMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            V+GGNIIDASCGSGLFSR+FAKSGLFSLVVALD+SE ML+QCYEF++
Sbjct  60   VLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQCYEFVQ  106



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +3

Query  102  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  248
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  249  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  428
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  608
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR 
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRK  186

Query  609  FAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FAKSG +S V+ LD+SE ML+QCY+FIK
Sbjct  187  FAKSGTYSGVIPLDYSENMLRQCYDFIK  214



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 113/166 (68%), Gaps = 5/166 (3%)
 Frame = +3

Query  207  EKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  374
            E KV    N    + ACP+CY+     G  G++L S+ +S  +CS C K ++  +  +DL
Sbjct  53   ENKVPQSNNSEAEVFACPVCYEPLIRKGPSGINLPSIYRSGFKCSKCNKSFTSKDIFLDL  112

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
            T+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V
Sbjct  113  TVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQSV  171

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML QCYEFI+
Sbjct  172  AGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLCQCYEFIQ  217



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 125/203 (62%), Gaps = 5/203 (2%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  263
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  264  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  443
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  444  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSG  623
            LVS+LYERGWRQ+F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSG  193

Query  624  LFSLVVALDFSETMLQQCYEFIK  692
             FS V+ALDFSE ML QCY+FIK
Sbjct  194  SFSGVIALDFSENMLLQCYDFIK  216



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 125/203 (62%), Gaps = 5/203 (2%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  263
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  264  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  443
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  444  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSG  623
            LVS+LYERGWRQ+F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSG  193

Query  624  LFSLVVALDFSETMLQQCYEFIK  692
             FS V+ALDFSE ML QCY+FIK
Sbjct  194  SFSGVIALDFSENMLLQCYDFIK  216



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +3

Query  102  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  248
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  249  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  428
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  608
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR 
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRK  186

Query  609  FAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FAKSG +S V+ LD+SE ML+QCY+FIK
Sbjct  187  FAKSGTYSGVIPLDYSENMLRQCYDFIK  214



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 126/208 (61%), Gaps = 15/208 (7%)
 Frame = +3

Query  102  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  248
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  249  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  428
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRL  608
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D SCGSGLFSR 
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVSCGSGLFSRK  186

Query  609  FAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FAKSG +S V+ LD+SE ML+QCY+FIK
Sbjct  187  FAKSGTYSGVIPLDYSENMLRQCYDFIK  214



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 9/180 (5%)
 Frame = +3

Query  153  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  332
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+LS        C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLSGFM-----CKR  95

Query  333  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  96   CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  154

Query  513  EKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ++EF++ Q+Y +   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FI+
Sbjct  155  DEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTYSGVIALDFSENMLRQCYDFIE  214



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 122/194 (63%), Gaps = 4/194 (2%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +LS++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLSAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALD
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALD  202

Query  651  FSETMLQQCYEFIK  692
            FSE ML QCY+FIK
Sbjct  203  FSENMLLQCYDFIK  216



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = +3

Query  177  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  356
            +  +P   +D ++    + LL CPIC+      G  GL+ +++  S   C +CR+K+S  
Sbjct  12   LRQEPRSNLDREEENSTSELLCCPICHKPLQRTGPSGLTQNAIRSSGFSCHSCRRKFSNR  71

Query  357  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
              +VDLTI  G + Y E   A  E+FR P+VSF+YERGWRQ+F+   GFPGP++EF++ Q
Sbjct  72   GDYVDLTILDGTRVYDENTTAGAEIFRSPVVSFVYERGWRQNFAR-AGFPGPDEEFKMAQ  130

Query  537  DYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +Y K V GG I+D SCGSGLF+R FA+SG FS V+ALDFSE ML+Q  EFI+
Sbjct  131  NYFKSVQGGVILDVSCGSGLFTRRFAQSGDFSSVIALDFSENMLRQSNEFIR  182



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 123/192 (64%), Gaps = 8/192 (4%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKK-----VEIR-TNLLACPICYDAFTWNGDPGLSL  296
            R  ++ IRA++    E    R  D+K+     +EI  T + ACP+CY+     G  G++L
Sbjct  51   RFPSLAIRAVALE-SESNETRSSDQKENQTQSIEIEETQVFACPVCYEPLMRKGPSGINL  109

Query  297  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  476
             ++ +S  +C  C K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWR
Sbjct  110  KAIYRSGFKCGQCNKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWR  169

Query  477  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFS  656
            Q+FS   GFPGP++EF + + Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+S
Sbjct  170  QNFSR-SGFPGPDEEFRMAERYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYS  228

Query  657  ETMLQQCYEFIK  692
            E ML+QC EFIK
Sbjct  229  ENMLRQCNEFIK  240



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 121/194 (62%), Gaps = 4/194 (2%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALD
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALD  202

Query  651  FSETMLQQCYEFIK  692
            FSE ML QCY+FIK
Sbjct  203  FSENMLLQCYDFIK  216



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 121/194 (62%), Gaps = 4/194 (2%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  470
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  471  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALD  650
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DASCGSGLFSR FAKSG F+ V+ALD
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDASCGSGLFSRKFAKSGSFAGVIALD  202

Query  651  FSETMLQQCYEFIK  692
            FSE ML QCY+FIK
Sbjct  203  FSENMLLQCYDFIK  216



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  133

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFQR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFIK
Sbjct  193  VDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCKEFIK  233



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGRCNKTYSSKDEYLDLTVTAD  133

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFIK
Sbjct  193  VDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCKEFIK  233



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            ++EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   QIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFIK
Sbjct  192  VDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCKEFIK  232



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  130  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKEAEGGLL  188

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FA+SG +S V+ALD+SE ML+QC EFIK
Sbjct  189  VDVSCGSGLFSRKFAQSGKYSGVIALDYSENMLRQCKEFIK  229



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFI+
Sbjct  192  VDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCKEFIQ  232



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 113/163 (69%), Gaps = 3/163 (2%)
 Frame = +3

Query  201  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  380
            ++E   E+   LL+CP+CY+  T  G PGL L ++ +S+ EC  C K YS  + ++DLT+
Sbjct  8    LNESSAEV--ELLSCPVCYEPLTRVGPPGLILQAICRSSFECKKCYKSYSSKKNYLDLTV  65

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
              G K Y EA    TELFR  ++SF+YE+G+RQ F  + GFPGP++EF++ QDY K   G
Sbjct  66   TAGLKKYVEAKPIGTELFRSIIMSFIYEKGYRQCFKRY-GFPGPDEEFKMAQDYFKSAEG  124

Query  561  GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
            G ++D SCGSGLF+  FAKSG +S VVALDFSE ML QCY+++
Sbjct  125  GVLVDVSCGSGLFAIRFAKSGTYSGVVALDFSENMLLQCYDYL  167



>dbj|BAF93193.1| putative methyltransferase-like [Hordeum vulgare]
Length=165

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  225  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  404
            +T + ACP+CY+     G PG++L ++ +S  +C  C K ++  +  +DLT+  G K Y 
Sbjct  18   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCPKCNKSFTSKDVFLDLTVTSGMKQYS  77

Query  405  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASC  584
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D SC
Sbjct  78   ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVSC  136

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQ  671
            GSGLFSR FA SG +S V+ALDFSE ML+
Sbjct  137  GSGLFSRKFASSGAYSSVIALDFSENMLR  165



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +3

Query  144  AVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ +S  
Sbjct  496  SASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIYRSGF  554

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+   G
Sbjct  555  KCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SG  613

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPGP++EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC 
Sbjct  614  FPGPDEEFRMAEEYFKEAEGGVLVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCN  673

Query  681  EFIK  692
            EFIK
Sbjct  674  EFIK  677



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 121/188 (64%), Gaps = 8/188 (4%)
 Frame = +3

Query  132  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  308
            +R  +  IRA++  + V + P  +I+E      T + ACP+CY+     G  G++L S+ 
Sbjct  40   SRFTSASIRAVALQSDVNESPSTVIEE------TQVFACPVCYEPLLRKGPSGINLQSIY  93

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
            +S  +C  C K YS  + ++DLT+      + E    +TELFR PLVSFLYERGWR +F 
Sbjct  94   RSGFKCGQCNKTYSSKDEYLDLTVTADLANFNEVKPITTELFRSPLVSFLYERGWRDNFK  153

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML  668
               GFPG E+EF++ ++Y K   GG ++D SCGSG+FSR FAKSG +S V+ALD+SE ML
Sbjct  154  R-SGFPGAEEEFKMAEEYFKEAEGGILVDVSCGSGIFSRKFAKSGKYSGVIALDYSENML  212

Query  669  QQCYEFIK  692
            +QC +FIK
Sbjct  213  RQCNDFIK  220



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 114/179 (64%), Gaps = 2/179 (1%)
 Frame = +3

Query  159  ALSTTFVEDKPVRLIDEKKVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC  335
            A  +T   +  +   +  K++I    + ACP+CY      G  G++L ++ +S  +C  C
Sbjct  50   AAISTVAPESDINKNETPKIKIEEAQVFACPVCYQPLMRKGPSGINLQAIYRSGFKCGQC  109

Query  336  RKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPE  515
             K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP+
Sbjct  110  NKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPD  168

Query  516  KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +EF + ++Y K   GG ++D SCGSGLFSR FAKSG +S V+ALD+SE ML+QC EFIK
Sbjct  169  EEFRMAEEYFKESEGGILVDVSCGSGLFSRKFAKSGKYSGVIALDYSENMLRQCKEFIK  227



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 1/159 (1%)
 Frame = +3

Query  216  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  395
            V  R + LACPICY     N      + S    N  C  C+K YS  E ++DL++     
Sbjct  8    VVTRLDSLACPICYQPLIRNSGANPKILSPRGLNFRCQNCQKAYSNYEEYIDLSVTDDSN  67

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  575
             Y  A+ ++TE+FR PLVS+LYERG+ ++F+ W GF G +KEFE +  YL+P +GG I+D
Sbjct  68   EYVGAMPSATEVFRNPLVSYLYERGYGKNFT-WSGFSGLDKEFETVTKYLQPTLGGIIVD  126

Query  576  ASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            ASCGSG+FSR FAK+G++S+ VALDF+E ML++CY F+K
Sbjct  127  ASCGSGMFSRRFAKNGMYSVAVALDFTENMLKECYGFVK  165



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = +3

Query  273  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  452
             G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E     TELFR PLVS
Sbjct  3    KGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVKPVGTELFRSPLVS  62

Query  453  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS  632
            FLYERGWRQ+F+   GFPG ++EF++ QDY K   GG ++D SCGSGLFSR FAKSG +S
Sbjct  63   FLYERGWRQNFNR-SGFPGIDEEFKMAQDYFKSAEGGVLLDVSCGSGLFSRKFAKSGTYS  121

Query  633  LVVALDFSETMLQQCYEFIK  692
             VVALDFSE ML+QCY+F+K
Sbjct  122  GVVALDFSENMLRQCYDFLK  141



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 119/187 (64%), Gaps = 18/187 (10%)
 Frame = +3

Query  132  NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  311
            +RLFA+      T F E K   L D  K E+     ACP+CY+     G PG++L ++ +
Sbjct  196  SRLFAI-----VTEFQEIK-TELNDASKTEV----FACPVCYEPLIRKGPPGMNLPAIYR  245

Query  312  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  491
            S  +CS C K ++  +  +DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+ 
Sbjct  246  SGFKCSKCNKSFTSKDVFLDLTVTSGIKEYSELKPARTELFRSPLVSFLYERGWRQNFNR  305

Query  492  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  671
              GFPG ++EF+        V GG ++D SCGSGLFSR FA SG +S V+ALDFSE ML+
Sbjct  306  -SGFPGRDEEFQ-------SVAGGILVDVSCGSGLFSRKFASSGAYSSVIALDFSENMLR  357

Query  672  QCYEFIK  692
            QCY++IK
Sbjct  358  QCYDYIK  364



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+PL+SFL+ERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRLFA
Sbjct  2    RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRLFA  61

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFS VVALD+SE MLQQCYEFI+
Sbjct  62   KSGLFSFVVALDYSENMLQQCYEFIQ  87



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFA  614
            R+PL+SFL+ERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDASC SGLFSRLFA
Sbjct  36   RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDASCASGLFSRLFA  95

Query  615  KSGLFSLVVALDFSETMLQQCYEFIK  692
            KSGLFS VVALD+SE MLQQCYEFI+
Sbjct  96   KSGLFSFVVALDYSENMLQQCYEFIQ  121



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +3

Query  300  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  479
            ++ +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ
Sbjct  26   AIYRSGFKCKRCQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQ  85

Query  480  SFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSE  659
            +F    GFPGP++EF + Q+Y +P  GG I+D SCGSGLFSR FAKSG +S V+ALDFSE
Sbjct  86   NFRQ-SGFPGPDEEFRMAQEYFEPAKGGRIVDVSCGSGLFSRKFAKSGTYSGVIALDFSE  144

Query  660  TMLQQCYEFIK  692
             ML+QCY+FIK
Sbjct  145  NMLRQCYDFIK  155



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 108/168 (64%), Gaps = 16/168 (10%)
 Frame = +3

Query  189  PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  368
            P + I  +    +T + ACP+CY+     G PG++LS               ++  +  +
Sbjct  51   PFQEIKTEHDASKTEVFACPVCYEPLIRKGPPGMNLS---------------FTSKDVFL  95

Query  369  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  548
            DLT+  G K Y E   A TELFR PLV FLYERGWRQ+F+   GFPG ++EF++ QDY++
Sbjct  96   DLTVTSGMKEYSELKPARTELFRSPLVPFLYERGWRQNFNR-SGFPGRDEEFQMAQDYIQ  154

Query  549  PVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            PV GG ++D S GSGLFSR FA SG +S V+ALDFSE ML+QCY++IK
Sbjct  155  PVAGGILVDVSGGSGLFSRKFASSGAYSSVIALDFSENMLRQCYDYIK  202



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGGK  395
            LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG +
Sbjct  34   LLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGLR  93

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG-----  560
             Y     A T+ FR  LVSFLYERGWRQ F    GFPGP++EF++  DY +         
Sbjct  94   EYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQSATDQGEGG  152

Query  561  ---GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
               G ++D SCGSGLFSR FAKSG+F+ VVALDFSE+ML+QCY F+K
Sbjct  153  GSGGVVVDVSCGSGLFSRRFAKSGVFAGVVALDFSESMLRQCYNFLK  199



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 109/167 (65%), Gaps = 15/167 (9%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGGK  395
            LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG +
Sbjct  34   LLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGLR  93

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG-----  560
             Y     A T+ FR  LVSFLYERGWRQ F    GFPGP++EF++  DY +         
Sbjct  94   EYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQSATDQGEGG  152

Query  561  ---GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
               G ++D SCGSGLFSR FAKSG+F+ VVALDFSE+ML+QCY F+K
Sbjct  153  GSGGVVVDVSCGSGLFSRRFAKSGVFAGVVALDFSESMLRQCYNFLK  199



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSG  623
            LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG+IIDASCGSG+FSR+FAKSG
Sbjct  11   LVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDASCGSGMFSRIFAKSG  70

Query  624  LFSLVVALDFSETMLQQCYEFIK  692
            LFS VVALD+SE ML+QCYEFIK
Sbjct  71   LFSSVVALDYSENMLRQCYEFIK  93



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (61%), Gaps = 16/161 (10%)
 Frame = +3

Query  213  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  389
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  68   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  127

Query  390  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  569
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  128  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKEAEGGLL  186

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D              SG +S V+ALD+SE ML+QC EFIK
Sbjct  187  VD--------------SGKYSGVIALDYSENMLRQCKEFIK  213



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY
Sbjct  97   YLDLTVTAGLKEYVEVQPTRTELFRSPLVSFLYERGWRQNFNR-SGFPGPDEEFKMAQDY  155

Query  543  LKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
             K   GG ++D SCGSGLFSR FAKSG +S VVALDFSE ML+Q YEF K
Sbjct  156  FKSAEGGVLVDVSCGSGLFSRKFAKSGTYSAVVALDFSENMLRQSYEFFK  205



>ref|XP_010042876.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Eucalyptus grandis]
Length=170

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPV-----RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  299
            R+ A K+RA  + +VE +P        + ++K+    N LACPIC++  T+ GDP LS++
Sbjct  37   RVLAPKLRASYSAYVETRPPPPPLESTVRQEKLGGNQNALACPICFEPLTFTGDPVLSVN  96

Query  300  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  479
            S + S L+C TC+K Y GNETH DLT  GG K YGE +  ++ELFR PLVS+LYERGWRQ
Sbjct  97   SASGSTLQCGTCKKAYVGNETHFDLTTTGGTKEYGEPVPFASELFRTPLVSYLYERGWRQ  156

Query  480  SFSLWGGFPGPEKE  521
             F    G PGPEKE
Sbjct  157  YFESLLGSPGPEKE  170



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 107/186 (58%), Gaps = 8/186 (4%)
 Frame = +3

Query  135  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  314
            RL  V  RA +   +  +P+    E+  +      ACPIC    T       S   +AQ+
Sbjct  42   RLRVVPCRATAQP-ISARPLGTDSERVKDSVEYNFACPIC---LTTEFSIQKSNQGLAQA  97

Query  315  NLECSTCRKKYSGNETHVDLTIAGGGKA--YGEALAASTELFRLPLVSFLYERGWRQSFS  488
             L C  C + +S NE  VDLT   G  A  Y ++    T++FR PLVSF YERGWR SF+
Sbjct  98   -LHCDRCARTFSANEKSVDLTSTSGAPARVYKQSFWGGTQIFRSPLVSFAYERGWRSSFT  156

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETML  668
             W GFPG +KEFE+  DYL+   G  ++D SCGSGLFSR F +SG F+ V+A DFSE+ML
Sbjct  157  -WAGFPGEQKEFEMAMDYLQAAYGEVLVDMSCGSGLFSRRFVRSGKFAGVIAADFSESML  215

Query  669  QQCYEF  686
             Q  +F
Sbjct  216  TQAKQF  221



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = +3

Query  243  CPICYDAFTWNGDPGLSLSSMAQSN--LECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  410
            CPIC            SLSSM   +  L C  C++ +  +  ++DLT+  G   + Y + 
Sbjct  82   CPICLQTH-------FSLSSMPTQSGGLSCVRCQRTFPSSPAYLDLTLTSGVRQRVYKQR  134

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI-IDASCG  587
                TELFR PLVSF YERGWRQ F+ W GFPG +KE+++   YL P   G + +D SCG
Sbjct  135  SWGGTELFRNPLVSFAYERGWRQGFA-WAGFPGADKEYDIAMSYLLPAAAGKVLVDMSCG  193

Query  588  SGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            SGLFSR FA+SG FS VVA DFSE+MLQQ  E+
Sbjct  194  SGLFSRRFARSGAFSGVVAADFSESMLQQTREY  226



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = +3

Query  315  NLECSTCRKKYSGNETHVDLTIAGG--GKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
             L C+ C + +  + +++DLT+  G   K Y +     TELFR PLVSF+YERGWRQ F+
Sbjct  10   GLYCNRCVRTFPASPSYLDLTLTAGIKQKVYNQRSWGGTELFRSPLVSFVYERGWRQGFA  69

Query  489  LWGGFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLFSRLFAKSGLFSLVVALDFSETM  665
             W GFPG ++E+++  DYL P  GG + +D SCGSGLFSR FA+SG FS V+A DFSE+M
Sbjct  70   -WAGFPGADREYDIAMDYLLPAAGGKVLVDMSCGSGLFSRRFARSGSFSGVIAADFSESM  128

Query  666  LQQCYEF  686
            LQQ  E+
Sbjct  129  LQQTREY  135



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 15/124 (12%)
 Frame = +3

Query  363  HVDLTIAGGGKAYGEALAASTELFR--------------LPLVSFLYERGWRQSFSLWGG  500
            ++DLTI  G K Y E     TELFR               PLVSFLYERGWRQ+F+   G
Sbjct  2    YLDLTITAGSKDYNELQPNRTELFRNCPCLIFGXFAIVRSPLVSFLYERGWRQNFNX-SG  60

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCY  680
            FPG ++EF++ Q+Y  PV+GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QCY
Sbjct  61   FPGRDEEFKMAQEYFXPVIGGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQCY  120

Query  681  EFIK  692
            +FIK
Sbjct  121  DFIK  124


 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 95/165 (58%), Gaps = 18/165 (11%)
 Frame = +3

Query  231  NLLACPICYDAFTWNGDPGLSLS----------SMAQSNLECSTCRKKYSGNETHVDLTI  380
            +L +CP+CY+     G PGL+L           ++ +S  +C TC K YS  + ++DLTI
Sbjct  232  DLFSCPVCYEXLIRKGPPGLNLXCLKNYTICRPAIYRSGFKCKTCNKSYSSKDMYLDLTI  291

Query  381  AGGGKAYGEALAASTELFR-LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  557
              G KAY EA    TELFR L      Y  G                +F++ Q+Y KP  
Sbjct  292  TAGSKAYNEAQPVRTELFRSLSPRPTGYASGTNH-------IKVDIVQFKMAQEYFKPAA  344

Query  558  GGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            GG ++D SCGSGLFSR FA+SG +S VVALDFSE ML+QCY+FIK
Sbjct  345  GGLLVDVSCGSGLFSRKFAESGTYSGVVALDFSENMLRQCYDFIK  389



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 92/158 (58%), Gaps = 8/158 (5%)
 Frame = +3

Query  237  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALA  416
            LACP C +  + +G  G + +++A+S L C TC K +  + T +DLT+      + E L 
Sbjct  26   LACPTCLEPLSRHGPQGFNRAAIAKSILRCQTCSKDFPSDGTFIDLTLGANRSTWQETLP  85

Query  417  ASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL-------KPVMGGNIID  575
                LFR   +S +YE  WR+SF  + GFPGP++E EL + +L       +P     ++D
Sbjct  86   IGVRLFRTKWISLIYEENWRKSFEKF-GFPGPDREVELAETFLQTAVDPSRPDEENLLVD  144

Query  576  ASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
             SCG+GL SR FAKS  F+ VVA DFSE ML QC+  +
Sbjct  145  ISCGTGLHSRRFAKSATFTAVVAADFSEAMLIQCHALL  182



>ref|XP_009595293.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=169

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = +3

Query  129  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  308
            ++R F  +IRA S   VE + +R   +   E    L +CPICY+     G PG +L ++ 
Sbjct  39   SSRGFNSRIRASSAVAVEPE-LRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLPAIY  95

Query  309  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  488
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ+F+
Sbjct  96   RSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQNFN  155

Query  489  LWGGFPGPEKEFEL  530
            L  GFPGP++E +L
Sbjct  156  L-SGFPGPDEEVKL  168



>ref|XP_009595292.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 6/137 (4%)
 Frame = +3

Query  129  ANRLFAVKIRALSTTFVED---KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  299
            ++R F  +IRA S   VE    K +R   +   E    L +CPICY+     G PG +L 
Sbjct  39   SSRGFNSRIRASSAVAVEPVIAKELRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLP  96

Query  300  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  479
            ++ +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ
Sbjct  97   AIYRSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQ  156

Query  480  SFSLWGGFPGPEKEFEL  530
            +F+L  GFPGP++E +L
Sbjct  157  NFNL-SGFPGPDEEVKL  172



>gb|AFW76187.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=187

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  383
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  384  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY 
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFNR-SGFPGLDEEFQMAQDYF  178



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 104/187 (56%), Gaps = 21/187 (11%)
 Frame = +3

Query  159  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  320
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  321  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  500
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  501  FPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL---DFSETMLQ  671
            FPG E+E +++  Y           A   +  FS   A+  LF+  + L   DFSE ML+
Sbjct  169  FPGLERERDMINIY-----------AQMFTQPFSLRQARKVLFASKLGLAQSDFSENMLK  217

Query  672  QCYEFIK  692
            QC E++K
Sbjct  218  QCNEYVK  224



>gb|EPS57983.1| hypothetical protein M569_16834, partial [Genlisea aurea]
Length=96

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  413
            L ACPIC+      G PG +L ++ +S  +CS+C K YS    ++DLTI  G K Y E +
Sbjct  2    LFACPICHLPLIRKGPPGFNLEAIYRSAFKCSSCNKSYSSKNIYLDLTITAGTKEYNEFV  61

Query  414  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  521
             A TELFR PLVSFLYERGWRQ+F+   GFPGPE+E
Sbjct  62   PARTELFRSPLVSFLYERGWRQNFNR-SGFPGPEEE  96



>gb|ACF86599.1| unknown [Zea mays]
 tpg|DAA49106.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
 tpg|DAA49107.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=186

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = +3

Query  219  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  398
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  399  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  536
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG E+E  L+ 
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREVMLLN  170



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 86/161 (53%), Gaps = 22/161 (14%)
 Frame = +3

Query  234  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC-RKKYSGNETHVDLTIAGGGKA--YG  404
            LLACPIC             L+     +L C+ C R  Y   +  +DL +   G A  Y 
Sbjct  63   LLACPIC-------------LTPFPAGSLRCARCARDAYPTKDGILDLCLDANGAAGAYA  109

Query  405  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG-----GNI  569
            E   + T LF+  ++S  YE GWRQSF+ W GFPG E+E E+   +L+           +
Sbjct  110  EPQRSGTRLFQSDVISAAYENGWRQSFA-WAGFPGEEEETEIAMTFLRGAGATTAPRATL  168

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +D SCGSGLFSR FA SG F+ VVA DFS +M++Q   + +
Sbjct  169  LDVSCGSGLFSRRFAASGEFAHVVASDFSASMMRQTKAYCE  209



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +3

Query  468  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVAL  647
            GWRQ+F+   GFPG ++EF++ QDY + V GG ++D SCGSGLFSR FA SG +S V+AL
Sbjct  72   GWRQNFNR-SGFPGRDEEFQMAQDYFQSVAGGILVDVSCGSGLFSRKFASSGAYSAVIAL  130

Query  648  DFSETMLQQCYEFIK  692
            DFSE ML+QCY++IK
Sbjct  131  DFSENMLRQCYDYIK  145



>emb|CDP12319.1| unnamed protein product [Coffea canephora]
Length=134

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +3

Query  228  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  407
            +NL+   IC D     G  G S+ ++ +S  +C  C K YS    ++DLT+  G K Y E
Sbjct  23   SNLIFNTICDDPLVRRGPSGFSVPAIYRSGFKCRVCNKTYSSKNIYLDLTVTAGSKDYNE  82

Query  408  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELM  533
               A TELFR PLVSFLYERGWRQ+F+   GFPGP KE + +
Sbjct  83   LKPAGTELFRSPLVSFLYERGWRQNFNC-SGFPGPNKEVKFL  123



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 94/165 (57%), Gaps = 8/165 (5%)
 Frame = +3

Query  204  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  374
            +E++ + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  52   NEQEDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  111

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
            TI G   A G  L+AS  +F  P+V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  112  TIPG---ACGVPLSAS--VFENPIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  166

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
             G  I+D SC  G  +R FA S  + LV+A D+SE ML + +  +
Sbjct  167  FGKAIMDLSCAGGTLTRKFAASNAYKLVIASDYSEAMLNESFHLL  211



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +3

Query  423  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN-IIDASCGSGLF  599
            T  F  P V+F YERGWR SF+   GFPGP++EF L Q  L P   G  ++DASCGSGLF
Sbjct  146  TSTFETPQVAFAYERGWRDSFAR-AGFPGPDEEFRLAQAKLLPFAAGKCVVDASCGSGLF  204

Query  600  SRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            +R F KSG +  VVALDFS+ ML+Q   F
Sbjct  205  TRRFVKSGDYGCVVALDFSDAMLRQARTF  233



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 70/122 (57%), Gaps = 13/122 (11%)
 Frame = +3

Query  363  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  542
            + DL I+    ++ EA  + T LF  P+VS  YERGWR SF+ W GFPG EKEF++   +
Sbjct  115  YTDLEISRNANSFREAKLSGTSLFETPIVSNAYERGWRDSFA-WAGFPGKEKEFDVAMRF  173

Query  543  LKPV------------MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            ++              +G  ++D SCGSGLF+R F  S  F  VVA DFSE ML +  +F
Sbjct  174  VRENTNQRQQQNQKQQLGEVVLDVSCGSGLFARKFVDSKAFVRVVASDFSENMLIEASQF  233

Query  687  IK  692
             +
Sbjct  234  AR  235



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 92/165 (56%), Gaps = 8/165 (5%)
 Frame = +3

Query  204  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  374
            +E+  + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  224  NEQDDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  283

Query  375  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  554
            TI G   A G  L+AS  +F   +V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  284  TIPG---ACGVPLSAS--VFENSIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  338

Query  555  MGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFI  689
             G  I+D SC  G  +R FA S  + LV+A D+SE ML + +  +
Sbjct  339  FGKAIMDLSCAGGTLTRKFAASNAYKLVIASDYSEAMLNESFHLL  383



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +3

Query  423  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI-IDASCGSGLF  599
            T  F  P V+F YERGWR SF    GFPGP++E++L +  L P     + +DASCGSGLF
Sbjct  1    TSTFETPQVAFAYERGWRDSFKR-AGFPGPDEEYDLARAKLLPHAADKVLVDASCGSGLF  59

Query  600  SRLFAKSGLFSLVVALDFSETMLQQCYEF  686
            +R FAKSG +S VVALD+S  ML Q  +F
Sbjct  60   TRRFAKSGDYSAVVALDYSAAMLTQARQF  88



>gb|KGN60338.1| hypothetical protein Csa_3G895840 [Cucumis sativus]
Length=180

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (53%), Gaps = 8/155 (5%)
 Frame = +3

Query  84   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRT-NLLACPICYD  260
              ++S  S SP         +      ++T V+     +ID    + +  N+LAC IC+ 
Sbjct  24   FNFHSTLSISPRLSLLTLRSSSAPPMETSTNVQPSDSVMIDNDNEDNKIKNILACSICHG  83

Query  261  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  440
              T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE++ A+TE+FR 
Sbjct  84   PLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GESMPAATEIFRT  142

Query  441  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  545
             LVSFLYERGWR         P P  EF L +D L
Sbjct  143  RLVSFLYERGWRPK-----EIPLPH-EFILNRDLL  171



>ref|XP_005842697.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
 gb|EFN50565.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
Length=190

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +3

Query  237  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  410
            LACPIC         P  +       +L C  C + ++   T+ DLT+  G   KAY ++
Sbjct  81   LACPICLS----TKLPLRNTQGRPTGSLSCPRCNRTFASTPTYADLTLTSGIQQKAYQQS  136

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  548
                T +FR PLVSF+YERGWRQ F+ W GFPG +KEFEL  DYL+
Sbjct  137  WWGGTTIFRSPLVSFVYERGWRQGFA-WAGFPGADKEFELAMDYLQ  181



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +3

Query  324  CSTCRKKYSGNETHVDLT-IAGGGKAYGEAL---AASTELFRLPLVSFLYERGWRQSFSL  491
            C+TC+ + +    +VDLT  A    +    L     S  LF+LPLVS  YERGWR +F+ 
Sbjct  40   CATCKFEPTERRGYVDLTRTASSPPSLLRNLLTQPPSQSLFQLPLVSAAYERGWRANFA-  98

Query  492  WGGFPGPEKEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQ  671
              GFPG EKE +L  D+  P     ++D SCGSGL +R  A SG F  VVA D+S+ ML+
Sbjct  99   RAGFPGIEKERDLFLDFAAPAAA--VLDMSCGSGLMARRLASSGRFGRVVAADYSDAMLR  156

Query  672  QCYEF  686
            Q  E+
Sbjct  157  QTVEY  161



>ref|XP_007227385.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
 gb|EMJ28584.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
Length=205

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  522  FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            FEL +D+LKPV GG+IID SCGSGLFSRLFA+SGLFSLVVALD+SE MLQQ    ++
Sbjct  60   FELAKDFLKPVYGGSIIDTSCGSGLFSRLFARSGLFSLVVALDYSENMLQQNIVLVR  116



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 18/94 (19%)
 Frame = +3

Query  411  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDASCGS  590
            L + TELFR PLVS +YERGWRQ+F    GFPG   + ++  +YL+P  GG I+D SCGS
Sbjct  7    LPSGTELFRNPLVSLIYERGWRQNFER-SGFPG---QLKMALEYLRPAFGGVIVDVSCGS  62

Query  591  GLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
                           V+ALDFSE+MLQQC EF+K
Sbjct  63   A--------------VIALDFSESMLQQCAEFVK  82



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = +3

Query  426  ELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN---------IIDA  578
            +LF  P VSF YERGWRQ F    GFPG + E+EL ++Y +PV+            ++D 
Sbjct  217  DLFTSPQVSFAYERGWRQGFQA-AGFPGADAEYELAKEYFEPVIASKRAKGDGTDVLVDM  275

Query  579  SCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            SC +GLF+R FAKSG ++ V+A D+SE+ML +    I+
Sbjct  276  SCATGLFTRRFAKSGDYTRVIACDYSESMLNEARRRIR  313



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 85/170 (50%), Gaps = 24/170 (14%)
 Frame = +3

Query  204  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV-DLTI  380
            D  + E     LACPIC  AF               +   C+ C + +   +  + DL +
Sbjct  60   DTHRRERARPQLACPICLRAFV--------------AGTTCACCARTFPTIDGKILDLCL  105

Query  381  AGGGK--AYGEA--LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  548
              GG    Y +     + T LF+   ++ +YE GWRQSF+ W GFPG   E+E   +Y+K
Sbjct  106  DAGGANGTYTDPPLRKSGTTLFQSEAIANVYENGWRQSFA-WAGFPGESTEWEYAMEYVK  164

Query  549  PVMGGN----IIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEF  686
                G     ++D SCGSGLF+R FA SG F  VVA D+S +M++Q   +
Sbjct  165  AAGHGGGGGVLLDVSCGSGLFTRRFAASGAFDHVVASDYSASMMRQTVTY  214



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +3

Query  423  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLF  599
            T  F  P V+F YERGWR SF+   GFPGP++E  L  D L      G I+DASCGSGLF
Sbjct  163  TATFETPQVAFAYERGWRDSFAR-AGFPGPDEETRLAMDALGEFARDGIIVDASCGSGLF  221

Query  600  SRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            SR F K+  +  VVALD+S+ ML+Q  ++++
Sbjct  222  SRRFLKTKAYKGVVALDYSDAMLRQAKQYME  252



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 82/153 (54%), Gaps = 19/153 (12%)
 Frame = +3

Query  228  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  407
             N L CP  +   +W     +S  S      + +  R +Y+ +E           +  G 
Sbjct  162  ANRLRCPNGHGEASWIQ---VSEKSRGGGFWDLTPQRFRYNVDE-----------RPRGP  207

Query  408  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN-IIDASC  584
            ++    +LF+ P V+FLYERGWR  F    GFPGP+ EF ++Q + K   G N ++D SC
Sbjct  208  SVELRRDLFQSPFVAFLYERGWRDQFRS-SGFPGPDAEFRIVQSFFK---GANCVMDLSC  263

Query  585  GSGLFSRLFAKSGLFSLVVALDFSETMLQQCYE  683
            GSGLF+R  A SG F  V+A+D+SE ML++  E
Sbjct  264  GSGLFTRRLAASGDFDHVIAVDYSEAMLRELVE  296



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 63/108 (58%), Gaps = 5/108 (5%)
 Frame = +3

Query  381  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  560
            A  G   GE      +LF  P+VS  YERGWRQ F+   GFPG + E +L  DY  PVM 
Sbjct  174  ATAGFPMGEDYVPMRDLFTSPVVSAAYERGWRQGFA-QAGFPGADDEAQLAMDYFAPVMA  232

Query  561  ----GNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
                  ++D SC +GLF+R FAKSG ++ V+  D+S +ML + +  I+
Sbjct  233  MSDTKTLVDMSCATGLFTRRFAKSGKYARVLGCDYSASMLNEAHTRIQ  280



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  429  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL-KPVMGGNIIDASCGSGLFSR  605
            LF  PLVSF YERGWR +F    GFPG E E E   + L +  +G  IID SCGSGLF+R
Sbjct  163  LFESPLVSFAYERGWRDNFKR-SGFPGVEVEKENAMEALGEDAVGDVIIDCSCGSGLFTR  221

Query  606  LFAKSGLFSLVVALDFSETMLQQCYE  683
             FA+SG +  +VALDFSE+M+++  E
Sbjct  222  EFARSGKYDGIVALDFSESMIKEAME  247



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  351  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL  530
             N   V   +AG G A  +      ELFR P+VS+LYERGWR  F+   GFPG EKE+EL
Sbjct  124  ANNPLVSAFLAGAG-AQMDGQPLRQELFRTPVVSWLYERGWRAGFAS-AGFPGIEKEYEL  181

Query  531  MQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFS-------LVVALDFSETMLQQCYEFI  689
            + D+ +      ++D SCGSGL  R  AKS  +S        V+A+D+SE ML +  +  
Sbjct  182  VMDFFQEARNKTVVDLSCGSGLMVRRLAKSRAYSKAMGERLQVIAVDYSENMLGEVIQRK  241

Query  690  K  692
            K
Sbjct  242  K  242



>ref|XP_009602551.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Nicotiana tomentosiformis]
Length=181

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  519  EFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            +F++ Q+Y K   GG ++D SCGSGLFSR FAKSG +S V+ALDFSE ML+QCY+FIK
Sbjct  2    QFKMAQEYFKVAEGGVLVDVSCGSGLFSRKFAKSGTYSRVIALDFSENMLRQCYDFIK  59



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 7/96 (7%)
 Frame = +3

Query  423  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP-VMGGNIIDASCGSGLF  599
            T  F  P V+F YERGWR SF    GFPGP++E  L  D L     GG ++DASCGSGLF
Sbjct  1    TATFETPQVAFAYERGWRDSFKR-AGFPGPDEEARLAVDALGEFAKGGIVVDASCGSGLF  59

Query  600  SRLFAK-----SGLFSLVVALDFSETMLQQCYEFIK  692
            +R F K     S  +  VVALD+S+ ML+Q  ++++
Sbjct  60   TRRFLKTYKGRSKAYKGVVALDYSDAMLRQAKQYME  95



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 21/131 (16%)
 Frame = +3

Query  342  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  512
            KY  NE ++DL  A        +  +   + ELFR PL SFLYERGWR +F    GFPG 
Sbjct  136  KYPANEVYMDLVPAEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPGI  194

Query  513  EKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSRLFAKSGLFSLVV  641
            ++EF  ++ +  P+                   G +ID SCGSGL +R   +S  +  V+
Sbjct  195  DEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLTARRLCRSRKWKRVI  254

Query  642  ALDFSETMLQQ  674
            A DFSE+ML++
Sbjct  255  AADFSESMLRE  265



>gb|EEE66113.1| hypothetical protein OsJ_22149 [Oryza sativa Japonica Group]
Length=237

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  522  FELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            F++ QDY + V GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML QCYEFI+
Sbjct  53   FQMAQDYFQSVAGGVLLDVSCGSGLFTRKFAKSGSYSAVIALDFSENMLCQCYEFIQ  109



>gb|AFW76188.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=206

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  516  KEFELMQDYLKPVMGGNIIDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQCYEFIK  692
            K F+ ++   +P+ GG ++D SCGSGLF+R FAKSG +S V+ALDFSE ML+QCYEFIK
Sbjct  19   KSFKWLKTIFQPIAGGILLDVSCGSGLFTRKFAKSGTYSAVIALDFSENMLRQCYEFIK  77



>ref|XP_006473932.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=139

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPL  446
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR PL
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRTPL  130



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (52%), Gaps = 21/132 (16%)
 Frame = +3

Query  339  KKYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  509
             KY  NE ++DL           +  +   + ELFR PL SFLYERGWR +F    GFPG
Sbjct  135  NKYPANEVYMDLVPVEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPG  193

Query  510  PEKEFELMQDYLKPVMG-----------------GNIIDASCGSGLFSRLFAKSGLFSLV  638
             ++EF  ++ +  P+                   G +ID SCGSGL +R   +S  +  V
Sbjct  194  IDEEFRDLEAFFAPLSDAGSESEREGEQQRRSGRGTVIDLSCGSGLMARRLCRSRKWKRV  253

Query  639  VALDFSETMLQQ  674
            +A DFSE+ML++
Sbjct  254  IAADFSESMLRE  265



>ref|XP_006474605.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=160

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 8/121 (7%)
 Frame = +3

Query  111  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  290
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  291  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV--SFLYE  464
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR  LV  +F +E
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRCVLVILAFFHE  138

Query  465  R  467
            +
Sbjct  139  K  139



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = +3

Query  396  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM--GGNI  569
            + GEA+   T  F+ PLVS+LYERGWRQ FS   GFPG ++EF L  +Y       G  +
Sbjct  251  SRGEAVKEGT--FQTPLVSWLYERGWRQGFSA-NGFPGIDEEFRLASEYFSSTGADGKAV  307

Query  570  IDASCGSGLFSRLFAKSGLFSLVVALDFSETMLQQ  674
            ID SCGSGL  R    SG +S V+  D S TML +
Sbjct  308  IDLSCGSGLMMRRLVSSGRYSRVIGGDLSPTMLAE  342



>ref|XP_002306577.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
 gb|EEE93573.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
Length=122

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +3

Query  120  TPKANRL-FAVKIRALSTTFVEDKPVRLID-EKKVEIRTNLLACPICYDAFTWNGDPGLS  293
            TP   R  FA KIRA ST F E KP   +  EK V    N+LACP+CY+  T  G   LS
Sbjct  29   TPTFKRTSFATKIRASSTAFAETKPTGPVTVEKDVRSSKNILACPVCYEPVTLIGATVLS  88

Query  294  LSSMAQSNLECSTCRKKYSGNETHV  368
            + S   S+L+CSTC+K YSG ET +
Sbjct  89   VYSARGSSLQCSTCKKTYSGKETQL  113



>ref|XP_005705444.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
 gb|EME28924.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
Length=331

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 95/204 (47%), Gaps = 34/204 (17%)
 Frame = +3

Query  90   YNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT  269
            +N K+SF+ L     R   V  R +  T          D + +E   +LLACP C +   
Sbjct  34   WNRKWSFA-LIVADKRTSPVAQRVMDIT---------NDTEALERLADLLACPNCRN---  80

Query  270  WNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAA----STELFR  437
                   SL S    +  C  C + +  +        AG      + L++      ELFR
Sbjct  81   -------SLVSRNNRSFICLNCYRTFFQD------PYAGYFNLCLDKLSSYRPIQQELFR  127

Query  438  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK--PVMGGNIIDASCGSGLFSRLF  611
             P+ SFLYERGWR +F    G+P  E E  L+ +Y +  P     ++D SCG+G  +R  
Sbjct  128  NPVTSFLYERGWRNNFQT-MGYPLKE-EVRLVTEYFQTYPKEPEVLVDLSCGTGYVTRRL  185

Query  612  AKSGLFSLVVALDFSETMLQQCYE  683
            AK+  +S +V +D SE+ML++ Y 
Sbjct  186  AKTRKYSRIVGIDLSESMLKEAYR  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340