BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021E11

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365150.1|  PREDICTED: BTB/POZ domain-containing protein...    164   6e-44   Solanum tuberosum [potatoes]
ref|XP_004251284.1|  PREDICTED: BTB/POZ domain-containing protein...    163   8e-44   Solanum lycopersicum
ref|XP_002281741.1|  PREDICTED: BTB/POZ domain-containing protein...    159   3e-42   Vitis vinifera
ref|XP_009610322.1|  PREDICTED: BTB/POZ domain-containing protein...    155   6e-41   Nicotiana tomentosiformis
ref|XP_009774422.1|  PREDICTED: BTB/POZ domain-containing protein...    155   8e-41   Nicotiana sylvestris
ref|XP_010260115.1|  PREDICTED: BTB/POZ domain-containing protein...    155   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010112313.1|  hypothetical protein L484_011179                   131   4e-34   
emb|CDP08962.1|  unnamed protein product                                134   4e-33   Coffea canephora [robusta coffee]
ref|XP_010685873.1|  PREDICTED: BTB/POZ domain-containing protein...    130   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008222552.1|  PREDICTED: BTB/POZ domain-containing protein...    129   1e-31   Prunus mume [ume]
gb|EYU18898.1|  hypothetical protein MIMGU_mgv1a005394mg                127   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_009354521.1|  PREDICTED: BTB/POZ domain-containing protein...    125   5e-30   Pyrus x bretschneideri [bai li]
ref|XP_004294641.1|  PREDICTED: BTB/POZ domain-containing protein...    124   1e-29   Fragaria vesca subsp. vesca
ref|XP_008349723.1|  PREDICTED: BTB/POZ domain-containing protein...    123   2e-29   Malus domestica [apple tree]
gb|KHG07032.1|  hypothetical protein F383_02815                         121   8e-29   Gossypium arboreum [tree cotton]
ref|XP_011089383.1|  PREDICTED: BTB/POZ domain-containing protein...    121   8e-29   
gb|KJB20225.1|  hypothetical protein B456_003G139200                    120   2e-28   Gossypium raimondii
ref|XP_008358075.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-27   
ref|XP_010043649.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    117   2e-27   
gb|KJB08821.1|  hypothetical protein B456_001G105900                    117   3e-27   Gossypium raimondii
gb|KCW85653.1|  hypothetical protein EUGRSUZ_B02440                     117   4e-27   Eucalyptus grandis [rose gum]
ref|XP_007016614.1|  BTB/POZ domain-containing protein                  115   1e-26   
gb|KHG05277.1|  hypothetical protein F383_30980                         115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_003540755.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-26   Glycine max [soybeans]
gb|KHN05697.1|  BTB/POZ domain-containing protein                       113   7e-26   Glycine soja [wild soybean]
ref|XP_010520319.1|  PREDICTED: BTB/POZ domain-containing protein...    113   1e-25   Tarenaya hassleriana [spider flower]
gb|EPS62176.1|  hypothetical protein M569_12618                         112   2e-25   Genlisea aurea
ref|XP_004505925.1|  PREDICTED: BTB/POZ domain-containing protein...    112   3e-25   Cicer arietinum [garbanzo]
ref|XP_007205061.1|  hypothetical protein PRUPE_ppa004481mg             110   1e-24   
ref|XP_006591005.1|  PREDICTED: BTB/POZ domain-containing protein...    109   2e-24   Glycine max [soybeans]
ref|XP_007132142.1|  hypothetical protein PHAVU_011G070200g             108   3e-24   Phaseolus vulgaris [French bean]
ref|XP_002531830.1|  protein binding protein, putative                  105   1e-22   Ricinus communis
gb|AES88747.2|  BTB/POZ domain plant protein                            102   5e-22   Medicago truncatula
emb|CDY09229.1|  BnaA02g06550D                                          102   9e-22   Brassica napus [oilseed rape]
ref|XP_009126626.1|  PREDICTED: BTB/POZ domain-containing protein...    102   9e-22   Brassica rapa
ref|XP_003606550.1|  hypothetical protein MTR_4g061670                  102   1e-21   
gb|KDO73042.1|  hypothetical protein CISIN_1g010024mg                   102   1e-21   Citrus sinensis [apfelsine]
ref|XP_006424700.1|  hypothetical protein CICLE_v10028213mg             101   2e-21   Citrus clementina [clementine]
gb|KDP44149.1|  hypothetical protein JCGZ_05616                         100   3e-21   Jatropha curcas
ref|NP_200813.1|  BTB/POZ domain-containing protein                     100   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866364.1|  hypothetical protein ARALYDRAFT_358221             100   6e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_010483651.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006281633.1|  hypothetical protein CARUB_v10027763mg           98.6    2e-20   Capsella rubella
ref|XP_010455877.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010443796.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002299517.2|  hypothetical protein POPTR_0001s09710g           97.1    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006400887.1|  hypothetical protein EUTSA_v10013333mg           95.9    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009398931.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011015247.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    6e-19   Populus euphratica
ref|XP_011015245.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    6e-19   Populus euphratica
gb|AAR14275.1|  predicted protein                                     94.4    8e-19   Populus tremula x Populus alba [gray poplar]
ref|XP_006419001.1|  hypothetical protein EUTSA_v10002519mg           92.8    1e-18   
ref|XP_011029330.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    1e-18   Populus euphratica
ref|XP_010255266.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002303602.2|  hypothetical protein POPTR_0003s13090g           93.6    2e-18   
gb|KDP25402.1|  hypothetical protein JCGZ_20558                       93.6    2e-18   Jatropha curcas
ref|XP_009628159.1|  PREDICTED: BTB/POZ domain-containing protein...  93.6    2e-18   Nicotiana tomentosiformis
ref|XP_011022633.1|  PREDICTED: BTB/POZ domain-containing protein...  93.2    3e-18   Populus euphratica
ref|XP_008807229.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    4e-18   Phoenix dactylifera
emb|CDP12055.1|  unnamed protein product                              91.7    8e-18   Coffea canephora [robusta coffee]
ref|XP_009800799.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    1e-17   Nicotiana sylvestris
ref|XP_011080923.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    2e-17   
ref|XP_009389780.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776124.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    6e-17   
ref|XP_008776113.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    6e-17   
ref|XP_004143891.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    8e-17   
ref|XP_007040317.1|  BTB/POZ domain-containing protein isoform 3      88.6    8e-17   
ref|XP_008437316.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    8e-17   Cucumis melo [Oriental melon]
gb|EYU40075.1|  hypothetical protein MIMGU_mgv1a002655mg              88.6    9e-17   Erythranthe guttata [common monkey flower]
ref|XP_008783441.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    1e-16   Phoenix dactylifera
ref|XP_011005022.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    1e-16   Populus euphratica
gb|KGN50074.1|  hypothetical protein Csa_5G152890                     88.6    1e-16   Cucumis sativus [cucumbers]
ref|XP_007040315.1|  BTB/POZ domain-containing protein isoform 1      88.6    1e-16   
gb|KJB37507.1|  hypothetical protein B456_006G208800                  88.2    1e-16   Gossypium raimondii
ref|XP_010922477.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    1e-16   
ref|XP_010069058.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    1e-16   Eucalyptus grandis [rose gum]
gb|KEH21112.1|  BTB/POZ domain plant protein                          87.8    1e-16   Medicago truncatula
ref|XP_010069057.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-16   Eucalyptus grandis [rose gum]
ref|XP_002298385.2|  hypothetical protein POPTR_0001s24050g           87.0    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002279382.2|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-16   Vitis vinifera
ref|XP_006829095.1|  hypothetical protein AMTR_s00001p00262820        87.4    2e-16   
emb|CBI34370.3|  unnamed protein product                              87.0    2e-16   Vitis vinifera
ref|XP_004245578.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    2e-16   Solanum lycopersicum
ref|XP_008783774.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    2e-16   Phoenix dactylifera
ref|XP_009400477.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073126.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  87.0    3e-16   Sesamum indicum [beniseed]
gb|KHG15549.1|  hypothetical protein F383_06896                       87.0    3e-16   Gossypium arboreum [tree cotton]
ref|XP_010058250.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  86.7    4e-16   
ref|XP_010089067.1|  BTB/POZ domain-containing protein                85.5    5e-16   
ref|XP_006343947.1|  PREDICTED: BTB/POZ domain-containing protein...  86.7    5e-16   Solanum tuberosum [potatoes]
ref|XP_004503685.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    6e-16   Cicer arietinum [garbanzo]
ref|XP_010933990.1|  PREDICTED: BTB/POZ domain-containing protein...  85.9    9e-16   Elaeis guineensis
ref|XP_003532421.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    1e-15   Glycine max [soybeans]
ref|XP_007160095.1|  hypothetical protein PHAVU_002G291900g           84.7    2e-15   Phaseolus vulgaris [French bean]
gb|AIB05883.1|  TRAF transcription factor                             84.7    2e-15   Zea mays [maize]
ref|NP_001169621.1|  uncharacterized protein LOC100383502             84.7    2e-15   Zea mays [maize]
gb|AFW59116.1|  hypothetical protein ZEAMMB73_743291                  84.7    2e-15   
ref|XP_008238939.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    2e-15   Prunus mume [ume]
ref|XP_007210316.1|  hypothetical protein PRUPE_ppa002210mg           84.7    2e-15   
ref|XP_001751363.1|  predicted protein                                83.6    2e-15   
gb|KJB52168.1|  hypothetical protein B456_008G248700                  84.3    2e-15   Gossypium raimondii
gb|KHG02986.1|  hypothetical protein F383_23864                       84.3    3e-15   Gossypium arboreum [tree cotton]
ref|XP_006355468.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    3e-15   Solanum tuberosum [potatoes]
ref|NP_001053645.1|  Os04g0579700                                     83.6    4e-15   
gb|KHG01374.1|  hypothetical protein F383_23678                       83.6    4e-15   Gossypium arboreum [tree cotton]
ref|XP_006476518.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_006652685.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    6e-15   
emb|CDY38217.1|  BnaA09g11720D                                        82.8    6e-15   Brassica napus [oilseed rape]
gb|KJB20610.1|  hypothetical protein B456_003G156100                  83.2    6e-15   Gossypium raimondii
ref|XP_009112778.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    7e-15   Brassica rapa
ref|XP_010233737.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    8e-15   Brachypodium distachyon [annual false brome]
ref|XP_010555851.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    1e-14   Tarenaya hassleriana [spider flower]
gb|KCW72192.1|  hypothetical protein EUGRSUZ_E00642                   81.3    1e-14   Eucalyptus grandis [rose gum]
emb|CDY08328.1|  BnaC09g12680D                                        82.0    1e-14   Brassica napus [oilseed rape]
ref|XP_003524451.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    1e-14   Glycine max [soybeans]
dbj|BAJ96039.1|  predicted protein                                    81.3    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004976580.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    2e-14   
ref|XP_010919095.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-14   Elaeis guineensis
gb|KFK38021.1|  hypothetical protein AALP_AA3G059800                  80.9    3e-14   Arabis alpina [alpine rockcress]
ref|XP_004300808.1|  PREDICTED: BTB/POZ domain-containing protein...  81.3    3e-14   Fragaria vesca subsp. vesca
ref|XP_002531214.1|  protein binding protein, putative                80.5    3e-14   Ricinus communis
ref|XP_009341340.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    4e-14   Pyrus x bretschneideri [bai li]
gb|KHN16799.1|  BTB/POZ domain-containing protein                     79.7    4e-14   Glycine soja [wild soybean]
ref|XP_002446981.1|  hypothetical protein SORBIDRAFT_06g026230        80.5    5e-14   
gb|AAZ67992.1|  At5g63850                                             77.4    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ67986.1|  At5g63850                                             77.4    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ68003.1|  At5g63850-like protein                                77.4    6e-14   Arabidopsis lyrata [lyrate rockcress]
gb|EPS69450.1|  hypothetical protein M569_05314                       80.1    6e-14   Genlisea aurea
gb|AAZ67998.1|  At5g63850                                             77.4    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009363413.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_001762013.1|  predicted protein                                79.3    6e-14   
ref|XP_009419272.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    9e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006439497.1|  hypothetical protein CICLE_v10019226mg           79.3    1e-13   Citrus clementina [clementine]
gb|KDO76298.1|  hypothetical protein CISIN_1g006210mg                 79.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_002887934.1|  hypothetical protein ARALYDRAFT_315042           79.3    1e-13   Arabidopsis lyrata subsp. lyrata
ref|NP_176570.1|  BTB/POZ domain-containing protein                   79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418426.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006302105.1|  hypothetical protein CARUB_v10020096mg           79.0    2e-13   Capsella rubella
ref|XP_010430498.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010473631.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006828235.1|  hypothetical protein AMTR_s00023p00185370        78.2    2e-13   Amborella trichopoda
ref|XP_002974611.1|  hypothetical protein SELMODRAFT_271097           77.8    3e-13   
ref|XP_002963321.1|  hypothetical protein SELMODRAFT_270367           77.4    3e-13   
ref|XP_009397488.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676445.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    4e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB24321.1|  hypothetical protein B456_004G139400                  77.0    5e-13   Gossypium raimondii
gb|EMT26347.1|  hypothetical protein F775_16772                       77.0    5e-13   
gb|AAZ68001.1|  At5g63850                                             72.0    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875751.1|  predicted protein                                70.5    4e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_008665486.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    6e-12   Zea mays [maize]
ref|XP_004981619.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    3e-11   
ref|XP_006391703.1|  hypothetical protein EUTSA_v10023392mg           71.6    4e-11   Eutrema salsugineum [saltwater cress]
dbj|BAK06120.1|  predicted protein                                    71.2    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008808898.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    6e-11   Phoenix dactylifera
gb|AAX19868.1|  unknown                                               68.2    7e-11   Doryanthes excelsa
ref|XP_002990647.1|  hypothetical protein SELMODRAFT_185507           70.5    8e-11   
ref|XP_007203630.1|  hypothetical protein PRUPE_ppa003965mg           70.5    9e-11   Prunus persica
ref|XP_002968764.1|  hypothetical protein SELMODRAFT_90136            70.1    1e-10   
ref|XP_010941741.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    1e-10   Elaeis guineensis
ref|NP_001051395.1|  Os03g0769400                                     70.1    1e-10   
gb|EAY91984.1|  hypothetical protein OsI_13674                        70.1    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_008241873.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    1e-10   Prunus mume [ume]
ref|XP_002522395.1|  protein binding protein, putative                70.1    1e-10   Ricinus communis
gb|EMT31851.1|  hypothetical protein F775_21356                       69.7    2e-10   
ref|XP_008338977.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  69.3    2e-10   
ref|XP_009376454.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_008797004.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    4e-10   Phoenix dactylifera
ref|XP_006650658.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    4e-10   Oryza brachyantha
ref|XP_008338182.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    4e-10   
ref|NP_001058798.2|  Os07g0123500                                     67.8    6e-10   
ref|XP_003548003.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    9e-10   Glycine max [soybeans]
ref|XP_009419041.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407431.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407677.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010243288.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    1e-09   Nelumbo nucifera [Indian lotus]
gb|KHN36167.1|  BTB/POZ domain-containing protein                     66.6    2e-09   Glycine soja [wild soybean]
ref|XP_008661718.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   
ref|XP_003517262.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   
ref|XP_007156873.1|  hypothetical protein PHAVU_002G024700g           66.2    2e-09   Phaseolus vulgaris [French bean]
ref|XP_009379165.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_002461387.1|  hypothetical protein SORBIDRAFT_02g001910        65.9    3e-09   Sorghum bicolor [broomcorn]
ref|XP_007156002.1|  hypothetical protein PHAVU_003G250400g           65.9    3e-09   Phaseolus vulgaris [French bean]
ref|XP_004955396.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    3e-09   Setaria italica
ref|XP_009388509.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008440171.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    4e-09   Cucumis melo [Oriental melon]
ref|XP_004160488.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  65.5    4e-09   
ref|XP_004141951.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    4e-09   
ref|XP_006657417.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    4e-09   Oryza brachyantha
gb|KDP31825.1|  hypothetical protein JCGZ_12286                       65.1    5e-09   Jatropha curcas
ref|XP_002307226.1|  hypothetical protein POPTR_0005s13800g           65.1    5e-09   Populus trichocarpa [western balsam poplar]
emb|CDP02424.1|  unnamed protein product                              65.1    5e-09   Coffea canephora [robusta coffee]
ref|XP_003558813.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    6e-09   Brachypodium distachyon [annual false brome]
ref|XP_003557600.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    6e-09   Brachypodium distachyon [annual false brome]
gb|KHN44517.1|  BTB/POZ domain-containing protein                     64.3    8e-09   Glycine soja [wild soybean]
ref|XP_002310195.1|  hypothetical protein POPTR_0007s12160g           64.3    9e-09   Populus trichocarpa [western balsam poplar]
ref|NP_001168062.1|  hypothetical protein                             64.3    9e-09   Zea mays [maize]
ref|XP_010254985.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    9e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010547478.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-08   
ref|XP_007047072.1|  Cell division protease ftsH isoform 1            63.9    1e-08   
ref|XP_003537445.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    1e-08   Glycine max [soybeans]
gb|KHN42029.1|  BTB/POZ domain-containing protein                     63.9    1e-08   Glycine soja [wild soybean]
ref|XP_011025688.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    1e-08   Populus euphratica
ref|XP_004300583.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    1e-08   Fragaria vesca subsp. vesca
gb|KHN00573.1|  BTB/POZ domain-containing protein                     62.8    2e-08   Glycine soja [wild soybean]
gb|KEH20448.1|  BTB/POZ domain plant protein                          62.8    3e-08   Medicago truncatula
ref|XP_004509225.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    3e-08   Cicer arietinum [garbanzo]
ref|XP_010941924.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    3e-08   Elaeis guineensis
dbj|BAJ95813.1|  predicted protein                                    62.4    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002275454.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    3e-08   Vitis vinifera
ref|XP_010680938.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    4e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT14102.1|  hypothetical protein F775_07870                       62.0    4e-08   
ref|XP_009115752.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    5e-08   
ref|XP_010029862.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    5e-08   
gb|KFK34324.1|  hypothetical protein AALP_AA5G130100                  62.0    5e-08   Arabis alpina [alpine rockcress]
gb|ACR38622.1|  unknown                                               61.6    5e-08   Zea mays [maize]
ref|XP_006466699.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    6e-08   Citrus sinensis [apfelsine]
ref|XP_010558026.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    6e-08   Tarenaya hassleriana [spider flower]
ref|XP_006290909.1|  hypothetical protein CARUB_v10017022mg           61.6    7e-08   Capsella rubella
ref|XP_011099262.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    8e-08   
gb|KDO79424.1|  hypothetical protein CISIN_1g014635mg                 61.2    8e-08   Citrus sinensis [apfelsine]
ref|XP_009397738.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    9e-08   
gb|EMS65337.1|  hypothetical protein TRIUR3_32744                     61.2    1e-07   Triticum urartu
ref|XP_010426621.1|  PREDICTED: BTB/POZ domain-containing protein...  60.8    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010515449.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010503746.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    1e-07   Camelina sativa [gold-of-pleasure]
gb|KJB17837.1|  hypothetical protein B456_003G018200                  60.5    1e-07   Gossypium raimondii
gb|EYU39382.1|  hypothetical protein MIMGU_mgv1a003833mg              60.5    2e-07   Erythranthe guttata [common monkey flower]
emb|CDX77944.1|  BnaA09g31390D                                        60.5    2e-07   
ref|XP_011009912.1|  PREDICTED: BTB/POZ domain-containing protein...  60.5    2e-07   Populus euphratica
ref|XP_002877770.1|  hypothetical protein ARALYDRAFT_323639           60.1    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006404002.1|  hypothetical protein EUTSA_v10010286mg           60.1    2e-07   Eutrema salsugineum [saltwater cress]
ref|NP_190647.1|  uncharacterized protein                             59.7    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085536.1|  PREDICTED: BTB/POZ domain-containing protein...  58.9    6e-07   Sesamum indicum [beniseed]
gb|KHG25971.1|  hypothetical protein F383_06642                       58.5    6e-07   Gossypium arboreum [tree cotton]
ref|XP_009776607.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    8e-07   Nicotiana sylvestris
ref|XP_009629328.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    8e-07   Nicotiana tomentosiformis
ref|XP_006338266.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    1e-06   Solanum tuberosum [potatoes]
ref|XP_004232086.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    2e-06   Solanum lycopersicum
ref|XP_004963062.1|  PREDICTED: BTB/POZ domain-containing protein...  57.0    2e-06   Setaria italica
ref|XP_006856144.1|  hypothetical protein AMTR_s00059p00166010        57.0    2e-06   Amborella trichopoda
ref|XP_006664162.1|  PREDICTED: BTB/POZ domain-containing protein...  56.6    3e-06   Oryza brachyantha
ref|XP_006419030.1|  hypothetical protein EUTSA_v10003115mg           55.8    5e-06   
gb|EEE53535.1|  hypothetical protein OsJ_36742                        53.9    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABG22069.1|  expressed protein                                     53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99196.2|  expressed protein                                     53.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097900.1|  BTB/POZ domain-containing protein                52.4    8e-05   Morus notabilis
ref|XP_002452861.1|  hypothetical protein SORBIDRAFT_04g033760        49.7    3e-04   
ref|XP_002442447.1|  hypothetical protein SORBIDRAFT_08g020150        50.4    3e-04   
ref|XP_002438728.1|  hypothetical protein SORBIDRAFT_10g025090        47.8    8e-04   



>ref|XP_006365150.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
tuberosum]
Length=496

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 15/123 (12%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+EQ+R  + S E+R+R QER+SRVLA APF +               GDV+LT
Sbjct  56   TLFEMMSEEQTRESKHSLESRYRTQERVSRVLAEAPFPAV--------------GDVRLT  101

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCED  600
            IAARDG+ KVSMDVHRRVL GRSRFFA+KL+R+GSHSVEILDCDDVEVYV+T+VLMYC+D
Sbjct  102  IAARDGF-KVSMDVHRRVLVGRSRFFADKLQRNGSHSVEILDCDDVEVYVETLVLMYCDD  160

Query  601  LKK  609
            LKK
Sbjct  161  LKK  163



>ref|XP_004251284.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
lycopersicum]
Length=498

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 15/123 (12%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+EQ+R  + S E+R+R QER+SRVLA APF +               GDV+LT
Sbjct  58   TLFEMMSEEQTRESKHSLESRYRTQERVSRVLADAPFPAV--------------GDVRLT  103

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCED  600
            I ARDG+ KVSMDVHRRVL GRSRFFAEKL+R+GSHSVEILDCDDVEVYV+T+VLMYC+D
Sbjct  104  IGARDGF-KVSMDVHRRVLVGRSRFFAEKLQRNGSHSVEILDCDDVEVYVETLVLMYCDD  162

Query  601  LKK  609
            LKK
Sbjct  163  LKK  165



>ref|XP_002281741.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 ref|XP_010651088.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 emb|CBI16228.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 132/190 (69%), Gaps = 25/190 (13%)
 Frame = +1

Query  46   MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  225
            MA+DN LK+ QV STMIKQGFISDP  +         P+  L+  ++SPPP     S   
Sbjct  1    MAADNILKSRQV-STMIKQGFISDPTITFS-------PSRPLSRVSLSPPPPSASPSKS-  51

Query  226  apptQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  405
                 TLF+MMS+EQSR  R S  AR ++Q++++RVLA APF+ P+          G  G
Sbjct  52   ----PTLFEMMSEEQSRESRHSDVARRKLQDQVARVLADAPFRDPA---------WGEFG  98

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKTV  579
            DVKLT+A+RDG+ KVSMDVHRRVL  +SRFFAEKLRR G  SHSVEI DCDDVE+YV+TV
Sbjct  99   DVKLTVASRDGF-KVSMDVHRRVLVEQSRFFAEKLRRDGAVSHSVEICDCDDVEIYVETV  157

Query  580  VLMYCEDLKK  609
            VLMYCEDL+K
Sbjct  158  VLMYCEDLRK  167



>ref|XP_009610322.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
tomentosiformis]
Length=503

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 16/124 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSP-EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            TLF+MMS+EQ+R  + S  E+RH+  ER+S+VLA APF                 GDV+L
Sbjct  63   TLFEMMSEEQTRESKHSLFESRHKAHERVSKVLADAPFPRV--------------GDVRL  108

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCE  597
            TIAARDG+ KVSMDVHRRVL GRSRFFAEKL+ +GSHSVEILDCDDVEVYV+T+VLMYCE
Sbjct  109  TIAARDGF-KVSMDVHRRVLIGRSRFFAEKLKSNGSHSVEILDCDDVEVYVETLVLMYCE  167

Query  598  DLKK  609
            DLKK
Sbjct  168  DLKK  171



>ref|XP_009774422.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
sylvestris]
Length=502

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 16/124 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSP-EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            TLF+MMS+EQ+R  + S  E+RH+  ER+S+VLA APF                 GDV+L
Sbjct  62   TLFEMMSEEQTRESKHSLFESRHKAHERVSKVLADAPFPRV--------------GDVRL  107

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCE  597
            TIAARDG+ KVSMDVHRRVL GRSRFFAEKL+ +GSHSVEILDCDDVEVYV+T+VLMYCE
Sbjct  108  TIAARDGF-KVSMDVHRRVLIGRSRFFAEKLKSNGSHSVEILDCDDVEVYVETLVLMYCE  166

Query  598  DLKK  609
            DLKK
Sbjct  167  DLKK  170



>ref|XP_010260115.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nelumbo 
nucifera]
Length=560

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 130/190 (68%), Gaps = 17/190 (9%)
 Frame = +1

Query  46   MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  225
            MA+DN LK+ +V S MIKQGFISDP     P        ++++ ++     +  PA    
Sbjct  51   MAADNVLKSREV-SAMIKQGFISDPTLCFSPSRM----ISRVSPSSSPSKSSPPPAFSDK  105

Query  226  apptQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  405
               + TLF+MMS+EQ R  ++S + RH++QERISR+LA APFQ+P+          GS G
Sbjct  106  MRSSPTLFEMMSEEQQREAKRSEDKRHKLQERISRILAEAPFQNPNW---------GSAG  156

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKTV  579
            DVKLT+ +RDG+ +VSM+VHR VLA RSRFFAEKLR  G  +HSVEI DCDDVEVYV+TV
Sbjct  157  DVKLTVTSRDGF-RVSMNVHRSVLADRSRFFAEKLRPDGAITHSVEICDCDDVEVYVETV  215

Query  580  VLMYCEDLKK  609
            VLMY EDLKK
Sbjct  216  VLMYSEDLKK  225



>ref|XP_010112313.1| hypothetical protein L484_011179 [Morus notabilis]
 gb|EXC33202.1| hypothetical protein L484_011179 [Morus notabilis]
Length=200

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 125/193 (65%), Gaps = 18/193 (9%)
 Frame = +1

Query  46   MASDNKLKNNQVVSTMIKQGfisdpffs---sppptsHHLPAAKLaatavspppaytpas  216
            MA++N LK+ +V S MIKQGFISD   S   S   +  + P +  + T  SPPP     +
Sbjct  1    MAAENSLKSREV-SAMIKQGFISDRTLSFSPSRSISRLYSPLSPPSKTLSSPPPLSPSPA  59

Query  217  pppapptQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSG  396
               A   QTL+DMMS+EQ R  R S + R ++ ER++++L  APF+S S           
Sbjct  60   NSHAAHNQTLYDMMSEEQHRESRLSDDKRRKLHERVAKLLDKAPFRSGS-----------  108

Query  397  SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYV  570
            S  DV+LT+ ++DG+ +VSMDVH  VL+ +SRFFA+KLRR    +HSVEI DCDDVEVYV
Sbjct  109  SSSDVRLTVVSKDGF-RVSMDVHGSVLSSKSRFFADKLRRERGVAHSVEISDCDDVEVYV  167

Query  571  KTVVLMYCEDLKK  609
            +TVVLMY EDLKK
Sbjct  168  ETVVLMYSEDLKK  180



>emb|CDP08962.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 100/125 (80%), Gaps = 5/125 (4%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS EQ+R+ R S EA  ++Q+R+ +VLA APF++      N  D +   GDV+LT
Sbjct  86   TLFEMMSDEQARDSRHSTEAGLKLQDRVFKVLAEAPFKNSGNDRTN--DNNLGCGDVRLT  143

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVEVYVKTVVLMYC  594
            ++ARDG+ +VSM+VHRRVLA RSRFFAEKLRR+G+H  +VEIL+CDDVEVYV+ VVLMYC
Sbjct  144  VSARDGF-RVSMEVHRRVLADRSRFFAEKLRRNGAHMVTVEILECDDVEVYVEVVVLMYC  202

Query  595  EDLKK  609
            EDLKK
Sbjct  203  EDLKK  207



>ref|XP_010685873.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Beta 
vulgaris subsp. vulgaris]
Length=508

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEA-RHRVQERISRVLAHAP-FQSPSRADGNFIDGSGSGGDVK  414
            TLF+MM+ EQ R  +QS +  R ++Q++++RVL+  P F   +    N + G G G DVK
Sbjct  50   TLFEMMTDEQLRESKQSSDNNRRKLQDKLARVLSKNPNFGDSNNCSSNNLGGFGDG-DVK  108

Query  415  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG-SHSVEILDCDDVEVYVKTVVLMY  591
            LT++ RDG+ K+SMDVHRRVLA +SRFFAEKL   G +HSVEI DCDDVE+YV+T+VLMY
Sbjct  109  LTVSGRDGF-KISMDVHRRVLAEKSRFFAEKLSDGGITHSVEICDCDDVEIYVETLVLMY  167

Query  592  CEDLKK  609
              DLKK
Sbjct  168  THDLKK  173



>ref|XP_008222552.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Prunus 
mume]
Length=519

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 13/126 (10%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL++MMS EQ R+   S  A  +V E++ ++L +APF++P+        G    GDV+L
Sbjct  71   QTLYEMMSDEQHRD---SKLADRKVHEKVHKLLQNAPFRNPNW-------GGLVSGDVRL  120

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
            T+ A+DG+ +V+MDVH+ VLA +SRFFA+KLR  R  SH VEI DCDDVEVYV+TVVLMY
Sbjct  121  TVVAKDGF-RVTMDVHKSVLAAKSRFFADKLRKDRGVSHCVEISDCDDVEVYVETVVLMY  179

Query  592  CEDLKK  609
            CEDLK+
Sbjct  180  CEDLKR  185



>gb|EYU18898.1| hypothetical protein MIMGU_mgv1a005394mg [Erythranthe guttata]
Length=485

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 91/126 (72%), Gaps = 14/126 (11%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF MMS EQSR+ +   EA +++Q+RIS +L+ APF        N  D  G G DV+LT
Sbjct  37   TLFQMMSAEQSRDPKPGSEAHNKLQDRISSLLSRAPF--------NVTDRWGVG-DVRLT  87

Query  421  IAAR----DGWP-KVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVL  585
            +A+R    +G   +VSMDVHRRVLA  SRFFAEKLRRSG+HSVEIL+CDDV VYV+ VVL
Sbjct  88   VASRSDSGEGESLRVSMDVHRRVLAAGSRFFAEKLRRSGTHSVEILECDDVAVYVEAVVL  147

Query  586  MYCEDL  603
            MY ++L
Sbjct  148  MYSDEL  153



>ref|XP_009354521.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Pyrus 
x bretschneideri]
Length=523

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 12/126 (10%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL++MMS +Q+R+ +  P+   ++ E++ R+L +APF++P+        G    GDV+L
Sbjct  75   QTLYEMMSDDQNRDSKLLPD--RKIHEKVHRLLQNAPFRNPNW-------GGLVSGDVRL  125

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
            T+ A+DG+ +VSMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  126  TVVAKDGF-RVSMDVHKSVLAAKSRFFAEKLRKERGVSHCVEISDCDDVEVYVEAVVLMY  184

Query  592  CEDLKK  609
             +DLK+
Sbjct  185  SDDLKR  190



>ref|XP_004294641.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Fragaria 
vesca subsp. vesca]
Length=515

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 12/126 (10%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL++MMS E  R+ +    + H   +++ R+L  APF++P+   G         GDV+L
Sbjct  69   QTLYEMMSDEHHRDSKVPDRSLH---QKVHRLLETAPFRNPNWGGGLV------SGDVRL  119

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
            T+ A+DG+ +VSMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV++VVLMY
Sbjct  120  TVVAKDGF-RVSMDVHKSVLASKSRFFAEKLRKDRGVSHCVEISDCDDVEVYVESVVLMY  178

Query  592  CEDLKK  609
            C+DLKK
Sbjct  179  CDDLKK  184



>ref|XP_008349723.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Malus 
domestica]
Length=523

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 12/125 (10%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL++MMS +Q+R+ +  P+   ++ E++ R+L  APF++P+        G    GDV+L
Sbjct  75   QTLYEMMSDDQNRDSKLLPD--RKIHEKVHRLLQDAPFRNPNW-------GGLVSGDVRL  125

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
            T+ A+DG+ ++SMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  126  TVVAKDGF-RISMDVHKSVLAAKSRFFAEKLRKERGVSHCVEISDCDDVEVYVEAVVLMY  184

Query  592  CEDLK  606
             +DLK
Sbjct  185  SDDLK  189



>gb|KHG07032.1| hypothetical protein F383_02815 [Gossypium arboreum]
Length=504

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 87/127 (69%), Gaps = 12/127 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+E  R  +   E+R + Q R+++ L             NF +G     DVKLT
Sbjct  54   TLFEMMSEEALRGSKTIEESRKKTQRRVAKFLTELKAY-------NFKNGGLGLSDVKLT  106

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            + +RDG+ +V+MDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  107  VVSRDGY-RVAMDVHRRVLSEKSRFFAEKLSQRREKGVSHTVEISECDDVEVYVETVVLM  165

Query  589  YCEDLKK  609
            YC+DLKK
Sbjct  166  YCDDLKK  172



>ref|XP_011089383.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089384.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089385.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
Length=511

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 16/129 (12%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            +LF+MMS EQ+R  + S EA  +++ER+S VL+ APF + +              DV+LT
Sbjct  59   SLFEMMSVEQAREPKPSSEAHKKLRERVSSVLSQAPFHNSNH---------WGMCDVRLT  109

Query  421  IAAR-------DGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTV  579
            +AAR        G  +VSMDVHRRVLA +SRFF+EKLRR+G HSVEIL+CDDV  Y++ V
Sbjct  110  VAARPEAGERETGAFRVSMDVHRRVLASKSRFFSEKLRRTGPHSVEILECDDVVAYLEAV  169

Query  580  VLMYCEDLK  606
            VLMY ++LK
Sbjct  170  VLMYSDELK  178



>gb|KJB20225.1| hypothetical protein B456_003G139200 [Gossypium raimondii]
Length=513

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 87/127 (69%), Gaps = 12/127 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+E  R  +   E+R + Q R+++ L      S       F +G     DVKLT
Sbjct  63   TLFEMMSEEALRGSKTIEESRKKTQRRVAKFLTELKAYS-------FKNGGLGLSDVKLT  115

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            + +RDG+ +V+MDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  116  VVSRDGY-RVAMDVHRRVLSEKSRFFAEKLSQRREKGVSHTVEISECDDVEVYVETVVLM  174

Query  589  YCEDLKK  609
            YC+DLKK
Sbjct  175  YCDDLKK  181



>ref|XP_008358075.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Malus 
domestica]
Length=534

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 87/126 (69%), Gaps = 12/126 (10%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL +MMS  Q RN +  P+   +V E++ R+L +APF++P+        G    GDV+L
Sbjct  86   QTLHEMMSDGQHRNSKLLPD--RKVHEKVHRLLQNAPFRNPNW-------GGLVSGDVRL  136

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
             + A+DG+ +VSMDVH+ VL  +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  137  MVVAKDGF-RVSMDVHKSVLEAKSRFFAEKLRKDRGVSHCVEISDCDDVEVYVEAVVLMY  195

Query  592  CEDLKK  609
             +DLK+
Sbjct  196  YDDLKR  201



>ref|XP_010043649.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Eucalyptus grandis]
Length=520

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 94/129 (73%), Gaps = 12/129 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS-GSG-GDVK  414
            TLF+MMS+EQ R      E+ + ++ R+S++L++APF +   A+    DG  G G GDV+
Sbjct  66   TLFEMMSQEQHR-----LESSNALKSRLSKILSNAPFVNSIVANSVESDGDLGFGTGDVR  120

Query  415  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR--SGSHSV--EILDCDDVEVYVKTVV  582
            LT+ +RDG+  VSMDVH RVLA +SR+FAEKLRR    SHSV  EI +CDD+EVYV+TVV
Sbjct  121  LTVVSRDGF-SVSMDVHGRVLAEKSRYFAEKLRRDRGVSHSVDIEISECDDLEVYVETVV  179

Query  583  LMYCEDLKK  609
            LMY EDLKK
Sbjct  180  LMYSEDLKK  188



>gb|KJB08821.1| hypothetical protein B456_001G105900 [Gossypium raimondii]
Length=511

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 12/128 (9%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTLF+MMS+E  R+ +   E+R + Q RI++ L     +S +       D     GDV+L
Sbjct  60   QTLFEMMSEEHLRDSKAIEESRKKTQTRIAKFLDELKTRSSN-------DWGLRSGDVRL  112

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  585
            T+ +RDG  +VSMDVH+RVL+ +SRFFAEKL     +  SH+VEI +CDDVEVYV+TVVL
Sbjct  113  TVVSRDG-HRVSMDVHKRVLSEKSRFFAEKLSQRKEKGVSHTVEISECDDVEVYVETVVL  171

Query  586  MYCEDLKK  609
            MY +DLKK
Sbjct  172  MYSDDLKK  179



>gb|KCW85653.1| hypothetical protein EUGRSUZ_B02440 [Eucalyptus grandis]
Length=539

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 94/129 (73%), Gaps = 12/129 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS-GSG-GDVK  414
            TLF+MMS+EQ R      E+ + ++ R+S++L++APF +   A+    DG  G G GDV+
Sbjct  85   TLFEMMSQEQHR-----LESSNALKSRLSKILSNAPFVNSIVANSVESDGDLGFGTGDVR  139

Query  415  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR--SGSHSV--EILDCDDVEVYVKTVV  582
            LT+ +RDG+  VSMDVH RVLA +SR+FAEKLRR    SHSV  EI +CDD+EVYV+TVV
Sbjct  140  LTVVSRDGF-SVSMDVHGRVLAEKSRYFAEKLRRDRGVSHSVDIEISECDDLEVYVETVV  198

Query  583  LMYCEDLKK  609
            LMY EDLKK
Sbjct  199  LMYSEDLKK  207



>ref|XP_007016614.1| BTB/POZ domain-containing protein [Theobroma cacao]
 gb|EOY34233.1| BTB/POZ domain-containing protein [Theobroma cacao]
Length=512

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 89/127 (70%), Gaps = 13/127 (10%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+E  R+ +   E+R +   R+++ L      S +        G GSG DV+LT
Sbjct  63   TLFEMMSEEHLRDSKTIEESRRKTN-RVAKFLTELKICSFNSW------GLGSG-DVRLT  114

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            + +RDG+ +VSMDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  115  VVSRDGY-RVSMDVHRRVLSEKSRFFAEKLSQGREKGVSHTVEISECDDVEVYVETVVLM  173

Query  589  YCEDLKK  609
            YC+DLKK
Sbjct  174  YCDDLKK  180



>gb|KHG05277.1| hypothetical protein F383_30980 [Gossypium arboreum]
Length=510

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 89/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTLF MMS+E  R+ +   E+R + Q RI++ L     ++ S  D     G GSG DV+L
Sbjct  59   QTLFGMMSEEHLRDSKAIEESRKKTQTRIAKFLDE--LKTCSSNDW----GLGSG-DVRL  111

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  585
            T+ +RDG  +VSMDVH+RVL+ +SRFFAEKL     +  SH+VEI +CDDVEVYV+TVVL
Sbjct  112  TVVSRDG-HRVSMDVHKRVLSEKSRFFAEKLSQRKEKGVSHTVEISECDDVEVYVETVVL  170

Query  586  MYCEDLKK  609
            MY +DLKK
Sbjct  171  MYSDDLKK  178



>ref|XP_003540755.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=503

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 22/126 (17%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTLFDMMS+E     + S E R + Q+R+SR+L     +               GGDV+L
Sbjct  63   QTLFDMMSEEH----KFSDEKRRKTQDRVSRLLDEPALRG--------------GGDVRL  104

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEVYVKTVVLM  588
            T+ ARDG+ + SM+V + VLA +SRFFA+KLR +G   SHSVEI DCDD+EVYV+ +VLM
Sbjct  105  TVVARDGF-RASMEVRKTVLADKSRFFADKLRCAGGDLSHSVEISDCDDIEVYVEAIVLM  163

Query  589  YCEDLK  606
            +CEDLK
Sbjct  164  HCEDLK  169



>gb|KHN05697.1| BTB/POZ domain-containing protein [Glycine soja]
Length=487

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 22/126 (17%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTLFDMMS+E     + S E R + Q+R+SR+L     +               GGDV+L
Sbjct  47   QTLFDMMSEEH----KFSDEKRRKTQDRVSRLLDEPALRG--------------GGDVRL  88

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEVYVKTVVLM  588
            T+ ARDG+ + SM+V + VLA +SRFFA+KLR +G   SHSVEI DCDD+EVYV+ +VLM
Sbjct  89   TVVARDGF-RASMEVRKTVLADKSRFFADKLRCAGGDLSHSVEISDCDDIEVYVEAIVLM  147

Query  589  YCEDLK  606
            +CEDLK
Sbjct  148  HCEDLK  153



>ref|XP_010520319.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Tarenaya 
hassleriana]
Length=507

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 84/128 (66%), Gaps = 14/128 (11%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  417
            TLF+MMS+E +R  +   E+R +   R++++L               +   G G GDV+L
Sbjct  58   TLFEMMSEEHNRESKTLDESRKKSHARVAKILTDFK--------NGIVYAYGLGPGDVRL  109

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  585
            T+  RDG+ +V+MDVHRRVL+ +SRFF EK+     +  SH VEI +CDDVEVYV+TVVL
Sbjct  110  TVVGRDGY-RVTMDVHRRVLSEKSRFFMEKMSSRKEKGVSHMVEISECDDVEVYVETVVL  168

Query  586  MYCEDLKK  609
            MYC+DLKK
Sbjct  169  MYCDDLKK  176



>gb|EPS62176.1| hypothetical protein M569_12618 [Genlisea aurea]
Length=524

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 21/128 (16%)
 Frame = +1

Query  241  TLFDMMSKEQSR-NFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            TLF+MM+ EQ+R + +   + R  +Q+RIS  L+ APF++ +R             DVKL
Sbjct  65   TLFEMMAIEQARESAKPDSDGRKNLQDRISSALSRAPFRTAAR---------WGIADVKL  115

Query  418  TIAA----------RDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  567
            T+AA           +G+ +VS+DVHRRVLA RSRFFAE+LRRSG HSVEILDCDDV  Y
Sbjct  116  TLAAVGDDDDDDSPEEGF-RVSVDVHRRVLAARSRFFAERLRRSGPHSVEILDCDDVAAY  174

Query  568  VKTVVLMY  591
            ++ +VLMY
Sbjct  175  LEAIVLMY  182



>ref|XP_004505925.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Cicer 
arietinum]
Length=495

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 34/191 (18%)
 Frame = +1

Query  46   MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  225
            M  DN LK+ +V STMIK GFIS+P FSS  P+    P+                +S   
Sbjct  1    MGGDNSLKSKEV-STMIKHGFISNPTFSSFSPSRTFSPSPP--------------SSTTR  45

Query  226  apptQTLFDMMSKEQS-RNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  402
               T +LFDMMS + + R+ + S +   ++++RI+++L  APF               SG
Sbjct  46   PSQTHSLFDMMSDDHNNRDAKHSDDNLRKMKDRITKLLQEAPF---------------SG  90

Query  403  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKT  576
            GDVKLT+  ++G+ KVSM+V + VLA +SRFFAEKLR     SHSVEI DCDDV+VYV+ 
Sbjct  91   GDVKLTVVGKEGF-KVSMEVKKSVLADKSRFFAEKLRCENGMSHSVEISDCDDVDVYVEA  149

Query  577  VVLMYCEDLKK  609
            VVLM+C DLKK
Sbjct  150  VVLMHCVDLKK  160



>ref|XP_007205061.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
 gb|EMJ06260.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
Length=507

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 25/126 (20%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTL++MMS EQ R+   S  A  +V E++ ++L +APF++P+            GG    
Sbjct  71   QTLYEMMSDEQHRD---SKLADRKVHEKVHKLLQNAPFRNPNW-----------GG----  112

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  591
                 DG+ +V+MDVH+ VLA +SRFFA+KLR  R  SH VEI DCDDVEVYV+TVVLMY
Sbjct  113  ----LDGF-RVTMDVHKSVLAAKSRFFADKLRKDRGVSHCVEISDCDDVEVYVETVVLMY  167

Query  592  CEDLKK  609
            CEDLK+
Sbjct  168  CEDLKR  173



>ref|XP_006591005.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=494

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 106/194 (55%), Gaps = 41/194 (21%)
 Frame = +1

Query  46   MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  225
            M  D+ LK+ QV S MIKQG                +PA  L+ +          ++ P 
Sbjct  1    MGGDSALKSGQV-SAMIKQG---------------FIPAPNLSFSPSRTFSPPPSSTRPS  44

Query  226  app----tQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS  393
                   TQTLF+MMS+E     + S E R    +R+SR+L     +S S          
Sbjct  45   QTQSHPHTQTLFNMMSEEH----KFSDEKRRNTHDRVSRLLDEPALRSAS----------  90

Query  394  GSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEV  564
               GDV+LT+  RDG+ +VSM+V + VLA +SRFFA+KLR  G   SHSVEI DCDDVEV
Sbjct  91   ---GDVRLTVVGRDGF-RVSMEVRKTVLADKSRFFADKLRCCGGGLSHSVEISDCDDVEV  146

Query  565  YVKTVVLMYCEDLK  606
            YV+ VVLM+C+DLK
Sbjct  147  YVEAVVLMHCDDLK  160



>ref|XP_007132142.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
 gb|ESW04136.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
Length=494

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 21/125 (17%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            QTLFDMMS+E     + S E R + Q+R+S++L     +               GGDV+L
Sbjct  55   QTLFDMMSEEH----KFSDEKRRKAQDRLSKLLREPALRE--------------GGDVRL  96

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKTVVLMY  591
            T+  RDG  +VSM+V + VLA +SRFFAEKLR  G  SHSVEI DCDDVEVYV+ VVLM+
Sbjct  97   TVVGRDG-LRVSMEVRKSVLADKSRFFAEKLRCDGAVSHSVEISDCDDVEVYVEAVVLMH  155

Query  592  CEDLK  606
             EDLK
Sbjct  156  SEDLK  160



>ref|XP_002531830.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30550.1| protein binding protein, putative [Ricinus communis]
Length=526

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 83/127 (65%), Gaps = 19/127 (15%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  417
            TLF MMS+EQS  F Q+   R + Q +IS+++         +   NF +  G G GDV+L
Sbjct  83   TLFQMMSEEQS--FEQN---RQKTQSKISKIV---------KEFDNFNNYCGFGLGDVRL  128

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---RSGSHSVEILDCDDVEVYVKTVVLM  588
            T+  RDG  KVS DVH+RVL  +S FF EKLR   +   HSVEI +CDDVEVY++ +VLM
Sbjct  129  TVIGRDG-LKVSCDVHKRVLIEKSGFFREKLRDREKGIMHSVEISECDDVEVYLEALVLM  187

Query  589  YCEDLKK  609
            YC+DLKK
Sbjct  188  YCDDLKK  194



>gb|AES88747.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=451

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 81/126 (64%), Gaps = 24/126 (19%)
 Frame = +1

Query  244  LFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTI  423
            LFDM+S  Q+     S + R ++Q+R++++L  A F                GGDVKLT+
Sbjct  43   LFDMISSNQTP---LSDDNRRKMQDRVNKLLQEAHF---------------IGGDVKLTV  84

Query  424  AARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS-----HSVEILDCDDVEVYVKTVVLM  588
              ++G  +VSMDV + VLA +SRFFAEKLR SG+     HSVEI DCDDV+VYV+ +VLM
Sbjct  85   VGKEG-IRVSMDVKKSVLAEKSRFFAEKLRGSGNGNGMVHSVEISDCDDVDVYVEAIVLM  143

Query  589  YCEDLK  606
            +C DLK
Sbjct  144  HCVDLK  149



>emb|CDY09229.1| BnaA02g06550D [Brassica napus]
Length=497

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 27/131 (21%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAH----APFQSPSRADGNFIDGSGSGGD  408
            TLFDMMS+E  R   Q P  R +   R+++++A       + +PS              D
Sbjct  60   TLFDMMSEEHHRE--QPP--RRKSHARVAQIMAEFKNGVVYDAPS--------------D  101

Query  409  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKT  576
            VKLT+  RDG+ +V+MDVHR+VL+ +SRFF  K+   R  G SH VEI +CDDVE+YV+T
Sbjct  102  VKLTVVGRDGY-RVTMDVHRKVLSEKSRFFMAKMSSRREKGVSHMVEISECDDVEIYVET  160

Query  577  VVLMYCEDLKK  609
            VVLMYC+DLKK
Sbjct  161  VVLMYCDDLKK  171



>ref|XP_009126626.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Brassica 
rapa]
Length=495

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 27/131 (21%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAH----APFQSPSRADGNFIDGSGSGGD  408
            TLFDMMS+E  R   Q P  R +   R+++++A       + +PS              D
Sbjct  58   TLFDMMSEEHHRE--QPP--RRKSHARVAQIMAEFKNGVVYDAPS--------------D  99

Query  409  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKT  576
            VKLT+  RDG+ +V+MDVHR+VL+ +SRFF  K+   R  G SH VEI +CDDVE+YV+T
Sbjct  100  VKLTVVGRDGY-RVTMDVHRKVLSEKSRFFMAKMSSRREKGVSHMVEISECDDVEIYVET  158

Query  577  VVLMYCEDLKK  609
            VVLMYC+DLKK
Sbjct  159  VVLMYCDDLKK  169



>ref|XP_003606550.1| hypothetical protein MTR_4g061670 [Medicago truncatula]
Length=565

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 81/126 (64%), Gaps = 24/126 (19%)
 Frame = +1

Query  244  LFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTI  423
            LFDM+S  Q+     S + R ++Q+R++++L  A F                GGDVKLT+
Sbjct  43   LFDMISSNQTP---LSDDNRRKMQDRVNKLLQEAHF---------------IGGDVKLTV  84

Query  424  AARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS-----HSVEILDCDDVEVYVKTVVLM  588
              ++G  +VSMDV + VLA +SRFFAEKLR SG+     HSVEI DCDDV+VYV+ +VLM
Sbjct  85   VGKEG-IRVSMDVKKSVLAEKSRFFAEKLRGSGNGNGMVHSVEISDCDDVDVYVEAIVLM  143

Query  589  YCEDLK  606
            +C DLK
Sbjct  144  HCVDLK  149



>gb|KDO73042.1| hypothetical protein CISIN_1g010024mg [Citrus sinensis]
Length=520

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 11/129 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+EQ +    + +   + Q RI ++L+   F++P+  D +F   +   G+V+LT
Sbjct  65   TLFEMMSQEQLQETTTTNKP-IKSQSRIFKLLSE--FKNPNIRD-SFSYLALGPGNVRLT  120

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL------RRSGSHSVEILDCDDVEVYVKTVV  582
            +  +DG+ +V MDVH+ VLA +SRFFAEKL       R   H VEI +CDDVEVYV+TVV
Sbjct  121  VVGKDGF-RVCMDVHKNVLAEKSRFFAEKLAIRDKENREMLHVVEISECDDVEVYVETVV  179

Query  583  LMYCEDLKK  609
            LMYC+DLK+
Sbjct  180  LMYCDDLKR  188



>ref|XP_006424700.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
 ref|XP_006488215.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Citrus 
sinensis]
 gb|ESR37940.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
Length=520

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 11/129 (9%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLF+MMS+EQ +    + +   + Q RI ++L+   F++P+  D +F   +   G+V+LT
Sbjct  65   TLFEMMSQEQLQETTTTNKP-IKSQSRIFKLLSE--FKNPNIRD-SFSYLALGPGNVRLT  120

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL------RRSGSHSVEILDCDDVEVYVKTVV  582
            +  +DG+ +V MDVH+ VLA +SRFFAEKL       R   H VEI +CDDVEVYV+TVV
Sbjct  121  VVGKDGF-RVCMDVHKNVLAEKSRFFAEKLAIRDKENREMLHVVEISECDDVEVYVETVV  179

Query  583  LMYCEDLKK  609
            LMYC+DLK+
Sbjct  180  LMYCDDLKR  188



>gb|KDP44149.1| hypothetical protein JCGZ_05616 [Jatropha curcas]
Length=510

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 20/127 (16%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  417
            TLF MMS+EQ+       + R R Q +IS+++           + + ++  G G GDV+L
Sbjct  69   TLFQMMSEEQALE-----QNRQRSQSKISKLVK----------EFDNLNNCGLGLGDVRL  113

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---RSGSHSVEILDCDDVEVYVKTVVLM  588
            T+  +DG+ +VS DVH+RVL  +S FF EKLR   +   HSVEI +CDDVEVY++T+VLM
Sbjct  114  TVIGKDGY-RVSFDVHKRVLMEKSGFFREKLRDGEKGVMHSVEISECDDVEVYMETLVLM  172

Query  589  YCEDLKK  609
            YC+DLKK
Sbjct  173  YCDDLKK  179



>ref|NP_200813.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9LVG9.1|Y5600_ARATH RecName: Full=BTB/POZ domain-containing protein At5g60050 [Arabidopsis 
thaliana]
 dbj|BAA96934.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42168.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04024.1| unknown protein [Arabidopsis thaliana]
 gb|AED97271.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=499

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 17/127 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R        R +   R++++L           +G     S   GDVKLT
Sbjct  57   TLFDMMSDEHNREL-----PRRKSHARVAQILTEFK-------NGVVYGHSLGPGDVKLT  104

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  163

Query  589  YCEDLKK  609
            Y +DLKK
Sbjct  164  YSDDLKK  170



>ref|XP_002866364.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42623.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 17/127 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R        R +   R++++L           +G     S   GDVKLT
Sbjct  57   TLFDMMSDEHNREL-----PRRKSHARVAQILTEF-------KNGVVYGHSLGPGDVKLT  104

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+Y++TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYIETVVLM  163

Query  589  YCEDLKK  609
            Y +DLKK
Sbjct  164  YSDDLKK  170



>ref|XP_010483651.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Camelina 
sativa]
Length=500

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R   + P  R +   R++++L           +G     S    DVKLT
Sbjct  55   TLFDMMSDEHNR---EPPPPRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  104

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  163

Query  589  YCEDLK  606
            Y +DLK
Sbjct  164  YSDDLK  169



>ref|XP_006281633.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
 gb|EOA14531.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
Length=500

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 80/127 (63%), Gaps = 16/127 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R     P  R +   R++++L           +G     S    DVKLT
Sbjct  56   TLFDMMSDEHNRE----PPPRRKSHARVAQILTEFK-------NGVVYGHSLGPSDVKLT  104

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CD++E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDELEIYVETVVLM  163

Query  589  YCEDLKK  609
            Y +DLKK
Sbjct  164  YSDDLKK  170



>ref|XP_010455877.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=499

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 79/126 (63%), Gaps = 14/126 (11%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R     P  R +   R++++L           +G     S    DVKLT
Sbjct  55   TLFDMMSDEHNRE--PPPPQRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  105

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  106  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  164

Query  589  YCEDLK  606
            Y +DLK
Sbjct  165  YSDDLK  170



>ref|XP_010443796.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=498

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 80/126 (63%), Gaps = 15/126 (12%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS E +R    SP  R +   R++++L           +G     S    DVKLT
Sbjct  53   TLFDMMSDEHNRE--PSP-PRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  102

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  103  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  161

Query  589  YCEDLK  606
            Y +DLK
Sbjct  162  YSDDLK  167



>ref|XP_002299517.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
 gb|EEE84322.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
Length=656

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSR--------------NFRQSPEARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q R              +FR +  ++  VQ+R + +L        +R+
Sbjct  182  TLFEMMASEPEMQPRTITQMPINANNGNISFRNTQSSQMSVQDRQALILQRITDILGNRS  241

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DVKLT++++DG   VSMDVHR++L G SRFFA KL         R S 
Sbjct  242  PGNQFNDSNSS-DVKLTLSSKDG-ISVSMDVHRQILVGHSRFFAVKLSDKWSNKQQRMST  299

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  300  PYVVEIADCDDVEVYIETLRLMYCKDLRR  328



>ref|XP_006400887.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
 gb|ESQ42340.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
Length=500

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 82/127 (65%), Gaps = 17/127 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TLFDMMS+E +R   + P  R +   R++++L           +G     S    +VKL+
Sbjct  57   TLFDMMSEEHNR---EPP--RRKSHARVTQILTEFK-------NGVVYGHSLGPSNVKLS  104

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  588
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDDVE+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDVEIYVETVVLM  163

Query  589  YCEDLKK  609
            Y +DLKK
Sbjct  164  YSDDLKK  170



>ref|XP_009398931.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=584

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 84/146 (58%), Gaps = 25/146 (17%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPE-ARHRVQERISRVLAHAPFQSP-----------SRADGNFI  384
            TLFDMM+ EQ   +R+SPE   H   +++ R +A     SP           +   GN  
Sbjct  104  TLFDMMTNEQG-FYRRSPEHVVHPPMQQLGRAVADPEATSPQDRQLLLQDRVAEIIGNCS  162

Query  385  DGSG----SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------RSGSHS  531
             G+       GDV LT+++ DG   VS++VHR +L G SRFFA KLR       RS  + 
Sbjct  163  PGNQLNDPESGDVHLTLSSMDG-LTVSLNVHRHILVGHSRFFAAKLRDLWSKQQRSLPYI  221

Query  532  VEILDCDDVEVYVKTVVLMYCEDLKK  609
            VEI DCDDVE+YV+T+ LMYC+DL++
Sbjct  222  VEISDCDDVEIYVETLCLMYCKDLRR  247



>ref|XP_011015247.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Populus euphratica]
Length=621

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 85/149 (57%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  147  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  206

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  207  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  264

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  265  PYVVEIADCDDVEVYIETLRLMYCKDLRR  293



>ref|XP_011015245.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Populus euphratica]
Length=658

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 85/149 (57%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  184  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  243

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  244  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  301

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  302  PYVVEIADCDDVEVYIETLRLMYCKDLRR  330



>gb|AAR14275.1| predicted protein [Populus tremula x Populus alba]
Length=533

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 11/120 (9%)
 Frame = +1

Query  277  NFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSM  456
            +FR +  ++  VQ+R + +L        +R+ GN  + S S  DVKLT++++DG   VSM
Sbjct  88   SFRNTQSSQMSVQDRQALILQRITDILGNRSPGNQFNDSNSS-DVKLTLSSKDG-ISVSM  145

Query  457  DVHRRVLAGRSRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            DVHR++L G SRFFA KL         R S  + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  146  DVHRQILVGHSRFFAVKLSDKWSNKQQRMSTPYVVEIADCDDVEVYIETLRLMYCKDLRR  205



>ref|XP_006419001.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
 gb|ESQ37437.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
Length=464

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 79/124 (64%), Gaps = 16/124 (13%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQ-SPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  417
            +L DM+S EQ+   R+   E R +   R++++L                  S   GDVKL
Sbjct  51   SLLDMISDEQNCETRRVQEEPRRKYHARVAKILTD-------------FKNSVEPGDVKL  97

Query  418  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEVYVKTVVLMYC  594
            ++  R G+  V+MDVH++VL+ +S FF ++++ +S SH+VEI +CDDVEV+V+TVVLM+C
Sbjct  98   SLVGRSGYA-VTMDVHKKVLSEKSSFFMDRIKSQSESHTVEISECDDVEVFVETVVLMHC  156

Query  595  EDLK  606
            EDLK
Sbjct  157  EDLK  160



>ref|XP_011029330.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=648

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 83/149 (56%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q R   Q P                +  VQ+R + +L        +R+
Sbjct  174  TLFEMMASEPEMQPRTITQMPINAYNGNISCRNTQSNQMSVQDRQALILQRITDILGNRS  233

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DVKLT+ ++DG   VSMDVHR++L G SRFFA KL         R S 
Sbjct  234  PGNQFNDSNSS-DVKLTLTSKDG-ICVSMDVHRQILVGHSRFFALKLSDKWSNKQQRIST  291

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  292  PYVVEIADCDDVEVYIETLRLMYCKDLRR  320



>ref|XP_010255266.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nelumbo 
nucifera]
Length=667

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 88/149 (59%), Gaps = 36/149 (24%)
 Frame = +1

Query  241  TLFDMMSKEQS---RN------------FRQSPEARHR---VQERISRVLAHAPFQSPSR  366
            TLF+MM+ EQ    RN             R  P  + +   +Q+R++ +L        S 
Sbjct  201  TLFEMMANEQDCQLRNQIPLPNNLPVIPIRPPPSVQDKQLLLQQRVAEILG-------SC  253

Query  367  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  522
            + GN F D + S  DVKLT++++DG+  VSM+VHR++L   SRFFA KL       +RS 
Sbjct  254  SPGNQFNDPTSS--DVKLTMSSKDGF-SVSMNVHRQILVAHSRFFAAKLSDRWSKQQRSI  310

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             H +EI DCDDVEVY++T+ LMYC+DL+K
Sbjct  311  PHIIEISDCDDVEVYIETLRLMYCKDLRK  339



>ref|XP_002303602.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
 gb|EEE78581.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
Length=656

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSR--------------NFRQSPEARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q R              N R +  ++  VQ+R + +L        +R+
Sbjct  182  TLFEMMASEPEMQPRTITQIPIIGNNGNINVRNTQSSQMSVQDRQALILQRITNILGNRS  241

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  242  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  299

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  300  PYVVEIADCDDVEVYIETLRLMYCKDLRR  328



>gb|KDP25402.1| hypothetical protein JCGZ_20558 [Jatropha curcas]
Length=665

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 85/144 (59%), Gaps = 23/144 (16%)
 Frame = +1

Query  241  TLFDMMSKE---QSRN----------FRQSPEARHRVQERISRVLAHAPFQSPSRADGNF  381
            TLF+MM+ E   Q RN           R S  A+  VQ++ + ++        +R+ GN 
Sbjct  196  TLFEMMASEPEMQPRNQIPINNGNVPVRSSQNAQMSVQDKQTLIMHRIADILSNRSPGNQ  255

Query  382  IDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSVE  537
             + S S  DVKLT++++DG   VSM+VHR++L   SRFFA KL        R S  + VE
Sbjct  256  FNDS-STSDVKLTLSSKDG-ISVSMNVHRQILVAHSRFFAVKLSDRWAKNQRTSSPYVVE  313

Query  538  ILDCDDVEVYVKTVVLMYCEDLKK  609
            I DCDDVEVY++T+ LMYC+DL++
Sbjct  314  IADCDDVEVYIETLRLMYCKDLRR  337



>ref|XP_009628159.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
tomentosiformis]
Length=667

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (58%), Gaps = 24/145 (17%)
 Frame = +1

Query  241  TLFDMMSKEQS----RNFRQSPEARHRVQERISRVLAHAPFQS----------PSRADGN  378
            TLF+MM+ E           +P +   + +++S  L     Q+            R+ GN
Sbjct  197  TLFEMMANEPECIPRSTINNTPISNGGLNQKLSTSLMPQDKQALMQHRLLDLLACRSPGN  256

Query  379  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSV  534
              + SGS  DVKLT++++DG+  V+M+VHR++L   SRFFA KL        R SG + V
Sbjct  257  QFNDSGSS-DVKLTLSSKDGF-SVAMNVHRQILVAHSRFFAVKLSEKWVKQQRNSGPYIV  314

Query  535  EILDCDDVEVYVKTVVLMYCEDLKK  609
            EI DCDD+EVY++T+ LMYC+DL+K
Sbjct  315  EIADCDDIEVYIETLRLMYCKDLRK  339



>ref|XP_011022633.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=658

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 84/149 (56%), Gaps = 28/149 (19%)
 Frame = +1

Query  241  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  184  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  243

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  522
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R   
Sbjct  244  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMYA  301

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  302  PYVVEIADCDDVEVYIETLRLMYCKDLRR  330



>ref|XP_008807229.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=630

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 82/144 (57%), Gaps = 30/144 (21%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR------QSPEARH--------RVQERISRVLAHAPFQSPSRADGN  378
            TLFDMM+ E   + R      QSP  R          +QER++ +L        S + GN
Sbjct  155  TLFDMMANEHDYHARPALPPPQSPAGRAVPVQDRQLLLQERVAGILG-------SCSPGN  207

Query  379  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVE  537
              +   S  DV+LT+ +RDG   VS++VHR +L   SRFFA KL       +RS  H VE
Sbjct  208  QFNDPDSS-DVRLTLTSRDGL-SVSLNVHRHILVAHSRFFAAKLSDRWSRQQRSLPHLVE  265

Query  538  ILDCDDVEVYVKTVVLMYCEDLKK  609
            I DCDDVEVY++T+ LMYC+D+++
Sbjct  266  ISDCDDVEVYIETLRLMYCKDIRR  289



>emb|CDP12055.1| unnamed protein product [Coffea canephora]
Length=648

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 24/145 (17%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSP--EARHRVQERISRVLAHAPFQSPS------------RADGN  378
            TLF+MM+ E   + R +      H+V   +   L   P    +            R+ GN
Sbjct  178  TLFEMMASEPDCHPRTAAAGTTTHQVSNGVISTLNQKPLDRQALMLQRLNDLLSCRSPGN  237

Query  379  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSV  534
              + S S  DVKLT++++DG   VSM VHR++L   SRFFAEKL        R +G   V
Sbjct  238  QFNDSASA-DVKLTLSSKDG-LHVSMSVHRQILVANSRFFAEKLSEKWVRQQRNAGPCIV  295

Query  535  EILDCDDVEVYVKTVVLMYCEDLKK  609
            EI DCDD+EVY++T+ LMYC+DL+K
Sbjct  296  EIADCDDIEVYIETLKLMYCKDLRK  320



>ref|XP_009800799.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
sylvestris]
Length=645

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 17/108 (16%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            +Q+R+  +LA        R+ GN  + SGS  DVKLT++++DG+  V+M+VHR++L   S
Sbjct  219  MQQRLLDLLA-------CRSPGNQFNDSGSS-DVKLTLSSKDGF-SVAMNVHRQILVAHS  269

Query  490  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFFA KL        R SG   VEI DCDD+EVY++T+ LMYC+DL+K
Sbjct  270  RFFAVKLSEKWVKQQRNSGPFIVEIADCDDIEVYIETLRLMYCKDLRK  317



>ref|XP_011080923.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Sesamum 
indicum]
Length=532

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 86/155 (55%), Gaps = 41/155 (26%)
 Frame = +1

Query  241  TLFDMMSKE---------------------QSRNFRQSPEARHR---VQERISRVLAHAP  348
            TLF+MM+ E                     QS     +P  + +   VQ+R+  +LA   
Sbjct  59   TLFEMMANEPDCHPRATTLVPNGVVFAQNHQSTKLAANPAPQDKQALVQQRLMDLLA---  115

Query  349  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  510
                SR+ GN  + + SG DVKLT++++DG   VS+ VHR++L   SRFFA KL      
Sbjct  116  ----SRSPGNQFNDAISG-DVKLTLSSKDG-INVSISVHRQILVAHSRFFALKLNEKWVK  169

Query  511  --RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              R SG + VEI DCDD+EVY++T+ LMYC+DL++
Sbjct  170  QQRSSGPYIVEIADCDDIEVYIETLRLMYCKDLRR  204



>ref|XP_009389780.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 86/150 (57%), Gaps = 36/150 (24%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR-----QSP---------------EARHRVQERISRVLAHAPFQSP  360
            TLFDMM+ EQ  + R     Q P               + +  +QER++ ++      SP
Sbjct  161  TLFDMMANEQDYHPRPAVPPQLPLPGRAGAALAAASAQDRQLLLQERVAEIIGSC---SP  217

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  519
                GN ++ + SG DV+LT+ ++DG   VS++VHR +L   SRFFA KL       +RS
Sbjct  218  ----GNQLNDAESG-DVRLTLTSKDGL-TVSLNVHRNILVAHSRFFAAKLSDRWSKQQRS  271

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              H VEI DCDDVEVYV+T+ LMYC+DL++
Sbjct  272  LPHIVEISDCDDVEVYVETLRLMYCKDLRR  301



>ref|XP_008776124.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X2 [Phoenix dactylifera]
Length=507

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 24/133 (18%)
 Frame = +1

Query  241  TLFDMMSKEQ-----SRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  405
            TLF+M+S+E              + R R++E IS++L+               D S   G
Sbjct  56   TLFEMISQEDFSRRGPPPPPSDDQKRRRLEEMISKILSTE-------------DPSWVPG  102

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGS-HSVEILDCDDVEVYV  570
            DV+L++++ DG+ + SMDVHR+VLA RSRFFAEKL    R  GS   VEI +CDDVEVYV
Sbjct  103  DVELSVSSDDGF-RFSMDVHRQVLARRSRFFAEKLEGISRVPGSPVVVEICECDDVEVYV  161

Query  571  KTVVLMYCEDLKK  609
            + V +MYC DL++
Sbjct  162  QAVGMMYCRDLRR  174



>ref|XP_008776113.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X1 [Phoenix dactylifera]
Length=509

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 24/133 (18%)
 Frame = +1

Query  241  TLFDMMSKEQ-----SRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  405
            TLF+M+S+E              + R R++E IS++L+               D S   G
Sbjct  56   TLFEMISQEDFSRRGPPPPPSDDQKRRRLEEMISKILSTE-------------DPSWVPG  102

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGS-HSVEILDCDDVEVYV  570
            DV+L++++ DG+ + SMDVHR+VLA RSRFFAEKL    R  GS   VEI +CDDVEVYV
Sbjct  103  DVELSVSSDDGF-RFSMDVHRQVLARRSRFFAEKLEGISRVPGSPVVVEICECDDVEVYV  161

Query  571  KTVVLMYCEDLKK  609
            + V +MYC DL++
Sbjct  162  QAVGMMYCRDLRR  174



>ref|XP_004143891.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
 ref|XP_004166918.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
Length=523

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 84/150 (56%), Gaps = 37/150 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS---PE----ARHRVQ-----------ERISRVLAHAPFQSPSR  366
            TLF+MM+ E   + R S   P+    + H+ Q           +RIS +L        SR
Sbjct  56   TLFEMMASEPDIHPRTSQIPPQIASVSVHKNQVPVQDKQALMMQRISEILG-------SR  108

Query  367  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  519
            + GN F D S S  D+KLT+++RDG   VSM VHR++L   SRFFA KL        R  
Sbjct  109  SPGNQFNDASSS--DIKLTLSSRDG-ISVSMSVHRQILVAHSRFFALKLSERWAKQQRSP  165

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              + VEI DCDDVEVY++T+ LMYC DL+K
Sbjct  166  SPYIVEIADCDDVEVYIETLKLMYCRDLRK  195



>ref|XP_007040317.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 ref|XP_007040318.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY24818.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY24819.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=566

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 88/155 (57%), Gaps = 41/155 (26%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQ----------------------ERISRVLAHAPFQ  354
            TLF+MM+ E   + R   + + ++Q                      +RIS +L++    
Sbjct  184  TLFEMMASEPDIHPRNQSQNQAQIQVPISAPRQNQPPPVIDKQALTMQRISDLLSN----  239

Query  355  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------R  513
               R+ GN  +  GS  D+KLT++++DG   VSM+VHR++L   SRFFA KL       +
Sbjct  240  ---RSPGNQFNDPGSS-DIKLTLSSKDGI-NVSMNVHRQILVAHSRFFAVKLSDRWAKQQ  294

Query  514  RSGS---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            R+GS   + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  295  RNGSGGPYIVEIADCDDVEVYIETLRLMYCKDLRK  329



>ref|XP_008437316.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
 ref|XP_008437317.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
Length=678

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 83/150 (55%), Gaps = 37/150 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS---PEAR----HRVQ-----------ERISRVLAHAPFQSPSR  366
            TLF+MM+ E   + R S   P+      H+ Q           +RIS +L        SR
Sbjct  211  TLFEMMASEPDIHPRTSQIPPQVASVSVHKNQVPIQDKQALMMQRISEILG-------SR  263

Query  367  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  519
            + GN F D S S  D+KLT+++RDG   VSM VHR++L   SRFFA KL        R  
Sbjct  264  SPGNQFNDASSS--DIKLTLSSRDG-ISVSMSVHRQILVAHSRFFALKLSERWAKQQRSP  320

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              + VEI DCDDVEVY++T+ LMYC DL+K
Sbjct  321  SPYIVEIADCDDVEVYIETLKLMYCRDLRK  350



>gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Erythranthe guttata]
Length=649

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 72/114 (63%), Gaps = 17/114 (15%)
 Frame = +1

Query  292  PEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRR  471
            P+ +  +Q+R++ +LA       SR+ GN  + + S  DVKLT++++DG   +S+ VHR 
Sbjct  216  PDKQALMQQRLTDILA-------SRSPGNQFNEAASS-DVKLTLSSKDG-VSISISVHRE  266

Query  472  VLAGRSRFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            +L   SRFFA+          R  G H VEI DCDD+EVY++T+ LMYC+DL+K
Sbjct  267  ILVVHSRFFAQTFNEKWVKQQRNLGPHIVEIADCDDIEVYIETLRLMYCKDLRK  320



>ref|XP_008783441.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783443.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783444.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=640

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 82/149 (55%), Gaps = 35/149 (23%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR-------------------QSPEARHRVQERISRVLAHAPFQSPS  363
            TLFDMM+ EQ    R                   Q  + R  +QERI+ VL        S
Sbjct  160  TLFDMMTNEQDYQPRALPPPPPPPPPPAGRAAPVQVQDQRLLLQERIADVLG-------S  212

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  522
             + GN  +   S  DV+LT++++DG   VS++VHR +L   S+FFA KL       +RS 
Sbjct  213  CSPGNQFNDPDSS-DVRLTLSSKDG-LSVSLNVHRHILVAHSQFFAAKLSDRWSRQQRSL  270

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             H VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  271  PHLVEISDCDDVEVYIETLCLMYCKDLRR  299



>ref|XP_011005022.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Populus 
euphratica]
Length=503

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 73/129 (57%), Gaps = 29/129 (22%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVK  414
            QTLF MMS EQ+             Q +IS+++              F D +  G GDV+
Sbjct  67   QTLFQMMSDEQNH------------QSKISKIMKE------------FEDLNCYGRGDVR  102

Query  415  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS----HSVEILDCDDVEVYVKTVV  582
            LT+  +DG  ++SMDVH+RVL  +S FF + LR         SVEI DCDDVEVY++T+V
Sbjct  103  LTVIGKDGHTRISMDVHKRVLLEKSGFFRDTLRGRDQGVVMQSVEISDCDDVEVYLETLV  162

Query  583  LMYCEDLKK  609
            LMY  DLK+
Sbjct  163  LMYSHDLKR  171



>gb|KGN50074.1| hypothetical protein Csa_5G152890 [Cucumis sativus]
Length=676

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 84/150 (56%), Gaps = 37/150 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS---PE----ARHRVQ-----------ERISRVLAHAPFQSPSR  366
            TLF+MM+ E   + R S   P+    + H+ Q           +RIS +L        SR
Sbjct  209  TLFEMMASEPDIHPRTSQIPPQIASVSVHKNQVPVQDKQALMMQRISEILG-------SR  261

Query  367  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  519
            + GN F D S S  D+KLT+++RDG   VSM VHR++L   SRFFA KL        R  
Sbjct  262  SPGNQFNDASSS--DIKLTLSSRDG-ISVSMSVHRQILVAHSRFFALKLSERWAKQQRSP  318

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              + VEI DCDDVEVY++T+ LMYC DL+K
Sbjct  319  SPYIVEIADCDDVEVYIETLKLMYCRDLRK  348



>ref|XP_007040315.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040316.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040319.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24816.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24817.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24820.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=657

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 27/148 (18%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAP----------FQSPS-----RADG  375
            TLF+MM+ E   + R   + + ++Q  IS    + P           Q  S     R+ G
Sbjct  184  TLFEMMASEPDIHPRNQSQNQAQIQVPISAPRQNQPPPVIDKQALTMQRISDLLSNRSPG  243

Query  376  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGS---  525
            N  +  GS  D+KLT++++DG   VSM+VHR++L   SRFFA KL       +R+GS   
Sbjct  244  NQFNDPGSS-DIKLTLSSKDG-INVSMNVHRQILVAHSRFFAVKLSDRWAKQQRNGSGGP  301

Query  526  HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  302  YIVEIADCDDVEVYIETLRLMYCKDLRK  329



>gb|KJB37507.1| hypothetical protein B456_006G208800 [Gossypium raimondii]
Length=613

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 84/153 (55%), Gaps = 39/153 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQ----------------------ERISRVLAHAPFQ  354
            TLF+MM+ E   N R   + + ++Q                      +RIS +L+     
Sbjct  163  TLFEMMANEPDNNPRNRTQNQAQIQVPISSPRQNHPPPVIDKQALTMQRISDLLS-----  217

Query  355  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR------  516
              +R+ GN  +   S  D+KLT++++DG   V+M+VHR++L   SRFFA KL        
Sbjct  218  --TRSPGNQFNDPNSS-DMKLTLSSKDG-ISVTMNVHRQILVAHSRFFAVKLSDRSQETN  273

Query  517  --SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              +G +SVEI DCDDVEVY++ + LMYC+DL+K
Sbjct  274  GPTGPYSVEIADCDDVEVYIEVLRLMYCKDLRK  306



>ref|XP_010922477.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Elaeis 
guineensis]
Length=544

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 27/134 (20%)
 Frame = +1

Query  241  TLFDMMSKEQ-SRNFRQS-----PEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  402
            TLF+M+S+E  SR           + R R++ERIS+VL+               +G+  G
Sbjct  97   TLFEMISQEDLSRRVPPPPPSSSEQKRRRLEERISKVLS--------------TEGTRWG  142

Query  403  -GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----RSGS-HSVEILDCDDVEV  564
              DV+L++++ DG+ + SM VHRRVLA RSRFFAEKL       GS   VEI +CDDVEV
Sbjct  143  PADVELSVSSSDGF-RFSMAVHRRVLASRSRFFAEKLEGIVGTLGSPVVVEICECDDVEV  201

Query  565  YVKTVVLMYCEDLK  606
            YV+ V +MYC DL+
Sbjct  202  YVEAVAMMYCRDLR  215



>ref|XP_010069058.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW57276.1| hypothetical protein EUGRSUZ_H00077 [Eucalyptus grandis]
Length=529

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 85/149 (57%), Gaps = 36/149 (24%)
 Frame = +1

Query  241  TLFDMMSKE---QSRN-------------FRQSPEARHRV-QERISRVLAHAPFQSPSRA  369
            TL +MM+ E   QS N             F+ S E +  +  +R+S +LA       +R+
Sbjct  62   TLIEMMANEPDIQSSNHILPNPSVPVAPKFQISAEDKQVLAMQRLSDILA-------ARS  114

Query  370  DGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSG  522
             GN F D S S  D+KL + ++DG   VSM+VHR +L   SRFFA KL        R SG
Sbjct  115  PGNQFNDASSS--DIKLALTSKDG-ITVSMNVHRPILVAHSRFFAMKLSDRWIKQQRVSG  171

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  172  PYIVEIADCDDVEVYIETLRLMYCKDLRK  200



>gb|KEH21112.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=595

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 22/143 (15%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS-----------PEARHRVQERISRVLAHAPFQSPSRADGNFID  387
            TLF+MM  E     R +           P+ +   Q+R + ++        SR+ GN  +
Sbjct  127  TLFEMMVNEPDIQQRTNQIPINNATSSMPKPQIIAQDRETLMMNRISELLSSRSPGNHFN  186

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSGSHSVEI  540
             S S  D+KLT++++DG+  VSM+VHR++L   SRFF+ KL         R +  + VEI
Sbjct  187  DSSSS-DIKLTLSSKDGF-SVSMNVHRQILVAHSRFFSVKLSDRWTQSQQRSALPYLVEI  244

Query  541  LDCDDVEVYVKTVVLMYCEDLKK  609
             DCDDVEVYV+T+ LMYC+DL+K
Sbjct  245  ADCDDVEVYVETLRLMYCKDLRK  267



>ref|XP_010069057.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Eucalyptus grandis]
Length=545

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 85/149 (57%), Gaps = 36/149 (24%)
 Frame = +1

Query  241  TLFDMMSKE---QSRN-------------FRQSPEARHRV-QERISRVLAHAPFQSPSRA  369
            TL +MM+ E   QS N             F+ S E +  +  +R+S +LA       +R+
Sbjct  78   TLIEMMANEPDIQSSNHILPNPSVPVAPKFQISAEDKQVLAMQRLSDILA-------ARS  130

Query  370  DGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSG  522
             GN F D S S  D+KL + ++DG   VSM+VHR +L   SRFFA KL        R SG
Sbjct  131  PGNQFNDASSS--DIKLALTSKDG-ITVSMNVHRPILVAHSRFFAMKLSDRWIKQQRVSG  187

Query  523  SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  188  PYIVEIADCDDVEVYIETLRLMYCKDLRK  216



>ref|XP_002298385.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
 gb|EEE83190.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
Length=503

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 74/129 (57%), Gaps = 29/129 (22%)
 Frame = +1

Query  238  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVK  414
            QTLF +MS+EQ+             Q +IS+++              F D +  G GDV+
Sbjct  67   QTLFQIMSEEQNH------------QSKISKIMKE------------FEDLNCYGRGDVR  102

Query  415  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS----HSVEILDCDDVEVYVKTVV  582
            LT+  +DG  ++SMDVH+RVL  +S FF + LR         SVEI DCDDVEVY++T+V
Sbjct  103  LTVIGKDGHTRISMDVHKRVLLEKSGFFRDTLRGRDQGVVMQSVEISDCDDVEVYLETLV  162

Query  583  LMYCEDLKK  609
            LMY  DLK+
Sbjct  163  LMYSHDLKR  171



>ref|XP_002279382.2| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vitis 
vinifera]
Length=667

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (65%), Gaps = 20/110 (18%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            + +RIS +LA       SR+ GN F D S S  D+KLT++++DG   +SM VHR++L   
Sbjct  240  MMQRISEILA-------SRSPGNQFNDMSSS--DIKLTLSSKDG-VSISMSVHRQILVAH  289

Query  487  SRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA KL         R +  + VEI DCDDVE+Y++T+ LMYC+DL+K
Sbjct  290  SRFFAAKLSDRWTRQQQRSASPYIVEIADCDDVEIYIETLRLMYCKDLRK  339



>ref|XP_006829095.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
 gb|ERM96511.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
Length=613

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 82/141 (58%), Gaps = 27/141 (19%)
 Frame = +1

Query  241  TLFDMMSKEQ-SRNFRQSPEARHRV----------QERISRVLAHAPFQSPSRADGNFID  387
            TL +MM  EQ SR     P  +  V          QE+++ +L        S + GN  +
Sbjct  145  TLSEMMRTEQDSRPRYHIPVMKQPVSGQGDSHCLFQEQVAEILG-------SCSPGNLFN  197

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILD  546
              GS  DVKLT+++RDG+  V++++HR++L   SRFFA KL       +RS  H VEI D
Sbjct  198  DLGSS-DVKLTLSSRDGF-SVTLNLHRQILVANSRFFASKLSERWSKQQRSLPHLVEISD  255

Query  547  CDDVEVYVKTVVLMYCEDLKK  609
            CDDV VY++T+ LMYC+DLK+
Sbjct  256  CDDVGVYMETLRLMYCKDLKR  276



>emb|CBI34370.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (65%), Gaps = 20/110 (18%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            + +RIS +LA       SR+ GN F D S S  D+KLT++++DG   +SM VHR++L   
Sbjct  95   MMQRISEILA-------SRSPGNQFNDMSSS--DIKLTLSSKDG-VSISMSVHRQILVAH  144

Query  487  SRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA KL         R +  + VEI DCDDVE+Y++T+ LMYC+DL+K
Sbjct  145  SRFFAAKLSDRWTRQQQRSASPYIVEIADCDDVEIYIETLRLMYCKDLRK  194



>ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Solanum 
lycopersicum]
Length=638

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 17/108 (16%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            +Q+R+  +LA        R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   S
Sbjct  212  MQQRLLDLLA-------CRSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHS  262

Query  490  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFFA KL        R SG + VEI DCDD+EVY++T+ LMYC+DL+K
Sbjct  263  RFFAVKLSEKWVKQQRNSGPYIVEIADCDDIEVYIETLRLMYCKDLRK  310



>ref|XP_008783774.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Phoenix 
dactylifera]
Length=517

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 27/134 (20%)
 Frame = +1

Query  241  TLFDMMSKE------QSRNFRQSPEARHRVQERISRVLA-HAPFQSPSRADGNFIDGSGS  399
            TLF+M+S+E               + R R++E I+++L+   P   P+            
Sbjct  70   TLFEMISQEDLSRRGPPPPPSSGDQKRRRLEEMITKILSTEGPRWGPA------------  117

Query  400  GGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEV  564
              DV+L++++ DG+ + SM VHRRVLAGRSRFFAEKL   G        VEI +CDDVEV
Sbjct  118  --DVELSVSSGDGF-RFSMAVHRRVLAGRSRFFAEKLEGIGVALGSPVVVEICECDDVEV  174

Query  565  YVKTVVLMYCEDLK  606
            Y + V LMYC DL+
Sbjct  175  YAEAVGLMYCRDLR  188



>ref|XP_009400477.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=643

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 85/155 (55%), Gaps = 43/155 (28%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEA-------------------------RHRVQERISRVLAHA  345
            TLFDMM+ EQ  ++   P A                         +  +QER++ ++   
Sbjct  150  TLFDMMANEQ--DYHPLPAAHAGPLQMHLPGRAADAPTAASAQDRQLLLQERVADIIG--  205

Query  346  PFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-----  510
                 S + GN ++ + S GDV+LT+++ DG   VS++VHR +L   SRFFA KL     
Sbjct  206  -----SCSPGNQLNDAES-GDVRLTLSSNDGL-TVSLNVHRHILVAHSRFFAAKLSDRWS  258

Query  511  --RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              +RS  H VEI DCDDVE+YV+T+ LMYC+DL++
Sbjct  259  KQQRSLPHIVEISDCDDVEIYVETLRLMYCKDLRR  293



>ref|XP_011073126.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Sesamum indicum]
Length=615

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 17/108 (16%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            +Q+R+  +LA        R+ GN  +  GS  DVKLT++++DG   VS+ VHR++L   S
Sbjct  189  MQQRLMDLLAL-------RSPGNQFNDEGSS-DVKLTLSSKDGL-SVSISVHRQILVAHS  239

Query  490  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFFA KL        R SG + VEI DCDD+EVY++T+ LMYC+DL+K
Sbjct  240  RFFALKLNEKWVKQQRSSGLYIVEIADCDDIEVYIETLRLMYCKDLRK  287



>gb|KHG15549.1| hypothetical protein F383_06896 [Gossypium arboreum]
Length=613

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 39/153 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQ----------------------ERISRVLAHAPFQ  354
            TLF+MM+ E   N R   + + ++Q                      +RIS +L+     
Sbjct  163  TLFEMMANEPDNNPRNQTQDQAQIQVPISGPRQNQPPPVIDKQALTMQRISDLLS-----  217

Query  355  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR------  516
              +R+ GN  +   S  D+KLT++++DG   V M+VHR++L   SRFFA KL        
Sbjct  218  --TRSPGNQFNDPNSS-DMKLTLSSKDG-ISVLMNVHRQILVAHSRFFAVKLSDRSQETN  273

Query  517  --SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              +G +SVEI DCDDVEVY++ + LMYC+DL+K
Sbjct  274  GPTGPYSVEIADCDDVEVYIEVLRLMYCKDLRK  306



>ref|XP_010058250.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Eucalyptus grandis]
Length=523

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = +1

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  513
            SR+ G+    S S  D+KL ++++DG   VSM+VHR +LA  S+FFAEKL         R
Sbjct  105  SRSPGSLFXDSASS-DMKLILSSKDGAISVSMNVHREILAAHSQFFAEKLSDQWMRQQQR  163

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             + +  VEI DCDDVEVYV+T+ LMYCEDL++
Sbjct  164  TAAAPIVEIADCDDVEVYVETLRLMYCEDLRR  195



>ref|XP_010089067.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=437

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 27/115 (23%)
 Frame = +1

Query  316  ERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSR  492
            +RIS +L+       SR+ GN F D S S  D+KLT+++RDG   VSM+VHR++L   SR
Sbjct  4    QRISEILS-------SRSPGNQFNDSSSS--DIKLTLSSRDG-ISVSMNVHRQILVAHSR  53

Query  493  FFAEKLR------------RSGS----HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            FFA KL              +GS    H VEI DC+DVEVY++T+ LMYC+DLKK
Sbjct  54   FFAVKLSDRWAKQQRWAAGNTGSSASPHIVEIADCEDVEVYIETLRLMYCKDLKK  108



>ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Solanum tuberosum]
Length=642

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 36/150 (24%)
 Frame = +1

Query  241  TLFDMMSKEQ---SRNFRQSP----------------EARHRVQERISRVLAHAPFQSPS  363
            TLF+MM+ E    +R+   +P                + +  +Q+R+  +LA        
Sbjct  174  TLFEMMANEPECITRSTINTPISNGCSNQKPASFVPLDKQALMQQRLLDLLA-------C  226

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  519
            R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   SRFFA KL        R S
Sbjct  227  RSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHSRFFAVKLSEKWVKQQRNS  284

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            G + VEI DCDD+EVY++T+ LMYC+DL++
Sbjct  285  GPYIVEIADCDDIEVYIETLRLMYCKDLRR  314



>ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cicer 
arietinum]
Length=609

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 20/107 (19%)
 Frame = +1

Query  319  RISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRF  495
            RIS +LA       SR+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   SRF
Sbjct  185  RISELLA-------SRSPGNHFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAHSRF  234

Query  496  FAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            F+ KL         R +  + VEI DCDDVE+YV+T+ LMYC+DL+K
Sbjct  235  FSVKLSDRWTQQQQRTALPYLVEIADCDDVEIYVETLRLMYCKDLRK  281



>ref|XP_010933990.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=639

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 77/139 (55%), Gaps = 20/139 (14%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG-----  405
            TLFDMM+ E   + R           R + VL          AD   I GS S G     
Sbjct  164  TLFDMMTNEHDYHPRPPLPQHPPPAGRAAPVLDRQLLLQERVAD---ILGSCSPGSQFND  220

Query  406  ----DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILDCD  552
                DV+LT++++DG+  VS++VHR +L   SRFFA KL       +RS  H VEI DCD
Sbjct  221  PDSSDVRLTLSSKDGF-SVSLNVHRHILVTHSRFFAAKLSDRWSRQQRSLPHLVEISDCD  279

Query  553  DVEVYVKTVVLMYCEDLKK  609
            DVEVY++T+ LMYC+D+++
Sbjct  280  DVEVYIETLRLMYCKDIRR  298



>ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
 ref|XP_006584729.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Glycine max]
Length=538

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 82/150 (55%), Gaps = 36/150 (24%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR--------QSPEARHRVQ---------ERISRVLAHAPFQSPSRA  369
            TLF+MM+ E   + R         +  A H+ Q         +RIS +L        SR+
Sbjct  70   TLFEMMASEPDVHHRPTTHIPNPTTTNANHKPQILDRQALMMQRISELLG-------SRS  122

Query  370  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----------RRS  519
             GN  +   S  D+KLT++++DG   VSM+VHR++L   SRFF+ KL          R  
Sbjct  123  PGNQFNDPLSS-DIKLTLSSKDG-ISVSMNVHRQILVAHSRFFSVKLSDRWTNLQQQRSP  180

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  181  VPYEVEIADCDDVEVYIETLRLMYCKDLRK  210



>ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
 gb|ESW32089.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
Length=610

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 21/111 (19%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            + +RIS +L        SR+ GN F DG  S  D+KLT++++DG   VSM+VHR++L   
Sbjct  181  MMQRISDLLG-------SRSPGNQFNDGVSS--DIKLTLSSKDG-ISVSMNVHRQILVAH  230

Query  487  SRFFAEKL----------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFF+ KL          R    + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  231  SRFFSVKLSDRWTKQQQQRSPVPYEVEIADCDDVEVYIETLRLMYCKDLRK  281



>gb|AIB05883.1| TRAF transcription factor, partial [Zea mays]
Length=606

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 38/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  360
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  120  TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  172

Query  361  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RR  516
            S + GN F D   S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R
Sbjct  173  SCSPGNQFNDADSS--DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQR  229

Query  517  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            +  H VEI DCDDVEVY +T+ LMYC+DL++
Sbjct  230  TLPHIVEISDCDDVEVYAETLRLMYCKDLRR  260



>ref|NP_001169621.1| uncharacterized protein LOC100383502 [Zea mays]
 gb|ACN34307.1| unknown [Zea mays]
Length=546

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 38/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  360
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  60   TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  112

Query  361  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RR  516
            S + GN F D   S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R
Sbjct  113  SCSPGNQFNDADSS--DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQR  169

Query  517  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            +  H VEI DCDDVEVY +T+ LMYC+DL++
Sbjct  170  TLPHIVEISDCDDVEVYAETLRLMYCKDLRR  200



>gb|AFW59116.1| hypothetical protein ZEAMMB73_743291 [Zea mays]
Length=606

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 38/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  360
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  120  TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  172

Query  361  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RR  516
            S + GN F D   S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R
Sbjct  173  SCSPGNQFNDADSS--DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQR  229

Query  517  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            +  H VEI DCDDVEVY +T+ LMYC+DL++
Sbjct  230  TLPHIVEISDCDDVEVYAETLRLMYCKDLRR  260



>ref|XP_008238939.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Prunus 
mume]
Length=643

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +1

Query  361  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--------  513
            SR+ GN F D S S  D+KLT++A+DG+  VSM+VHR++L   SRFFA KL         
Sbjct  224  SRSPGNQFNDPSSS--DIKLTLSAKDGF-SVSMNVHRQILVAHSRFFAVKLSDRWVKQQR  280

Query  514  ---RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
                S  ++VEI DCDDVEVY++ + LMYC+DL+K
Sbjct  281  TTSSSSPYNVEIADCDDVEVYIEALRLMYCKDLRK  315



>ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
 gb|EMJ11515.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
Length=700

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +1

Query  361  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--------  513
            SR+ GN F D S S  D+KLT++A+DG+  VSM+VHR++L   SRFFA KL         
Sbjct  281  SRSPGNQFNDPSSS--DIKLTLSAKDGF-SVSMNVHRQILVAHSRFFAVKLSDRWVKQQR  337

Query  514  ---RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
                S  ++VEI DCDDVEVY++ + LMYC+DL+K
Sbjct  338  TTSSSSPYNVEIADCDDVEVYIEALRLMYCKDLRK  372



>ref|XP_001751363.1| predicted protein [Physcomitrella patens]
 gb|EDQ83680.1| predicted protein, partial [Physcomitrella patens]
Length=440

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 28/138 (20%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRV--------QERISRVLAHAPFQSPSRADGNFIDGSG  396
            TLF+MM+ EQ       P+A H +        QE++  +L+     SP    GN  + + 
Sbjct  10   TLFEMMTHEQELG----PKAVHTISLSQQLTFQEKMKSILSGT---SP----GNQFNATN  58

Query  397  SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILDCDD  555
            +  D+KL +  R+G+  V+++VHR +L   SRFFA KL       +R+ S+ +EI D DD
Sbjct  59   TS-DLKLILNNREGYS-VTVNVHRHILVTHSRFFAAKLSDRWSKQQRTNSNLIEITDIDD  116

Query  556  VEVYVKTVVLMYCEDLKK  609
            VE+Y++T+ LMYCED+KK
Sbjct  117  VEIYLETLRLMYCEDVKK  134



>gb|KJB52168.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52169.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52170.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
Length=643

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 39/153 (25%)
 Frame = +1

Query  241  TLFDMMSKE-------QSRNFRQSPEARHR-------------VQERISRVLAHAPFQSP  360
            TLF+MM+ E       Q++   Q+P +  R               +RIS +L+       
Sbjct  172  TLFEMMASEPDIHQRTQNQAQIQAPISAPRQNQPPPVMDKQVLTMQRISDLLS-------  224

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  519
            +R+ GN  +  G   D+KLT++++DG   VSM+VHR++L   SRFFA +L       +R+
Sbjct  225  TRSPGNQFNDPGLS-DIKLTLSSKDG-ISVSMNVHRQILVAHSRFFAVRLSDRWTKQQRN  282

Query  520  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            GS   + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  283  GSTGPYIVEISDCDDVEVYIETLRLMYCKDLRK  315



>gb|KHG02986.1| hypothetical protein F383_23864 [Gossypium arboreum]
Length=646

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 88/153 (58%), Gaps = 39/153 (25%)
 Frame = +1

Query  241  TLFDMMSKE-------QSRNFRQSPEARHR-------------VQERISRVLAHAPFQSP  360
            TLF+MM+ E       Q++   Q+P +  R               +RIS +L+       
Sbjct  175  TLFEMMASEPDIHQRTQNQAQIQAPISAPRQNQPPPVMDKQVLTMQRISDLLS-------  227

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  519
            +R+ GN  +  G   D+KLT++++DG   VSM+VHR++L   SRFFA +L       +R+
Sbjct  228  TRSPGNQFNDPGLS-DIKLTLSSKDG-ISVSMNVHRQILMAHSRFFAVRLSDRWTKQQRN  285

Query  520  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            GS   + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  286  GSTGPYIVEISDCDDVEVYIETLRLMYCKDLRK  318



>ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum 
tuberosum]
Length=644

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 85/150 (57%), Gaps = 36/150 (24%)
 Frame = +1

Query  241  TLFDMMSKEQ---SRNFRQSP----------------EARHRVQERISRVLAHAPFQSPS  363
            TLF+MM+ E    +R+   +P                + +  +Q+R+  +LA        
Sbjct  176  TLFEMMANEPECITRSTINTPISNGCSNQKPASFVPLDKQALMQQRLLDLLA-------C  228

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  519
            R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   SRFFA KL        R S
Sbjct  229  RSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHSRFFAVKLSEKWVKQQRNS  286

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              + VEI DCDD+EVY++T+ LMYC+DL++
Sbjct  287  SPYIVEIADCDDIEVYIETLRLMYCKDLRR  316



>ref|NP_001053645.1| Os04g0579700 [Oryza sativa Japonica Group]
 emb|CAE03270.1| OSJNBa0011J08.25 [Oryza sativa Japonica Group]
 emb|CAD41158.2| OSJNBa0064M23.3 [Oryza sativa Japonica Group]
 dbj|BAF15559.1| Os04g0579700 [Oryza sativa Japonica Group]
 gb|EAY95268.1| hypothetical protein OsI_17091 [Oryza sativa Indica Group]
 gb|EAZ31736.1| hypothetical protein OsJ_15888 [Oryza sativa Japonica Group]
Length=533

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (55%), Gaps = 37/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS---------PEARH------------RVQERISRVLAHAPFQS  357
            TLFDMM+ EQ  + R +         P+  H             +Q+R++ ++       
Sbjct  45   TLFDMMANEQDYHPRTAAAIHSIPAPPQQAHPLQPARSMDRQVLLQDRVAELIG------  98

Query  358  PSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RR  516
             S + GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL       +R
Sbjct  99   -SCSPGNQFNDADSS-DVRLTLTSKDG-LSVTLCVHRHILVAHSRFFAAKLSDRWSKQQR  155

Query  517  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            +  H VEI DCDDVEVYV+T+ LMYC+DL++
Sbjct  156  TLPHIVEISDCDDVEVYVETLRLMYCKDLRR  186



>gb|KHG01374.1| hypothetical protein F383_23678 [Gossypium arboreum]
Length=640

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 86/151 (57%), Gaps = 37/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFR-----QSPEARHR-------------VQERISRVLAHAPFQSPSR  366
            TLF+MM+ E   + R     Q P +  R               +RIS +L+       +R
Sbjct  170  TLFEMMASEPDVHPRTQTQIQVPISGPRQNQPPPVIDKQALTMQRISNLLS-------TR  222

Query  367  ADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGS  525
            + GN  +   S  D+KLT++++DG   VSM+VHR+++   SRFFA KL       +R+GS
Sbjct  223  SPGNQFNDPDSS-DIKLTLSSKDG-ISVSMNVHRQIVVAHSRFFAVKLSDRWAKQQRNGS  280

Query  526  ---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
               + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  281  AGPYIVEIADCDDVEVYIETLKLMYCKDLRK  311



>ref|XP_006476518.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
Length=656

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 11/92 (12%)
 Frame = +1

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  513
            +R+ GN  + S S  D+KLT++++DG   VS++VHR++L   SRFFA KL         +
Sbjct  239  TRSPGNQFNESTSS-DIKLTLSSKDG-ISVSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  296

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             +  + VEI DCDDVEVY++T+ LMYC+DLKK
Sbjct  297  TTHPYIVEIADCDDVEVYIETLRLMYCKDLKK  328



>ref|XP_006652685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Oryza 
brachyantha]
Length=532

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 82/150 (55%), Gaps = 36/150 (24%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS--------PEARH------------RVQERISRVLAHAPFQSP  360
            TLFDMM+ EQ  + R +        P   H             +Q+R++ ++        
Sbjct  50   TLFDMMANEQDYHPRTAAAIHSIPAPPQPHPLQPARSMDRQVLLQDRVAELIG-------  102

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  519
            S + GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL       +R+
Sbjct  103  SCSPGNQFNDADSS-DVRLTLTSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQRT  160

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              H VEI DCDDVEVYV+T+ LMYC+DL++
Sbjct  161  LPHIVEISDCDDVEVYVETLRLMYCKDLRR  190



>emb|CDY38217.1| BnaA09g11720D [Brassica napus]
Length=533

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 80/156 (51%), Gaps = 42/156 (27%)
 Frame = +1

Query  241  TLFDMMSKE-----QSRNFRQSPEARHRV-----------------QERISRVLAHAPFQ  354
            TLF+MMS E     Q +N      +R R                   +RIS +L      
Sbjct  62   TLFEMMSSEAGSPVQIQNLALPSSSRTRTTNGSHLVISAQDKQALAMQRISNLLM-----  116

Query  355  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------  513
              +R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL        
Sbjct  117  --TRSPGNQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQ  172

Query  514  ----RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
                 S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  173  QMAPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  208



>gb|KJB20610.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
 gb|KJB20611.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
Length=638

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 84/153 (55%), Gaps = 41/153 (27%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQS--------------------P  360
            TLF+MM+ E        P+   R Q +I +V    P Q+                     
Sbjct  168  TLFEMMASE--------PDVHPRTQTQI-QVPISGPGQNQPPPVIDKQVLTMQRISNLLS  218

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  519
            +R+ GN  +   S  D+KLT++++DG   VSM+VHR+++   SRFFA KL       +R+
Sbjct  219  TRSPGNQFNDPDSS-DIKLTLSSKDG-ISVSMNVHRQIVVAHSRFFAVKLSDRWAKQQRN  276

Query  520  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            GS   + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  277  GSAGPYIVEIADCDDVEVYIETLKLMYCKDLRK  309



>ref|XP_009112778.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brassica 
rapa]
Length=534

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 80/156 (51%), Gaps = 42/156 (27%)
 Frame = +1

Query  241  TLFDMMSKE-----QSRNFRQSPEARHRV-----------------QERISRVLAHAPFQ  354
            TLF+MMS E     Q +N      +R R                   +RIS +L      
Sbjct  63   TLFEMMSSEAGSPVQIQNLALPSSSRTRTTNGSHLVISAQDKQALAMQRISNLLM-----  117

Query  355  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------  513
              +R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL        
Sbjct  118  --TRSPGNQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQ  173

Query  514  ----RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
                 S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  174  QMAPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  209



>ref|XP_010233737.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brachypodium 
distachyon]
Length=550

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 81/154 (53%), Gaps = 41/154 (27%)
 Frame = +1

Query  241  TLFDMMSKEQ--------SRNFRQSPEARHR---------------VQERISRVLAH-AP  348
            TLFDMM+ EQ        S     +P   H                +Q+R++ + A  +P
Sbjct  61   TLFDMMANEQDYHPRTHPSTTLPSAPPQHHHHLAPARSSSMDRQLLLQDRLADLAASCSP  120

Query  349  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  510
                +RAD +         DV+LT+A++DG   +++ +HR +L   SRFFA KL      
Sbjct  121  GSQFNRADSS---------DVRLTLASKDGL-SLTLSLHRHILVAHSRFFAAKLSDRWSR  170

Query  511  -RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             +R+  H VEI DCDDVEVYV+T+ LMYC DL++
Sbjct  171  QQRTLPHVVEISDCDDVEVYVETLRLMYCNDLRR  204



>ref|XP_010555851.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Tarenaya 
hassleriana]
Length=539

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 21/109 (19%)
 Frame = +1

Query  316  ERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSR  492
            ++IS +LA       SR+ GN F D + S  DVKLT++++DG   ++M VHR++L   SR
Sbjct  108  QKISDLLA-------SRSPGNQFNDPTSS--DVKLTLSSKDG-ISITMSVHRQILVAHSR  157

Query  493  FFAEKLR----------RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            FFA KL            S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  158  FFAMKLSDRWSKQQRPPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  206



>gb|KCW72192.1| hypothetical protein EUGRSUZ_E00642 [Eucalyptus grandis]
Length=404

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 9/76 (12%)
 Frame = +1

Query  409  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSGSHSVEILDCDDVE  561
            +KL ++++DG   VSM+VHR +LA  S+FFAEKL         R + +  VEI DCDDVE
Sbjct  1    MKLILSSKDGAISVSMNVHREILAAHSQFFAEKLSDQWMRQQQRTAAAPIVEIADCDDVE  60

Query  562  VYVKTVVLMYCEDLKK  609
            VYV+T+ LMYCEDL++
Sbjct  61   VYVETLRLMYCEDLRR  76



>emb|CDY08328.1| BnaC09g12680D [Brassica napus]
Length=532

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 79/148 (53%), Gaps = 27/148 (18%)
 Frame = +1

Query  241  TLFDMMSKE-----QSRNFRQSPEARHRVQERISRVLAHAPFQS----------PSRADG  375
            TLF+MMS E     Q +N      +R     R   V++    Q+           +R+ G
Sbjct  62   TLFEMMSSEAGSPVQIQNLALPSSSRTTNANRSHLVISAQDKQALAMQRISNLLMTRSPG  121

Query  376  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------RSGS  525
            N  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL            S  
Sbjct  122  NQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQMAPSSSP  179

Query  526  HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  180  YIVEISDCDDVEVYIETLMLMYCRDLRK  207



>ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
Length=564

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 80/151 (53%), Gaps = 37/151 (25%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSP----------------EARHRVQERISRVLAHAPFQSPSRAD  372
            TLF++M+ E     R +P                +    + +RIS +L        SR+ 
Sbjct  95   TLFEIMASEPDVPHRPTPLIPPTPNPYPNKPLILDPHALLMQRISELLV-------SRSP  147

Query  373  GNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------------RR  516
            GN  + + S  D+KLT+ ++DG   VSM++HR++L   SRFF+ KL            R 
Sbjct  148  GNQFNDAVSS-DIKLTLTSKDG-TCVSMNLHRQILVAHSRFFSVKLSDRWTKHQQELQRS  205

Query  517  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
               + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  206  PVPYEVEIADCDDVEVYIETLRLMYCKDLRK  236



>dbj|BAJ96039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 77/146 (53%), Gaps = 26/146 (18%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSR---------------ADG  375
            TLFDMM+ EQ    R +  A              AP +S  R               + G
Sbjct  64   TLFDMMANEQDYQPRSAAAAHSAPPHPHQHHNPLAPARSMDRQALLQDRVAELIGSCSPG  123

Query  376  N-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHS  531
            N F D   S  DV+LT++++DG   +++ VHR +L   SRFFA KL       +R+  H 
Sbjct  124  NQFNDADSS--DVRLTLSSKDGL-SLTLCVHRHILVAHSRFFAAKLSDRWSKQQRTLPHI  180

Query  532  VEILDCDDVEVYVKTVVLMYCEDLKK  609
            VEI DCDDVEVYV+T+ LMYC+DL++
Sbjct  181  VEISDCDDVEVYVETLRLMYCKDLRR  206



>ref|XP_004976580.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Setaria 
italica]
Length=549

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 80/154 (52%), Gaps = 40/154 (26%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRV------------------------QERISRVLAHAP  348
            TLFDMM+ EQ  + R +    H +                        Q+RI+ ++    
Sbjct  58   TLFDMMANEQDYHPRTAAAGVHSIPAPPPQHPHHQLQPARSMDRQVMLQDRIADLIGSC-  116

Query  349  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  510
              SP    GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL      
Sbjct  117  --SP----GNQFNDADSS-DVRLTLTSKDG-LSVTLCVHRHILVAHSRFFAAKLSDRWSK  168

Query  511  -RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             +R+  H VEI DCDD+EVY +T+ LMYC+DL++
Sbjct  169  QQRTLPHIVEISDCDDIEVYAETLRLMYCKDLRR  202



>ref|XP_010919095.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=637

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 76/144 (53%), Gaps = 30/144 (21%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHR--------------VQERISRVLAHAPFQSPSRADGN  378
            TLFDMM+ EQ    R S                    + ERI+ +L        S + GN
Sbjct  162  TLFDMMANEQEYQPRASLPPPPPPPPADRAAPFQELMLHERIAEILG-------SCSPGN  214

Query  379  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVE  537
              +   S  DV+LT++++DG   VS++VH  +L   SRFFA KL       + S  H VE
Sbjct  215  QFNDPDSS-DVRLTLSSKDG-LSVSLNVHHHILVAHSRFFAAKLSDRWSRQQHSLPHIVE  272

Query  538  ILDCDDVEVYVKTVVLMYCEDLKK  609
            I DCDDVEVY++T+ LMYC DL++
Sbjct  273  ISDCDDVEVYIETLRLMYCNDLRR  296



>gb|KFK38021.1| hypothetical protein AALP_AA3G059800 [Arabis alpina]
Length=537

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 11/91 (12%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS------  525
            R+ GN  + S S  DVKLT++++DG   ++M VHR++L   SRFFA KL    S      
Sbjct  119  RSPGNQFNDSNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQSSSS  176

Query  526  ---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
               + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  177  SSPYIVEISDCDDVEVYIETLMLMYCRDLRK  207



>ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria 
vesca subsp. vesca]
Length=616

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 80/145 (55%), Gaps = 25/145 (17%)
 Frame = +1

Query  241  TLFDMMSKEQS----------RNFRQSPEARHRVQERISRVLAHAPFQSPSRADGN-FID  387
            TLF+MMS E            +N   +P     VQ++ + ++        SR+ G+ F D
Sbjct  148  TLFEMMSSEPEMANPKPAQIHQNGVVAPPRTGLVQDKQALMMQRVSDLLGSRSPGSQFND  207

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR-----------SGSHSV  534
             + S  D+KLT+ A+DG+  VSM +HR +L   SRFFA KL             S  ++V
Sbjct  208  PTNS--DIKLTLGAKDGF-SVSMSLHRPILIAHSRFFAVKLSERWVKQQRTAASSPPYNV  264

Query  535  EILDCDDVEVYVKTVVLMYCEDLKK  609
            EI DCDDVEVY++ + LMYC+DL+K
Sbjct  265  EIADCDDVEVYIEALRLMYCKDLRK  289



>ref|XP_002531214.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31191.1| protein binding protein, putative [Ricinus communis]
Length=474

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 20/111 (18%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            + +RIS +L +   +SP    GN  + S +  DVKLT++++DG   VSM+VHR++L   S
Sbjct  45   IMQRISDILGN---KSP----GNQFNDSLTS-DVKLTLSSKDG-ITVSMNVHRQILVAHS  95

Query  490  RFFAEKL---------RRSG--SHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFFA KL         +RS    + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  96   RFFAVKLSDRWAKQQQQRSSLLPYVVEIADCDDVEVYIETLRLMYCKDLRR  146



>ref|XP_009341340.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=653

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 22/113 (19%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            + +R+S +L      + +R+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   
Sbjct  222  MMQRVSHLL------TGNRSPGNQFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAH  272

Query  487  SRFFAEKLRR------------SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA KL              S  ++VEI DCDDVEVY++ + LMYC+DL++
Sbjct  273  SRFFAVKLSERWVKQQRTAPSSSPPYNVEIADCDDVEVYIEALRLMYCKDLRR  325



>gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja]
Length=429

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 68/110 (62%), Gaps = 19/110 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            + +RIS +L        SR+ GN  +   S  D+KLT++++DG   VSM+VHR++L   S
Sbjct  1    MMQRISELLG-------SRSPGNQFNDPLSS-DIKLTLSSKDG-ISVSMNVHRQILVAHS  51

Query  490  RFFAEKL----------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFF+ KL          R    + VEI DCDDVEVY++T+ LMYC+DL+K
Sbjct  52   RFFSVKLSDRWTNLQQQRSPVPYEVEIADCDDVEVYIETLRLMYCKDLRK  101



>ref|XP_002446981.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
 gb|EES11309.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
Length=552

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 83/156 (53%), Gaps = 43/156 (28%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQS---------PEARHR----------------VQERISRVLAHA  345
            TLFDMM+ EQ  + R +         P   H+                +Q+RI+ ++   
Sbjct  61   TLFDMMANEQDYHPRSAAAAAGVHSIPAPPHQPHHQLQPVRSMDRQMLLQDRIADLIG--  118

Query  346  PFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----  510
                 S + GN F D   S  DV+LT++++DG   V++ VHR +L   SRFFA KL    
Sbjct  119  -----SCSPGNQFNDADSS--DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRW  170

Query  511  ---RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
               +R+  H VEI DCDDVEVY +T+ LMYC+DL++
Sbjct  171  SKQQRTLPHIVEISDCDDVEVYAETLRLMYCKDLRR  206



>gb|AAZ67992.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  98



>gb|AAZ67986.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67987.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67988.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67989.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67990.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67991.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67993.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67994.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67995.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67996.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67997.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ68002.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  98



>gb|AAZ68003.1| At5g63850-like protein [Arabidopsis lyrata]
Length=233

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  98



>gb|EPS69450.1| hypothetical protein M569_05314, partial [Genlisea aurea]
Length=512

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 17/107 (16%)
 Frame = +1

Query  313  QERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSR  492
            Q+R++ +LA       SR+ GN  +   SG DVKLT++++DG   +S++VHR +L   SR
Sbjct  86   QQRLTDLLA-------SRSPGNQFNDPVSG-DVKLTLSSKDG-VDISINVHRHILVAHSR  136

Query  493  FFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            FFA KL        R SG   VEI DCDD+EVY++T+ LMY +DL +
Sbjct  137  FFALKLNEKWAQQQRSSGPFLVEIADCDDIEVYIETLRLMYSKDLGR  183



>gb|AAZ67998.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67999.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ68000.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  98



>ref|XP_009363413.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=651

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 71/113 (63%), Gaps = 22/113 (19%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            + +R+S +L        +R+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   
Sbjct  220  MMQRVSDLLTE------NRSPGNQFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAH  270

Query  487  SRFFAEKLRR------------SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA KL              S  ++VEI DCDDVEVY++ + LMYC+DL++
Sbjct  271  SRFFAVKLSERWVKQQRMTLSSSPPYNVEIADCDDVEVYIEALRLMYCKDLRR  323



>ref|XP_001762013.1| predicted protein [Physcomitrella patens]
 gb|EDQ73117.1| predicted protein, partial [Physcomitrella patens]
Length=439

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 81/139 (58%), Gaps = 30/139 (22%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRV--------QERISRVLAHAPFQSPSRADGN-FIDGS  393
            TLF+MM+ EQ       P+A H +        QE++  +L+     SP    GN F D +
Sbjct  10   TLFEMMTHEQEL----GPKAVHSISLSQQLTFQEKMKSILSGT---SP----GNQFNDTT  58

Query  394  GSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILDCD  552
             S  D+KL++  R+G   V+++VHR +L   SRFFA KL       +R+  + +EI D D
Sbjct  59   TS--DLKLSLNNREG-CSVTVNVHRHILVTHSRFFAAKLSDRWLKQQRANPNLIEITDID  115

Query  553  DVEVYVKTVVLMYCEDLKK  609
            DVE+Y++T+ LMYCED+KK
Sbjct  116  DVEIYLETLRLMYCEDVKK  134



>ref|XP_009419272.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 29/134 (22%)
 Frame = +1

Query  241  TLFDMMSKE------QSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  402
            TLF+M++ E       SR      + R R+ ERI+ ++A    + P              
Sbjct  59   TLFEMITHEDLARRVSSRTHPSGDQKRLRLLERIAAMIAK---EGP--------------  101

Query  403  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEVY  567
            GDV+L++++ DG+ +V M VHRRVLA  SRFFAEKL   G        VEI DCDD EVY
Sbjct  102  GDVELSVSSGDGF-RVPMAVHRRVLAAGSRFFAEKLAGIGGGPGRPVMVEICDCDDAEVY  160

Query  568  VKTVVLMYCEDLKK  609
            V+ V LMY  DL++
Sbjct  161  VEVVGLMYSTDLRR  174



>ref|XP_006439497.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
 gb|ESR52737.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
Length=653

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 62/92 (67%), Gaps = 11/92 (12%)
 Frame = +1

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  513
            +R+ GN  +   S  D+KLT++++DG   +S++VHR++L   SRFFA KL         +
Sbjct  236  TRSPGNQFNELTSS-DIKLTLSSKDG-ISLSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  293

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             +  + VEI DCDDVEVY++T+ LMYC+DLKK
Sbjct  294  TTLPYIVEIADCDDVEVYIETLRLMYCKDLKK  325



>gb|KDO76298.1| hypothetical protein CISIN_1g006210mg [Citrus sinensis]
Length=656

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 62/92 (67%), Gaps = 11/92 (12%)
 Frame = +1

Query  361  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  513
            +R+ GN  +   S  D+KLT++++DG   +S++VHR++L   SRFFA KL         +
Sbjct  239  TRSPGNQFNELTSS-DIKLTLSSKDG-ISLSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  296

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             +  + VEI DCDDVEVY++T+ LMYC+DLKK
Sbjct  297  TTLPYIVEIADCDDVEVYIETLRLMYCKDLKK  328



>ref|XP_002887934.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64193.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
Length=548

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  218



>ref|NP_176570.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9CAJ9.1|Y1385_ARATH RecName: Full=BTB/POZ domain-containing protein At1g63850 [Arabidopsis 
thaliana]
 gb|AAG52452.1|AC010852_9 hypothetical protein; 43750-42004 [Arabidopsis thaliana]
 gb|AEE34156.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=548

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  218



>ref|XP_010418426.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=548

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  218



>ref|XP_006302105.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
 gb|EOA35003.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
Length=548

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  218



>ref|XP_010430498.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=549

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  130  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  187

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  188  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  219



>ref|XP_010473631.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Camelina 
sativa]
Length=547

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  128  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAIKLSDRWSKQQLPP  185

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  186  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  217



>ref|XP_006828235.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
 gb|ERM95651.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
Length=489

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 17/125 (14%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  420
            TL +MMS       +      H++QER+ ++++                     GDVKL 
Sbjct  45   TLLEMMSNNHEDPPKLPENPHHKLQERVDKIISGFTL--------------SESGDVKLK  90

Query  421  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVLMY-C  594
            + +++G+  VSM V RRVL G+S FF  KL  +   H VEI DCDDVE YV+T+VLM+  
Sbjct  91   LRSKEGF-SVSMRVQRRVLVGKSGFFVGKLPDKKAGHLVEIEDCDDVEAYVETLVLMHSS  149

Query  595  EDLKK  609
            EDL+K
Sbjct  150  EDLRK  154



>ref|XP_002974611.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
 gb|EFJ24131.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
Length=450

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 18/108 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            VQE++  +L         R+ GN F D S S  DVKLTI  RDG+  VS++VHR +L  +
Sbjct  27   VQEKVDAILLL-------RSPGNQFNDPSSS--DVKLTITGRDGF-SVSINVHRHILTAQ  76

Query  487  SRFFAEKLRRSGS-------HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA K     S       ++VEI DC+DV++Y++T+ LMYC DL++
Sbjct  77   SRFFAAKFSDWWSKQHRMPLNAVEISDCEDVDLYLQTIRLMYCRDLRR  124



>ref|XP_002963321.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
 gb|EFJ35192.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
Length=450

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 18/108 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            VQE++  +L         R+ GN F D S S  DVKLTI  RDG+  +S++VHR +L  +
Sbjct  27   VQEKVDAILLL-------RSPGNQFNDPSSS--DVKLTITGRDGF-SISINVHRHILTAQ  76

Query  487  SRFFAEKLRRSGS-------HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA K     S       ++VEI DC+DV++Y++T+ LMYC DL++
Sbjct  77   SRFFAAKFSDWWSKQHRMPLNAVEISDCEDVDLYLQTIRLMYCRDLRR  124



>ref|XP_009397488.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 30/132 (23%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSP-------EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGS  399
            TLF+MMS+E   +    P       + R R+QE+I+ +LA    + P             
Sbjct  58   TLFEMMSQEGVPHRTYPPPRQPSGDQNRLRLQEKIAAILAR---EGP-------------  101

Query  400  GGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEV  564
             GD++L++++ DG+ +V++  HRRVLA RSRFFAEKL   G       +VEI +CDD E 
Sbjct  102  -GDMELSVSSSDGF-RVTVTAHRRVLAARSRFFAEKLAGVGGRPGRPVAVEICECDDAEA  159

Query  565  YVKTVVLMYCED  600
            YV+ V LMY  D
Sbjct  160  YVEAVGLMYSGD  171



>ref|XP_010676445.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Beta 
vulgaris subsp. vulgaris]
Length=585

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 23/114 (20%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  489
            +Q RI+ +LA+    SP    GN  +  GS  D++LT++++DG+  V + VHR +L G S
Sbjct  151  LQLRINEILANT---SP----GNQFNDLGSS-DIRLTLSSKDGF-SVDLCVHRHILVGHS  201

Query  490  RFFAEKL---RRSGSH-----------SVEILDCDDVEVYVKTVVLMYCEDLKK  609
            RFFA K       GS+           SVEI DCDDVEVY++T+ LMYC+DL++
Sbjct  202  RFFAGKFGFKNHRGSNGNGNGVETTPFSVEISDCDDVEVYIETLRLMYCKDLRR  255



>gb|KJB24321.1| hypothetical protein B456_004G139400 [Gossypium raimondii]
Length=518

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 62/92 (67%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  522
            R+ GN  +  GS  D+KLT++++DG   VSM+VH+++L   SRFF  KL       + +G
Sbjct  101  RSPGNKFNDPGSS-DIKLTLSSKDG-ISVSMNVHKQILVAHSRFFEVKLSDKLAKYQWNG  158

Query  523  S---HSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            S   + VEI DCDDVEVY++T+ LMYC+ L+K
Sbjct  159  SAEVYMVEITDCDDVEVYIETLRLMYCKYLRK  190



>gb|EMT26347.1| hypothetical protein F775_16772 [Aegilops tauschii]
Length=451

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 18/108 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  486
            +Q+R++ ++      SP    GN F D   S  DV+LT++++DG   +++ VHR +L   
Sbjct  7    LQDRVAELIGSC---SP----GNQFNDADSS--DVRLTLSSKDG-LSLTLCVHRHILVAH  56

Query  487  SRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            SRFFA KL       +R+  H VEI DCDDVEVYV+T+ LMYC+DL++
Sbjct  57   SRFFAAKLSDRWSKQQRTLPHIVEISDCDDVEVYVETLRLMYCKDLRR  104



>gb|AAZ68001.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 12/92 (13%)
 Frame = +1

Query  364  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  513
            R+ GN  +   S  DV  T+++ DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVXXTLSSXDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  514  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             S  + VEI DCDDVEVY++T++LMYC DL+K
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRK  98



>ref|XP_002875751.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52010.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=128

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 11/74 (15%)
 Frame = +1

Query  403  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHS--VEILDCDDVEV  564
            GDVKLT+  RDG+ +V+MDVH++VL+ +S+FF EK+   R +G SHS  VEI +C DVE 
Sbjct  13   GDVKLTLVGRDGY-RVTMDVHKKVLSEKSKFFREKMKYRRENGVSHSQMVEISECGDVE-  70

Query  565  YVKTVVLMYCEDLK  606
               TVVL YC+DL+
Sbjct  71   ---TVVLKYCDDLQ  81



>ref|XP_008665486.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 ref|XP_008665487.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 tpg|DAA51621.1| TPA: hypothetical protein ZEAMMB73_771347 [Zea mays]
Length=534

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  564
            G     D+K+ +  +DG   V M VH+  LAG S FFA+KL  +S + S+E+ DC+DVE+
Sbjct  130  GQLETSDLKVVLYGKDG-VAVKMSVHKNTLAGNSTFFADKLSGQSPASSIEVTDCEDVEI  188

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC D+K+
Sbjct  189  YVETVGLMYCSDVKQ  203



>ref|XP_004981619.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Setaria italica]
 ref|XP_004981620.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Setaria italica]
 ref|XP_004981621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X3 [Setaria italica]
Length=526

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  582
            D+K+ +  +DG   V M VH+ +LA  S FFA+KL R++   S+E+ DC+DVE+YV+TV 
Sbjct  129  DLKVVLYGKDG-VAVKMSVHKNILAENSTFFADKLSRQTPVSSLEVTDCEDVEIYVETVG  187

Query  583  LMYCEDLKK  609
            LMYC D+K+
Sbjct  188  LMYCSDVKQ  196



>ref|XP_006391703.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
 gb|ESQ28989.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
Length=554

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 14/93 (15%)
 Frame = +1

Query  364  RADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---------  513
            R+ GN F D + S  DVKLT++++DG   ++M VHR++L   SRFFA KL          
Sbjct  135  RSPGNQFNDPTSS--DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLP  191

Query  514  -RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
              S  + VEI DCDDVEVY++T++LMY  D +K
Sbjct  192  PSSSPYIVEISDCDDVEVYIETLMLMYSRDPRK  224



>dbj|BAK06120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+++ +  +DG   V M VH+ +LA  S FFA+KL R+S   S+E+ DC+DVE+
Sbjct  121  GQIEMSDLRIVLYGKDG-VAVKMSVHKNILAENSSFFADKLSRQSPVSSIEVPDCEDVEI  179

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC D+K+
Sbjct  180  YVETVGLMYCNDVKQ  194



>ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808899.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808900.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=528

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VHR ++A  SRFFA+KL R+S    +EI++C+DVE+
Sbjct  124  GQPETSDLKVLLFGKEG-IAVKMSVHRNIIAEHSRFFADKLSRQSPVPYIEIMNCEDVEI  182

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC+++K
Sbjct  183  YVETVGLMYCKEMK  196



>gb|AAX19868.1| unknown, partial [Doryanthes excelsa]
Length=194

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ ++ ++G   V M VHR +L   S FFA+KL R+S    VEI DC+DVE+
Sbjct  120  GQSETSDLKVILSGKEGI-SVRMSVHRNILLEHSSFFADKLSRQSPVSCVEIGDCEDVEI  178

Query  565  YVKTVVLMYCEDL  603
            YV+TV LMYC+++
Sbjct  179  YVETVGLMYCKEV  191



>ref|XP_002990647.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
 gb|EFJ08279.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
Length=551

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 19/109 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARD--GWPKVSMDVHRRVLAG  483
            +QER++ +L+  P  +       F D S S  DVKLT+ +RD  G   V++ VH RVL  
Sbjct  89   LQERVNAILS-CPLNT-------FNDASTS--DVKLTLISRDVVGGLTVTVHVHTRVLVA  138

Query  484  RSRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             SR+FA KL         +  +SVEI DC+DVE+Y+ T+ LMY  D K+
Sbjct  139  SSRYFAAKLAYRQQQVHTAAPYSVEISDCEDVEIYLLTIRLMYSSDFKR  187



>ref|XP_007203630.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
 gb|EMJ04829.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
Length=537

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  +EI +CDDVE
Sbjct  128  GEPGSSDMKVVLLGKQGF-CVKLSVHKNVLVEHSNFFADKLSEQQSGSSCLEIEECDDVE  186

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  187  IYVETVGLMYCKDMRQ  202



>ref|XP_002968764.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
 gb|EFJ29880.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
Length=464

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 19/109 (17%)
 Frame = +1

Query  310  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARD--GWPKVSMDVHRRVLAG  483
            +QER++ +L+  P  +       F D S S  DVKLT+ +RD  G   V++ VH RVL  
Sbjct  16   LQERVNAILS-CPLNT-------FNDASTS--DVKLTLISRDVVGGLTVTVHVHTRVLVA  65

Query  484  RSRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
             SR+FA KL         +  +SVEI DC+DVE+Y+ T+ LMY  D K+
Sbjct  66   SSRYFAAKLAYRQQQVHTAAPYSVEISDCEDVEIYLLTIRLMYSSDFKR  114



>ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941747.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941755.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VHR +LA  S FFA+KL R+S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEG-IAVRMSVHRNILAEHSIFFADKLSRQSPVPYIEIMDCEDVEI  182

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC+++K
Sbjct  183  YVETVGLMYCKEMK  196



>ref|NP_001051395.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|AAR87334.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAT85043.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99073.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99074.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99075.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13309.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|EAZ28713.1| hypothetical protein OsJ_12730 [Oryza sativa Japonica Group]
Length=522

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  582
            D+K+ +  +DG   V M VHR +LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNILAENSTWFADKLSRQSPMSSMEVPDCEDVEIYVETVG  185

Query  583  LMYCEDLKK  609
            LMYC D K+
Sbjct  186  LMYCNDAKQ  194



>gb|EAY91984.1| hypothetical protein OsI_13674 [Oryza sativa Indica Group]
Length=522

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  582
            D+K+ +  +DG   V M VHR +LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNILAENSTWFADKLSRQSPMSSMEVPDCEDVEIYVETVG  185

Query  583  LMYCEDLKK  609
            LMYC D K+
Sbjct  186  LMYCNDAKQ  194



>ref|XP_008241873.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Prunus 
mume]
Length=529

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  +EI +CDDVE
Sbjct  120  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVEHSNFFADKLSEQQSGSSCLEIEECDDVE  178

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  179  IYVETVGLMYCKDMRQ  194



>ref|XP_002522395.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40079.1| protein binding protein, putative [Ricinus communis]
Length=532

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  561
            G     D+K+ +  + G+  V + VHR VL G S FFA+KL +  S+   +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHRNVLVGNSSFFADKLSKEESNISCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  182  IYVETMGLMYCKDMKQ  197



>gb|EMT31851.1| hypothetical protein F775_21356 [Aegilops tauschii]
Length=559

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  582
            D+++ +  +DG   V M VH+ +LA  S FF++KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  162  DLRVVLYGKDG-VAVKMSVHKNILAENSTFFSDKLARQSPVSSIEVPDCEDVEIYVETVG  220

Query  583  LMYCEDLKK  609
            LMYC D+K+
Sbjct  221  LMYCNDVKQ  229



>ref|XP_008338977.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At3g50780-like [Malus domestica]
Length=531

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  + I DCDDVE
Sbjct  129  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVEHSNFFADKLSEQQSGSXCLNIEDCDDVE  187

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  188  IYVETVGLMYCKDMRQ  203



>ref|XP_009376454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=536

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  + I DCDDVE
Sbjct  127  GEPGTSDMKVVLLGKKGFC-VKLSVHKNVLVEHSNFFADKLSEQQSGSTCLNIEDCDDVE  185

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  186  IYVETVGLMYCKDMRQ  201



>ref|XP_008797004.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=526

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V + VHR +LA  S FFA+KL R+S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEG-IAVRIGVHRNILAEHSSFFADKLSRQSPVPYIEIMDCEDVEI  182

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC+++K
Sbjct  183  YVETVGLMYCKEVK  196



>ref|XP_006650658.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=521

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  582
            D+K+ +  +DG   V M VHR  LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNTLAENSTWFADKLSRQSPISSMEVPDCEDVEIYVETVG  185

Query  583  LMYCEDLKK  609
            LMYC D K+
Sbjct  186  LMYCNDAKQ  194



>ref|XP_008338182.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Malus 
domestica]
Length=536

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  +++GS  + I DCDDVE
Sbjct  127  GEPGTSDMKVVLLGKKGFC-VKLSVHKNVLVEHSNFFADKLSEQQTGSTCLNIZDCDDVE  185

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  186  IYVETVGLMYCKDMRQ  201



>ref|NP_001058798.2| Os07g0123500 [Oryza sativa Japonica Group]
 dbj|BAC83795.1| PRLI-interacting factor G-like protein [Oryza sativa Japonica 
Group]
 dbj|BAH00971.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81446.1| hypothetical protein OsI_24731 [Oryza sativa Indica Group]
 gb|EEE66492.1| hypothetical protein OsJ_22937 [Oryza sativa Japonica Group]
 dbj|BAF20712.2| Os07g0123500 [Oryza sativa Japonica Group]
Length=527

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  R+G   V M VH+ +LA  S FFA+KL R+S    +E+ DC+DVE+
Sbjct  124  GQLHTSDLKVMLYGREG-VAVKMIVHKNILAENSTFFADKLSRQSPVSCIEVSDCEDVEI  182

Query  565  YVKTVVLMYCEDLKK  609
            +V+TV LMYC+D+K+
Sbjct  183  FVETVGLMYCKDVKQ  197



>ref|XP_003548003.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=543

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+
Sbjct  133  GEPGTCDMKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGLSCLQIADCEDVEI  191

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  192  YVETVGLMYCKEMKQ  206



>ref|XP_009419041.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419043.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=526

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  567
            G     D+K+T+  + G   V M VH+ +LA  S FFA+KL       +E+ DC+DVE++
Sbjct  125  GQLETSDLKVTLHGKGG-TSVRMSVHKNILAENSSFFADKLSGLSVPQIEMADCEDVEIF  183

Query  568  VKTVVLMYCEDLK  606
            V+TV LMYC+D+K
Sbjct  184  VETVGLMYCKDIK  196



>ref|XP_009407431.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407432.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407433.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR-SGSHSVEILDCDDVEV  564
            G     D+K+T+  ++G   + M VHR +LA  S FFA+KL R S +  VEI DC+DVE+
Sbjct  125  GRPETSDMKVTLHGKEG-SSMRMSVHRNILAEHSSFFADKLSRLSPASQVEIADCEDVEI  183

Query  565  YVKTVVLMYCEDLK  606
            +++ V LMYCE++K
Sbjct  184  FLEVVGLMYCEEIK  197



>ref|XP_009407677.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407678.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407679.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=528

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VHR +LA  S FFA+K  R+S    VEI+DC+DVE+
Sbjct  130  GQPDTSDLKVVLFGKEGI-YVRMSVHRNILAEHSSFFADKFSRQSPVPCVEIVDCEDVEI  188

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC++ K
Sbjct  189  YVETVGLMYCKEPK  202



>ref|XP_010243288.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
 ref|XP_010243289.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=538

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G  +  D+K+ ++ + G+  V M VH+ VL   S FFAEKL +  S    +E+ DC+DVE
Sbjct  122  GEPATSDLKVVLSGKQGF-SVKMSVHKNVLVENSSFFAEKLSQQESPLTCLELGDCEDVE  180

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+++K+
Sbjct  181  IYVETVGLMYCKEMKQ  196



>gb|KHN36167.1| BTB/POZ domain-containing protein [Glycine soja]
Length=522

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGTCDMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  182  YVETVGLMYCKEMKQ  196



>ref|XP_008661718.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 tpg|DAA47352.1| TPA: hypothetical protein ZEAMMB73_722672 [Zea mays]
Length=530

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVL  585
            D+ + +  ++G   VSM VHR VLA  S FFA +L   G   VEI DC+D E+YV+TV L
Sbjct  127  DLTVVLYGKEG-VAVSMSVHRDVLAQSSAFFARRLAADGQPCVEIHDCEDAEIYVETVGL  185

Query  586  MYCED  600
            MYC+D
Sbjct  186  MYCDD  190



>ref|XP_003517262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006573610.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=522

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGTCDMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  182  YVETVGLMYCKEMKQ  196



>ref|XP_007156873.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 ref|XP_007156874.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28867.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28868.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
Length=521

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGSCDMKLLLLGKQGF-CVKLSVHRDVLKEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  182  YVETVGLMYCKEMKQ  196



>ref|XP_009379165.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
 ref|XP_009379166.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=531

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++ GS  + + DCDDVE
Sbjct  129  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVEHSNFFADKLSEQQPGSTCLNMEDCDDVE  187

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+++
Sbjct  188  IYVETVGLMYCKDMRQ  203



>ref|XP_002461387.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
 gb|EER97908.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
Length=543

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VH+ +LA  S FFA+++ R+S    +E+ DC+DVE+
Sbjct  126  GQLGTSDLKVVLHGKEG-VAVKMIVHKNILAENSTFFADRISRQSPVACIEVPDCEDVEI  184

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+D+K+
Sbjct  185  YVETVGLMYCKDVKQ  199



>ref|XP_007156002.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
 gb|ESW27996.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
Length=546

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I +C+DVE+
Sbjct  130  GEPGTCDMKVILLGKQGF-CVKLSVHRNVLTEKSSFFSEKLSEQSGLSCLQIGECEDVEI  188

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  189  YVETVGLMYCKEMKQ  203



>ref|XP_004955396.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=543

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VH+ +LA  S FFA ++ R+S    +E+ DC+DVE+
Sbjct  130  GQLGTSDLKVVLYGKEG-VAVKMIVHKNILAENSTFFANRISRQSPVSCIEVPDCEDVEI  188

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+D+K+
Sbjct  189  YVETVGLMYCKDVKQ  203



>ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388510.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388511.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388512.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388513.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=532

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VH  +LA  SRFFA+KL  +S    +E+ DC+DVE+
Sbjct  132  GQPETSDLKVILFGKEG-ICVRMSVHWNILAENSRFFADKLAGQSPVPCLEVADCEDVEI  190

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC++LK
Sbjct  191  YVETVGLMYCKELK  204



>ref|XP_008440171.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
 ref|XP_008440172.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
Length=534

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  567
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL      S+EI DC+DVE+Y
Sbjct  123  GEPGTSNIKVVLLGKQGF-SVKLSVHKNVLMDNSSFFANKLADQEGPSMEIGDCEDVEIY  181

Query  568  VKTVVLMYCEDLKK  609
            V+TV LMYC+++K+
Sbjct  182  VETVGLMYCKEMKQ  195



>ref|XP_004160488.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At3g50780-like [Cucumis sativus]
Length=534

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  567
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL      S+EI DC+DVE+Y
Sbjct  123  GEPGTSNIKVVLLGKQGF-SVKLSVHKNVLIDNSSFFANKLADQEGPSMEIGDCEDVEIY  181

Query  568  VKTVVLMYCEDLKK  609
            V+TV LMYC+++K+
Sbjct  182  VETVGLMYCKEMKQ  195



>ref|XP_004141951.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Cucumis 
sativus]
 gb|KGN48457.1| hypothetical protein Csa_6G487780 [Cucumis sativus]
Length=534

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  567
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL      S+EI DC+DVE+Y
Sbjct  123  GEPGTSNIKVVLLGKQGF-SVKLSVHKNVLIDNSSFFANKLADQEGPSMEIGDCEDVEIY  181

Query  568  VKTVVLMYCEDLKK  609
            V+TV LMYC+++K+
Sbjct  182  VETVGLMYCKEMKQ  195



>ref|XP_006657417.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=524

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  R+G   V M VH+ +L+  S FFA+KL R+S    +E+ DC+DVE+
Sbjct  123  GQLHTSDLKVMLYGREG-VAVKMIVHKNILSENSTFFADKLSRQSPVSCIEVSDCEDVEI  181

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+ +K+
Sbjct  182  YVETVGLMYCKHVKQ  196



>gb|KDP31825.1| hypothetical protein JCGZ_12286 [Jatropha curcas]
Length=534

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+D+E
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLSEEESNLSCLEIDDCEDIE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+K+
Sbjct  182  IYVETVGLMYCKDMKQ  197



>ref|XP_002307226.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
 gb|EEE94222.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
Length=518

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH++VL   SRFFA KL    S+   +EI DC+D+E
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKKVLEENSRFFANKLSEEESNLSCLEIDDCEDIE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+++K+
Sbjct  182  IYVETMGLMYCKEMKQ  197



>emb|CDP02424.1| unnamed protein product [Coffea canephora]
Length=538

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+++L   SRFFA K+  ++     +EI DCDDVE
Sbjct  125  GEPGTSDLKVILLGKQGF-AVKLSVHKKILVEHSRFFANKISEQQLVFPCLEIDDCDDVE  183

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC++LK+
Sbjct  184  IYVETVGLMYCKELKQ  199



>ref|XP_003558813.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=524

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  564
            G     D+++ +  +DG   V M VH+ +LA  S  FA+KL  +S   S+E+ DC+DVE+
Sbjct  121  GQIEMSDLRVVLHGKDG-VAVKMSVHKNILAENSTLFADKLSSQSPMSSIEVSDCEDVEI  179

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC D+++
Sbjct  180  YVETVGLMYCSDVRQ  194



>ref|XP_003557600.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=534

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  564
            G     D+K+ +  R+G   V M VH+ +LA  S FFA+KL  +S    +E+ DC+DVE+
Sbjct  123  GQLQTSDLKVVLYGREG-VAVKMIVHKNILAENSTFFADKLSSQSPVPFIEVPDCEDVEI  181

Query  565  YVKTVVLMYCEDLKK  609
            +V+TV LMYC+D+K+
Sbjct  182  FVETVGLMYCKDVKQ  196



>gb|KHN44517.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  409  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVL  585
            +K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+YV+TV L
Sbjct  1    MKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGMSCLQIADCEDVEIYVETVGL  59

Query  586  MYCEDLKK  609
            MYC+++K+
Sbjct  60   MYCKEMKQ  67



>ref|XP_002310195.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
 gb|EEE90645.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
Length=536

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLSEEESNLSCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+++K+
Sbjct  182  IYVETVGLMYCKEMKQ  197



>ref|NP_001168062.1| hypothetical protein [Zea mays]
 ref|XP_008671020.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 gb|ACN26975.1| unknown [Zea mays]
 tpg|DAA42716.1| TPA: hypothetical protein ZEAMMB73_494397 [Zea mays]
 tpg|DAA53077.1| TPA: hypothetical protein ZEAMMB73_512829 [Zea mays]
Length=545

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +   +G   V M VH+ +LA  S FFA+++ R+S    +E+ DC+DVE+
Sbjct  126  GQLGTSDLKVVLHGMEG-VAVKMIVHKSILAENSTFFADRISRQSPVSCIEVPDCEDVEI  184

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+D+K+
Sbjct  185  YVETVGLMYCKDVKQ  199



>ref|XP_010254985.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=539

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  561
            G  +  D+K+ ++ + G   V+M  H+ VL   S FFA++L +  S    +EI DC+DVE
Sbjct  122  GEPATSDLKVVLSGKQG-VSVTMSAHKDVLVENSSFFADRLSQQDSSLPCLEIGDCEDVE  180

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC++LK+
Sbjct  181  IYVETVGLMYCKELKQ  196



>ref|XP_010547478.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547479.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547480.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Tarenaya hassleriana]
Length=512

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH++VL   S FF  KL  + SG   +EI  C+DVE
Sbjct  121  GEPGTSDMKVVLLGKQGFC-VKLSVHKKVLVDNSSFFVNKLADKDSGFSCIEIDSCEDVE  179

Query  562  VYVKTVVLMYCEDLK  606
            +YV+TV LMYC+D+K
Sbjct  180  IYVETVGLMYCKDMK  194



>ref|XP_007047072.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 ref|XP_007047073.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91229.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91230.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=534

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH++VL   S FF +KL  + SG   +E+ DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKKVLLEHSSFFTDKLSEQESGLSCLELDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+++K+
Sbjct  182  IYVETVGLMYCKEMKQ  197



>ref|XP_003537445.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006590671.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=515

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS-VEILDCDDVEVYVKTVV  582
            D+KL +  + G+  V + VHR VL  +S FFA+KL    S S +++ DC+DVE+YV+TV 
Sbjct  121  DMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSSLSCLQVDDCEDVEIYVETVG  179

Query  583  LMYCEDLKK  609
            LMYC+++K+
Sbjct  180  LMYCKEMKQ  188



>gb|KHN42029.1| BTB/POZ domain-containing protein [Glycine soja]
Length=515

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS-VEILDCDDVEVYVKTVV  582
            D+KL +  + G+  V + VHR VL  +S FFA+KL    S S +++ DC+DVE+YV+TV 
Sbjct  121  DMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSSLSCLQVDDCEDVEIYVETVG  179

Query  583  LMYCEDLKK  609
            LMYC+++K+
Sbjct  180  LMYCKEMKQ  188



>ref|XP_011025688.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=536

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S    +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLPEEESNLSCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+++K+
Sbjct  182  IYVETVGLMYCKEMKQ  197



>ref|XP_004300583.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465450.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
Length=538

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++S S  +EI +C+DVE
Sbjct  128  GEPGTSDMKVILLGKQGF-CVKLSVHKNVLVENSNFFADKLAEQQSNSSCLEIEECEDVE  186

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+++++
Sbjct  187  IYVETVGLMYCKEMRQ  202



>gb|KHN00573.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  409  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVL  585
            +K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+YV+TV L
Sbjct  1    MKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGLSCLQIGDCEDVEIYVETVGL  59

Query  586  MYCEDLKK  609
            MYC+++K+
Sbjct  60   MYCKEMKQ  67



>gb|KEH20448.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=542

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  + G+  V + VHR VL  +S FF+EK+  +S    ++I DC+DVE+
Sbjct  131  GEPGTCDMKVVLLGKQGF-SVKLSVHRDVLIEKSSFFSEKISEQSDMSCLQIGDCEDVEI  189

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  190  YVETVGLMYCKEMKQ  204



>ref|XP_004509225.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509226.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Cicer arietinum]
Length=545

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +S    +++ DC+DVE+
Sbjct  134  GEPGTCDMKVVLLGKQGF-SVKLSVHRDVLIEKSSFFSEKLSEQSDLSCLQVGDCEDVEI  192

Query  565  YVKTVVLMYCEDLKK  609
            YV+TV LMYC+++K+
Sbjct  193  YVETVGLMYCKEMKQ  207



>ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941925.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VHR +LA  S FFA+KL   S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEG-IVVRMSVHRNILAEHSSFFADKLSTESPVPYIEIMDCEDVEI  182

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMY +++K
Sbjct  183  YVETVGLMYSKEVK  196



>dbj|BAJ95813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-----RSGSH--SVEILD  546
            G     D+ + +  ++G   V M VHR VL+G S FFAEKL        GS    VEI D
Sbjct  131  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLSGSSAFFAEKLSDGDNGHGGSPVPCVEIHD  189

Query  547  CDDVEVYVKTVVLMYCEDLK  606
            CDD E+YV+TV LMYC++ K
Sbjct  190  CDDAEIYVETVGLMYCDEAK  209



>ref|XP_002275454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Vitis 
vinifera]
 emb|CBI17589.3| unnamed protein product [Vitis vinifera]
Length=524

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL   +S    +EI DC+D+E
Sbjct  123  GEPGTSDMKVILMGKQGF-YVKLSVHKNVLMENSSFFADKLSEEQSNLSCLEIEDCEDIE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC++ K+
Sbjct  182  IYVETVGLMYCKETKQ  197



>ref|XP_010680938.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Beta 
vulgaris subsp. vulgaris]
Length=532

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V ++VH+ VL   S FFAEKL  +     S++I DC+DVE
Sbjct  123  GESGTSDMKVLLFGKHGF-SVKLNVHKSVLVDNSIFFAEKLDEQEPDVSSLQIFDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMY +D+K+
Sbjct  182  IYVETIGLMYSKDMKQ  197



>gb|EMT14102.1| hypothetical protein F775_07870 [Aegilops tauschii]
Length=518

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 45/79 (57%), Gaps = 9/79 (11%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH------SVEILDC  549
            G     D+ + +  ++G   V M VHR VL G S FF EKL  S  H       VEI DC
Sbjct  128  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLCGSSAFFTEKL--SDGHVGSPVPCVEIHDC  184

Query  550  DDVEVYVKTVVLMYCEDLK  606
            DD E+YV+TV LMYC++ K
Sbjct  185  DDAEIYVETVGLMYCDEAK  203



>ref|XP_009115752.1| PREDICTED: BTB/POZ domain-containing protein At3g50780, partial 
[Brassica rapa]
Length=352

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL  + S    +EI  C+D E
Sbjct  128  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLSDKDSVFACLEIESCEDAE  186

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+K+
Sbjct  187  IYVETVGLMYCKDMKQ  202



>ref|XP_010029862.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029863.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029864.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 gb|KCW56822.1| hypothetical protein EUGRSUZ_I02489 [Eucalyptus grandis]
Length=526

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VHR VL   S FFA+KL         +EI DC+D E
Sbjct  122  GEPGTSDMKVILLGKQGF-CVKLSVHRNVLVENSSFFAKKLLEEEDALPCLEIDDCEDAE  180

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+K+
Sbjct  181  IYVETVGLMYCKDMKQ  196



>gb|KFK34324.1| hypothetical protein AALP_AA5G130100 [Arabis alpina]
Length=529

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 67/131 (51%), Gaps = 14/131 (11%)
 Frame = +1

Query  241  TLFDMMSKEQSRNFRQSPEARH------RVQERISRVLAHAPFQSPSRADGNFIDGSGSG  402
            T+  +++ ++  ++  +PE  H       VQER  R         P +    F  G    
Sbjct  80   TIRSVIASDEQLHYSGNPETHHSIAVPVTVQERPQRQKVET---LPRKVAIEF--GEPGS  134

Query  403  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVEVYVKT  576
             D K+ +  + G+  V + VH+++L   S FFA+KL    S    +EI  C+D E+YV+T
Sbjct  135  SDAKVILVGKQGFC-VKLSVHKKLLVDHSSFFAKKLAEKDSVFACLEIESCEDAEIYVET  193

Query  577  VVLMYCEDLKK  609
            + LMYC+D+K+
Sbjct  194  IGLMYCKDMKQ  204



>gb|ACR38622.1| unknown [Zea mays]
Length=389

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  454  MDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCED  600
            M VHR VLA  S FFA +L   G   VEI DC+D E+YV+TV LMYC+D
Sbjct  1    MSVHRDVLAQSSAFFARRLAADGQPCVEIHDCEDAEIYVETVGLMYCDD  49



>ref|XP_006466699.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Citrus 
sinensis]
Length=535

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL   + G   +EI DC+DVE
Sbjct  124  GEPGTSNIKVVLLGKQGF-CVKLSVHKNVLLENSSFFANKLSEEQFGLSCLEIDDCEDVE  182

Query  562  VYVKTVVLMYCEDLKK  609
             YV+TV LMYC+D+K+
Sbjct  183  SYVETVGLMYCKDMKQ  198



>ref|XP_010558026.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Tarenaya 
hassleriana]
Length=533

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL+  S FFA KL  +  G   +EI  C+DVE
Sbjct  127  GEPGTSDMKVILLGKQGFC-VKLSVHKNVLSDNSSFFANKLAEKDPGISCLEIERCEDVE  185

Query  562  VYVKTVVLMYCEDLK  606
            +Y++TV LMYC+D+K
Sbjct  186  IYIETVGLMYCKDMK  200



>ref|XP_006290909.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
 gb|EOA23807.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
Length=520

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  121  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKNSVFACLEIESCEDAE  179

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  180  IYVETIGLMYCKDMKQ  195



>ref|XP_011099262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099263.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099264.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099265.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099268.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=534

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G   V + VHR +L   S FFA K+  ++     +EI DC+DVE
Sbjct  122  GEPGTSDLKVILLGKQG-VAVKLSVHRSILVENSSFFANKILSQQPFFPCIEIDDCEDVE  180

Query  562  VYVKTVVLMYCEDLKK  609
            VYV+TV LMYC++LK+
Sbjct  181  VYVETVGLMYCKELKQ  196



>gb|KDO79424.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79425.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79426.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79427.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79428.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
Length=421

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL   + G   +EI DC+DVE
Sbjct  10   GEPGTSNIKVVLLGKQGFC-VKLSVHKNVLLENSSFFANKLSEEQFGLSCLEIDDCEDVE  68

Query  562  VYVKTVVLMYCEDLKK  609
             YV+TV LMYC+D+K+
Sbjct  69   SYVETVGLMYCKDMKQ  84



>ref|XP_009397738.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397739.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397740.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  564
            G     D+K+ +  ++G   V M VH+ +L   S FFA+K  R+S     EI DC+DVE+
Sbjct  125  GQPETSDLKIILFGKEG-IAVEMSVHKAILTEHSSFFADKFSRQSPVPFFEISDCEDVEI  183

Query  565  YVKTVVLMYCEDLK  606
            YV+TV LMYC ++K
Sbjct  184  YVETVGLMYCGEVK  197



>gb|EMS65337.1| hypothetical protein TRIUR3_32744 [Triticum urartu]
Length=559

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 46/80 (58%), Gaps = 8/80 (10%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-----RSGSH--SVEILD  546
            G     D+ + +  ++G   V M VHR VL G S FFAEKL        GS    VEI D
Sbjct  166  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLCGSSGFFAEKLSDGDNGHGGSLVPCVEIHD  224

Query  547  CDDVEVYVKTVVLMYCEDLK  606
            CDD E+YV+TV LMYC++ K
Sbjct  225  CDDAEIYVETVGLMYCDEAK  244



>ref|XP_010426621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Camelina 
sativa]
Length=521

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  122  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  180

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  181  IYVETIGLMYCKDMKQ  196



>ref|XP_010515449.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=522

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  123  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  182  IYVETIGLMYCKDMKQ  197



>ref|XP_010503746.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=524

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  125  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  183

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  184  IYVETIGLMYCKDMKQ  199



>gb|KJB17837.1| hypothetical protein B456_003G018200 [Gossypium raimondii]
Length=536

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH++VL   S FF +KL  +  G   +EI DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKKVLMEHSCFFTDKLSGQEPGLSCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
             YV+TV LMYC+++K+
Sbjct  182  SYVETVGLMYCKEMKQ  197



>gb|EYU39382.1| hypothetical protein MIMGU_mgv1a003833mg [Erythranthe guttata]
Length=561

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSV----EILDCDD  555
            G     D+K+ +  + G   V + VHR VL   S FFA K+  SG   +    EI +C+D
Sbjct  129  GEAKTSDLKVILLGKQGL-AVKLSVHRSVLVENSDFFARKI--SGQQPIFPCLEIDNCED  185

Query  556  VEVYVKTVVLMYCEDLKK  609
            VE+YV+T+ LMYC++LK+
Sbjct  186  VEIYVETIGLMYCKELKQ  203



>emb|CDX77944.1| BnaA09g31390D [Brassica napus]
Length=512

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL  + S    +EI  C+D E
Sbjct  117  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLSDKDSVFACLEIESCEDAE  175

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC+D+K+
Sbjct  176  IYVETVGLMYCKDMKQ  191



>ref|XP_011009912.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=518

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRS--GSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH++VL   S FFA KL         +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKKVLEENSSFFANKLSEEEFSLSCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+++K+
Sbjct  182  IYVETMGLMYCKEMKQ  197



>ref|XP_002877770.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54029.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  119  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSCFFAKKLAEKDSVFACLEIESCEDAE  177

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  178  IYVETIGLMYCKDMKQ  193



>ref|XP_006404002.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
 gb|ESQ45455.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
Length=527

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  126  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  184

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ +MYC+D+K+
Sbjct  185  IYVETIGIMYCKDMKQ  200



>ref|NP_190647.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SVM0.1|Y3078_ARATH RecName: Full=BTB/POZ domain-containing protein At3g50780 [Arabidopsis 
thaliana]
 emb|CAB42907.1| putative protein [Arabidopsis thaliana]
 gb|AAO22779.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50646.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78709.1| uncharacterized protein AT3G50780 [Arabidopsis thaliana]
Length=520

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  561
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  120  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSCFFAKKLAEKDSVFACLEIESCEDAE  178

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+T+ LMYC+D+K+
Sbjct  179  LYVETIGLMYCKDMKQ  194



>ref|XP_011085536.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085537.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085538.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=525

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = +1

Query  346  PFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRS  519
            P   P +    F  G     D+++ +  + G   V + +HR +L   S FFA K+  ++ 
Sbjct  111  PENVPRKVTIEF--GEPGTSDLRVILLGKHGL-AVKLSIHRSILVENSSFFASKISEQQP  167

Query  520  GSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
                +EI +CDDVE+YV+T+ LMYC++LK+
Sbjct  168  VFPCLEIDNCDDVEIYVETIGLMYCKELKQ  197



>gb|KHG25971.1| hypothetical protein F383_06642 [Gossypium arboreum]
Length=536

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+K+ +  + G+  V + VH+ VL   S FF +KL  +  G   +EI DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKIVLMEHSCFFTDKLSGQEPGLSCLEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
             YV+TV LMYC+++K+
Sbjct  182  SYVETVGLMYCKEMKQ  197



>ref|XP_009776607.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
 ref|XP_009776608.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
Length=536

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+++ +  + G+  V ++VH+ +L   S +FA K+  ++     +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVENSSYFANKISEQQPVFPCIEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC++ K+
Sbjct  182  IYVETVGLMYCKEFKQ  197



>ref|XP_009629328.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
 ref|XP_009629329.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
Length=538

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+++ +  + G+  V ++VH+ +L   S +FA K+  ++     +EI DC+DVE
Sbjct  125  GEPGTSDLRVILLGKQGF-TVKLNVHKSILVENSSYFANKISEQQPVFPCIEIDDCEDVE  183

Query  562  VYVKTVVLMYCEDLKK  609
            +YV+TV LMYC++ K+
Sbjct  184  IYVETVGLMYCKEFKQ  199



>ref|XP_006338266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Solanum 
tuberosum]
Length=536

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+++ +  + G+  V ++VH+ +L   S FFA K+  R+     +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVENSSFFANKISVRQPVFPCIEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            + V+T+ LMYC+++K+
Sbjct  182  ICVETIGLMYCKEMKQ  197



>ref|XP_004232086.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Solanum 
lycopersicum]
Length=536

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  561
            G     D+++ +  + G+  V ++VH+ +L   S FFA K+  ++     +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVANSSFFANKISVQQPVFPCIEIDDCEDVE  181

Query  562  VYVKTVVLMYCEDLKK  609
            + V+T+ LMYC+++K+
Sbjct  182  ICVETIGLMYCKEMKQ  197



>ref|XP_004963062.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=526

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 8/78 (10%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCD  552
            G     D+ + +  ++G   V + VHR VL   S FFA +L  +G H      VEI DCD
Sbjct  125  GRPETSDLTVMLYGKEG-IAVKIGVHRDVLCRSSAFFAARL--AGGHGLPPPCVEIHDCD  181

Query  553  DVEVYVKTVVLMYCEDLK  606
            D E+YV+TV LMYC++ K
Sbjct  182  DAEIYVETVGLMYCDEAK  199



>ref|XP_006856144.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
 gb|ERN17611.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
Length=618

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  448  VSMDVHRRVLAGRSRFFAEKLRR--SGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  609
            V M VHR +LA  S +FAEKL +       VEI +C+DVE +V+TV LMYC+D+K+
Sbjct  145  VRMRVHRNILAINSTYFAEKLSQLLGPPFCVEIGECEDVESFVETVGLMYCKDVKQ  200



>ref|XP_006664162.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=516

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 12/84 (14%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----------SV  534
            G     D+ + +  ++G   V M VHR VL   S FFAEKL  +               V
Sbjct  119  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLCRSSGFFAEKLAAASGGGGGHGSPAVPSCV  177

Query  535  EILDCDDVEVYVKTVVLMYCEDLK  606
            EI DCDD E+YV+TV LMYC++ K
Sbjct  178  EIHDCDDAEIYVETVGLMYCDEAK  201



>ref|XP_006419030.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
 gb|ESQ37466.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
Length=380

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +1

Query  493  FFAEKLR-RSGSHSVEILDCDDVEVYVKTVVLMYCEDLK  606
             F EK++ +S SH++EI +CDDVEV+V+TVVLM+CEDLK
Sbjct  82   IFMEKMKSQSQSHTLEISECDDVEVFVETVVLMHCEDLK  120



>gb|EEE53535.1| hypothetical protein OsJ_36742 [Oryza sativa Japonica Group]
Length=1123

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  537
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEG-IAVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  538  ILDCDDVEVYVKTVVLMYCEDLK  606
            I DCDD E+YV+TV LMYC++ K
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAK  195



>gb|ABG22069.1| expressed protein [Oryza sativa Japonica Group]
Length=510

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  537
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEG-IAVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  538  ILDCDDVEVYVKTVVLMYCEDLK  606
            I DCDD E+YV+TV LMYC++ K
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAK  195



>gb|ABA99196.2| expressed protein [Oryza sativa Japonica Group]
Length=513

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  537
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEG-IAVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  538  ILDCDDVEVYVKTVVLMYCEDLK  606
            I DCDD E+YV+TV LMYC++ K
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAK  195



>ref|XP_010097900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB72727.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=532

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +1

Query  388  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVE---ILDCDDV  558
            G     D+K+ +  + G+  V + VH+ VL     FFA+KL            I DC+DV
Sbjct  126  GEPGTSDMKVILLGKQGF-CVKLSVHKNVLVEHCSFFADKLSEQQQSGSSSLEIDDCEDV  184

Query  559  EVYVKTVVLMYCEDLKK  609
            E+YV+TV LMYC+++++
Sbjct  185  EIYVETVGLMYCKEMRQ  201



>ref|XP_002452861.1| hypothetical protein SORBIDRAFT_04g033760 [Sorghum bicolor]
 gb|EES05837.1| hypothetical protein SORBIDRAFT_04g033760 [Sorghum bicolor]
Length=216

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 11/77 (14%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS----------VEILDCDD  555
            D+ + +  ++G   V M VH  +L+  S FFA +L  + +            VEI DCDD
Sbjct  70   DLTVMLYGKEG-IAVRMSVHSDILSQSSAFFAHRLSAAAAAVGGSAPNQPCVVEIHDCDD  128

Query  556  VEVYVKTVVLMYCEDLK  606
             E+YV+TV LMYC++ K
Sbjct  129  AEMYVETVGLMYCDEAK  145



>ref|XP_002442447.1| hypothetical protein SORBIDRAFT_08g020150 [Sorghum bicolor]
 gb|EES16285.1| hypothetical protein SORBIDRAFT_08g020150 [Sorghum bicolor]
Length=524

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 10/76 (13%)
 Frame = +1

Query  406  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS---------VEILDCDDV  558
            D+ + +  ++G   V M VH  VL+  S FFA +L  +G            VEI DCDD 
Sbjct  146  DLTVMLYGKEGI-AVRMSVHSDVLSQSSAFFAHRLSAAGGGGGPAPNQPCVVEIDDCDDA  204

Query  559  EVYVKTVVLMYCEDLK  606
            E+YV+TV LMYC++ K
Sbjct  205  EMYVETVGLMYCDEAK  220



>ref|XP_002438728.1| hypothetical protein SORBIDRAFT_10g025090 [Sorghum bicolor]
 gb|EER90095.1| hypothetical protein SORBIDRAFT_10g025090 [Sorghum bicolor]
Length=161

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 9/62 (15%)
 Frame = +1

Query  448  VSMDVHRRVLAGRSRFFAEKLRRSGSHS---------VEILDCDDVEVYVKTVVLMYCED  600
            V M VH  VL+  S FFA +L  + + +         VEI DCDD E+YV+TV LMYC++
Sbjct  10   VRMSVHSDVLSQSSAFFAHRLSAAAAAAGSAPNQPCVVEIHDCDDAEMYVETVGLMYCDE  69

Query  601  LK  606
             K
Sbjct  70   AK  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230