BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021A22

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085741.1|  PREDICTED: pentatricopeptide repeat-containi...    237   3e-71   Sesamum indicum [beniseed]
ref|XP_009774058.1|  PREDICTED: pentatricopeptide repeat-containi...    236   1e-70   Nicotiana sylvestris
gb|EYU40343.1|  hypothetical protein MIMGU_mgv1a004109mg                219   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_009592903.1|  PREDICTED: pentatricopeptide repeat-containi...    219   2e-64   Nicotiana tomentosiformis
ref|XP_010052788.1|  PREDICTED: pentatricopeptide repeat-containi...    215   5e-63   Eucalyptus grandis [rose gum]
ref|XP_009338668.1|  PREDICTED: pentatricopeptide repeat-containi...    214   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_002301239.2|  pentatricopeptide repeat-containing family p...    213   5e-62   Populus trichocarpa [western balsam poplar]
gb|KDP28877.1|  hypothetical protein JCGZ_14648                         212   7e-62   Jatropha curcas
ref|XP_004229730.1|  PREDICTED: pentatricopeptide repeat-containi...    212   1e-61   Solanum lycopersicum
ref|XP_011017395.1|  PREDICTED: pentatricopeptide repeat-containi...    212   1e-61   Populus euphratica
ref|XP_006347992.1|  PREDICTED: pentatricopeptide repeat-containi...    211   4e-61   Solanum tuberosum [potatoes]
ref|XP_010692029.1|  PREDICTED: pentatricopeptide repeat-containi...    209   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008343713.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-60   
ref|XP_002270492.1|  PREDICTED: pentatricopeptide repeat-containi...    208   2e-60   Vitis vinifera
ref|XP_002526471.1|  pentatricopeptide repeat-containing protein,...    208   3e-60   Ricinus communis
ref|XP_008438222.1|  PREDICTED: pentatricopeptide repeat-containi...    207   6e-60   Cucumis melo [Oriental melon]
ref|XP_004133941.1|  PREDICTED: pentatricopeptide repeat-containi...    207   1e-59   Cucumis sativus [cucumbers]
ref|XP_011032472.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-58   Populus euphratica
ref|XP_006375170.1|  pentatricopeptide repeat-containing family p...    202   4e-58   
emb|CDY15126.1|  BnaC05g00050D                                          200   2e-57   Brassica napus [oilseed rape]
gb|KHG14992.1|  hypothetical protein F383_17735                         201   2e-57   Gossypium arboreum [tree cotton]
ref|XP_009119759.1|  PREDICTED: pentatricopeptide repeat-containi...    200   2e-57   Brassica rapa
emb|CDX90079.1|  BnaA10g00030D                                          200   2e-57   
ref|XP_004307244.1|  PREDICTED: pentatricopeptide repeat-containi...    200   3e-57   Fragaria vesca subsp. vesca
ref|XP_006445447.1|  hypothetical protein CICLE_v10019658mg             200   3e-57   Citrus clementina [clementine]
ref|XP_010089787.1|  hypothetical protein L484_008037                   200   5e-57   Morus notabilis
ref|XP_008232381.1|  PREDICTED: pentatricopeptide repeat-containi...    199   6e-57   Prunus mume [ume]
ref|XP_006418504.1|  hypothetical protein EUTSA_v10007383mg             199   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009375366.1|  PREDICTED: pentatricopeptide repeat-containi...    199   9e-57   Pyrus x bretschneideri [bai li]
ref|XP_007052357.1|  Tetratricopeptide repeat (TPR)-like superfam...    199   1e-56   
ref|XP_007218971.1|  hypothetical protein PRUPE_ppa003822mg             199   1e-56   Prunus persica
ref|XP_006306047.1|  hypothetical protein CARUB_v10011354mg             198   2e-56   Capsella rubella
ref|XP_002892022.1|  pentatricopeptide repeat-containing protein        198   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010496474.1|  PREDICTED: pentatricopeptide repeat-containi...    197   2e-56   
ref|XP_010479321.1|  PREDICTED: pentatricopeptide repeat-containi...    198   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008343643.1|  PREDICTED: pentatricopeptide repeat-containi...    194   1e-55   
ref|NP_171717.2|  pentatricopeptide repeat-containing protein           195   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22842.1|  hypothetical protein B456_004G069400                    194   3e-55   Gossypium raimondii
gb|AAM19786.1|  At1g02150/T7I23.8                                       194   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515320.1|  PREDICTED: pentatricopeptide repeat-containi...    194   4e-55   Cicer arietinum [garbanzo]
gb|KEH18913.1|  PPR containing plant protein                            188   5e-55   Medicago truncatula
ref|XP_008343638.1|  PREDICTED: pentatricopeptide repeat-containi...    194   6e-55   Malus domestica [apple tree]
ref|XP_010246096.1|  PREDICTED: pentatricopeptide repeat-containi...    191   5e-54   Nelumbo nucifera [Indian lotus]
ref|XP_003520417.1|  PREDICTED: pentatricopeptide repeat-containi...    184   3e-51   Glycine max [soybeans]
ref|XP_003530115.1|  PREDICTED: pentatricopeptide repeat-containi...    182   1e-50   Glycine max [soybeans]
ref|XP_007134411.1|  hypothetical protein PHAVU_010G045500g             175   1e-47   Phaseolus vulgaris [French bean]
gb|EPS66397.1|  hypothetical protein M569_08380                         172   3e-47   Genlisea aurea
ref|XP_010540211.1|  PREDICTED: pentatricopeptide repeat-containi...    173   5e-47   Tarenaya hassleriana [spider flower]
ref|XP_010933566.1|  PREDICTED: pentatricopeptide repeat-containi...    166   9e-45   Elaeis guineensis
ref|XP_010919766.1|  PREDICTED: pentatricopeptide repeat-containi...    166   1e-44   Elaeis guineensis
ref|XP_008786192.1|  PREDICTED: pentatricopeptide repeat-containi...    162   2e-43   Phoenix dactylifera
emb|CDP09418.1|  unnamed protein product                                161   3e-43   Coffea canephora [robusta coffee]
ref|XP_008794909.1|  PREDICTED: pentatricopeptide repeat-containi...    158   1e-41   Phoenix dactylifera
ref|XP_006838525.1|  hypothetical protein AMTR_s00002p00190720          153   1e-40   
emb|CBI16683.3|  unnamed protein product                                152   4e-40   Vitis vinifera
ref|XP_010496689.1|  PREDICTED: pentatricopeptide repeat-containi...    149   1e-38   
dbj|BAJ85010.1|  predicted protein                                      147   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652599.1|  PREDICTED: pentatricopeptide repeat-containi...    147   7e-38   
ref|XP_002448264.1|  hypothetical protein SORBIDRAFT_06g024190          147   7e-38   Sorghum bicolor [broomcorn]
ref|XP_004956425.1|  PREDICTED: pentatricopeptide repeat-containi...    147   1e-37   
ref|NP_001168310.1|  hypothetical protein                               145   2e-37   Zea mays [maize]
dbj|BAK02297.1|  predicted protein                                      145   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAE04345.1|  OSJNBb0038F03.9                                        144   8e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95037.1|  hypothetical protein OsI_16851                          144   8e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001053460.2|  Os04g0544400                                       144   1e-36   
ref|XP_010227218.1|  PREDICTED: uncharacterized protein LOC100829762    143   2e-35   Brachypodium distachyon [annual false brome]
gb|EEC77735.1|  hypothetical protein OsI_16848                          142   5e-35   Oryza sativa Indica Group [Indian rice]
gb|EAZ31514.1|  hypothetical protein OsJ_15655                          119   9e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849761.1|  hypothetical protein AMTR_s00024p00251490          110   1e-24   
ref|XP_008344410.1|  PREDICTED: pentatricopeptide repeat-containi...    110   1e-24   
emb|CAN75355.1|  hypothetical protein VITISV_002476                     110   3e-24   Vitis vinifera
ref|XP_007052358.1|  Tetratricopeptide repeat (TPR)-like superfam...    106   1e-23   
emb|CBI21839.3|  unnamed protein product                                107   2e-23   Vitis vinifera
gb|KJB50098.1|  hypothetical protein B456_008G153900                    105   4e-23   Gossypium raimondii
ref|XP_003636175.1|  ATP-dependent DNA helicase PIF1                    107   5e-23   
ref|XP_010272479.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002273904.2|  PREDICTED: pentatricopeptide repeat-containi...    106   1e-22   Vitis vinifera
ref|XP_003636171.1|  Pentatricopeptide repeat-containing protein      97.4    8e-22   
ref|NP_001151760.1|  tetratricopeptide-like helical                     102   1e-21   Zea mays [maize]
ref|XP_009357846.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009342634.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    100   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_007198902.1|  hypothetical protein PRUPE_ppa005316mg             100   2e-21   Prunus persica
ref|XP_004146883.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-21   
gb|KGN53198.1|  Pentatricopeptide repeat-containing protein             100   3e-21   Cucumis sativus [cucumbers]
ref|XP_002442234.1|  hypothetical protein SORBIDRAFT_08g016710          100   3e-21   
ref|XP_006840468.1|  hypothetical protein AMTR_s00045p00181820          100   4e-21   
emb|CBI21840.3|  unnamed protein product                              99.0    8e-21   Vitis vinifera
ref|XP_010108201.1|  hypothetical protein L484_014527                 99.8    8e-21   
ref|XP_008451368.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    9e-21   Cucumis melo [Oriental melon]
emb|CDP17058.1|  unnamed protein product                              99.8    9e-21   Coffea canephora [robusta coffee]
ref|XP_004962880.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    1e-20   Setaria italica
emb|CAN73453.1|  hypothetical protein VITISV_024964                   99.4    1e-20   Vitis vinifera
ref|NP_001176986.1|  Os12g0527850                                     97.4    1e-20   
ref|XP_010921943.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    1e-20   Elaeis guineensis
ref|XP_010237220.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_010249903.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008381253.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-20   
ref|XP_008453822.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-20   Cucumis melo [Oriental melon]
ref|XP_008790994.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    2e-20   Phoenix dactylifera
ref|XP_004133705.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    2e-20   Cucumis sativus [cucumbers]
ref|XP_008452263.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-20   Cucumis melo [Oriental melon]
ref|XP_008810293.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    3e-20   Phoenix dactylifera
gb|KDP21918.1|  hypothetical protein JCGZ_03056                       97.8    4e-20   Jatropha curcas
ref|XP_008781129.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    4e-20   Phoenix dactylifera
ref|XP_008381422.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    4e-20   
ref|XP_010242929.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009349931.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    4e-20   Pyrus x bretschneideri [bai li]
dbj|BAK02972.1|  predicted protein                                    97.4    5e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO35896.1|  hypothetical protein CISIN_1g048394mg                 97.1    6e-20   Citrus sinensis [apfelsine]
gb|EMT11631.1|  Pentatricopeptide repeat-containing protein           99.0    6e-20   
ref|XP_009387891.1|  PREDICTED: pentatricopeptide repeat-containi...  92.4    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46994.1|  hypothetical protein B456_008G004700                  97.4    6e-20   Gossypium raimondii
ref|XP_006827770.1|  hypothetical protein AMTR_s00009p00264540        97.1    7e-20   
ref|XP_008342918.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    7e-20   
ref|XP_008353787.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    8e-20   
gb|EPS60165.1|  hypothetical protein M569_14638                       97.1    8e-20   Genlisea aurea
gb|ABA99305.2|  pentatricopeptide, putative, expressed                97.1    9e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KEH17920.1|  PPR containing plant-like protein                     95.5    9e-20   Medicago truncatula
gb|KCW90381.1|  hypothetical protein EUGRSUZ_A02520                   96.3    1e-19   Eucalyptus grandis [rose gum]
gb|KDP24140.1|  hypothetical protein JCGZ_25797                       96.3    1e-19   Jatropha curcas
ref|XP_004148903.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    1e-19   Cucumis sativus [cucumbers]
ref|XP_008366628.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    1e-19   
ref|XP_009379667.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    1e-19   
ref|XP_007021400.1|  Tetratricopeptide repeat-like superfamily pr...  96.3    1e-19   
ref|XP_010058578.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    2e-19   Eucalyptus grandis [rose gum]
gb|EMT17732.1|  hypothetical protein F775_09007                       95.5    2e-19   
ref|XP_008227878.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    2e-19   Prunus mume [ume]
ref|XP_006429067.1|  hypothetical protein CICLE_v10011521mg           95.5    3e-19   Citrus clementina [clementine]
ref|XP_009144540.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    3e-19   Brassica rapa
ref|XP_007221478.1|  hypothetical protein PRUPE_ppa005037mg           94.7    3e-19   
ref|XP_008229148.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    3e-19   Prunus mume [ume]
ref|XP_002531596.1|  pentatricopeptide repeat-containing protein,...  93.2    3e-19   
ref|XP_009354430.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    4e-19   Pyrus x bretschneideri [bai li]
ref|XP_008235277.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    4e-19   Prunus mume [ume]
ref|XP_006664068.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    5e-19   Oryza brachyantha
ref|XP_010255941.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    5e-19   Nelumbo nucifera [Indian lotus]
emb|CDX97288.1|  BnaA02g20790D                                        94.7    5e-19   
ref|XP_008349216.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    5e-19   Malus domestica [apple tree]
ref|XP_010940923.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    7e-19   Elaeis guineensis
ref|XP_006480799.1|  PREDICTED: pentatricopeptide repeat-containi...  94.4    7e-19   Citrus sinensis [apfelsine]
gb|EPS68015.1|  hypothetical protein M569_06760                       92.4    9e-19   Genlisea aurea
ref|XP_010921472.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    1e-18   Elaeis guineensis
ref|XP_004155477.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    1e-18   
ref|XP_010556784.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010456952.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    1e-18   
gb|KHG13694.1|  hypothetical protein F383_19313                       93.6    1e-18   Gossypium arboreum [tree cotton]
ref|XP_004514446.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    1e-18   Cicer arietinum [garbanzo]
gb|KDO74080.1|  hypothetical protein CISIN_1g011236mg                 93.2    1e-18   Citrus sinensis [apfelsine]
emb|CDX91277.1|  BnaC02g26880D                                        93.2    2e-18   
gb|KHN31110.1|  Pentatricopeptide repeat-containing protein           92.4    2e-18   Glycine soja [wild soybean]
ref|XP_010520653.1|  PREDICTED: uncharacterized protein LOC104799713  94.4    2e-18   
ref|XP_004288536.2|  PREDICTED: pentatricopeptide repeat-containi...  92.8    2e-18   Fragaria vesca subsp. vesca
ref|XP_008368855.1|  PREDICTED: pentatricopeptide repeat-containi...  92.4    3e-18   
gb|KGN43610.1|  hypothetical protein Csa_7G047450                     92.4    3e-18   Cucumis sativus [cucumbers]
ref|XP_009398991.1|  PREDICTED: pentatricopeptide repeat-containi...  92.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042879.1|  Tetratricopeptide repeat-like superfamily pr...  90.9    4e-18   
gb|EYU46589.1|  hypothetical protein MIMGU_mgv1a004554mg              92.0    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_008455539.1|  PREDICTED: uncharacterized protein LOC103495690  93.2    4e-18   
ref|XP_006376506.1|  pentatricopeptide repeat-containing family p...  92.0    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008781131.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    5e-18   Phoenix dactylifera
emb|CDP03624.1|  unnamed protein product                              91.7    5e-18   Coffea canephora [robusta coffee]
ref|XP_010069830.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    6e-18   Eucalyptus grandis [rose gum]
ref|XP_006429969.1|  hypothetical protein CICLE_v10013712mg           91.3    6e-18   
emb|CDO99551.1|  unnamed protein product                              90.9    7e-18   Coffea canephora [robusta coffee]
ref|XP_009779118.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    7e-18   Nicotiana sylvestris
gb|EMT27370.1|  Pentatricopeptide repeat-containing protein           92.4    7e-18   
ref|XP_002874893.1|  pentatricopeptide repeat-containing protein      91.7    7e-18   
ref|XP_002316903.2|  hypothetical protein POPTR_0011s12150g           91.3    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006451898.1|  hypothetical protein CICLE_v10007647mg           92.0    8e-18   
ref|XP_009610168.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    8e-18   Nicotiana tomentosiformis
ref|XP_009357845.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_010939721.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    9e-18   Elaeis guineensis
gb|KFK30887.1|  hypothetical protein AALP_AA6G038700                  91.3    9e-18   Arabis alpina [alpine rockcress]
ref|NP_192191.1|  pentatricopeptide repeat-containing protein         91.3    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517926.1|  pentatricopeptide repeat-containing protein,...  90.9    9e-18   Ricinus communis
emb|CDO97403.1|  unnamed protein product                              90.1    9e-18   Coffea canephora [robusta coffee]
gb|AAL32523.1|  Unknown protein                                       91.3    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010091037.1|  hypothetical protein L484_006401                 90.5    1e-17   
ref|XP_004290659.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    1e-17   Fragaria vesca subsp. vesca
gb|KJB79603.1|  hypothetical protein B456_013G057100                  89.7    1e-17   Gossypium raimondii
ref|XP_009629681.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    1e-17   Nicotiana tomentosiformis
ref|XP_010099567.1|  hypothetical protein L484_011573                 90.9    1e-17   Morus notabilis
ref|XP_007203456.1|  hypothetical protein PRUPE_ppa022158mg           90.5    1e-17   
ref|XP_006481674.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    1e-17   Citrus sinensis [apfelsine]
gb|KHG20865.1|  hypothetical protein F383_27144                       89.4    1e-17   Gossypium arboreum [tree cotton]
ref|XP_010422532.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010455929.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDP14775.1|  unnamed protein product                              90.5    2e-17   Coffea canephora [robusta coffee]
ref|XP_010430409.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_011079543.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    2e-17   Sesamum indicum [beniseed]
ref|XP_003536907.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    2e-17   Glycine max [soybeans]
ref|XP_007050629.1|  Pentatricopeptide repeat (PPR) superfamily p...  90.5    2e-17   
ref|XP_011029462.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    2e-17   Populus euphratica
ref|XP_002301516.2|  pentatricopeptide repeat-containing family p...  90.1    2e-17   
gb|ACU24296.1|  unknown                                               89.7    2e-17   Glycine max [soybeans]
gb|KHN16203.1|  Pentatricopeptide repeat-containing protein, mito...  89.7    2e-17   Glycine soja [wild soybean]
ref|XP_006287476.1|  hypothetical protein CARUB_v10000687mg           90.1    2e-17   Capsella rubella
gb|ABR18022.1|  unknown                                               90.1    3e-17   Picea sitchensis
ref|XP_004155478.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    3e-17   
ref|XP_007198989.1|  hypothetical protein PRUPE_ppa004422mg           89.7    3e-17   Prunus persica
ref|XP_008229146.1|  PREDICTED: pentatricopeptide repeat-containi...  89.7    3e-17   Prunus mume [ume]
ref|XP_009401682.1|  PREDICTED: pentatricopeptide repeat-containi...  89.7    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003590654.1|  WD repeat-containing protein                     89.7    3e-17   
ref|XP_006399423.1|  hypothetical protein EUTSA_v10013686mg           88.6    3e-17   Eutrema salsugineum [saltwater cress]
gb|AES60905.2|  PPR containing plant protein                          89.4    3e-17   Medicago truncatula
ref|XP_006349176.1|  PREDICTED: pentatricopeptide repeat-containi...  89.4    4e-17   Solanum tuberosum [potatoes]
ref|XP_007051132.1|  Tetratricopeptide repeat (TPR)-like superfam...  89.4    4e-17   
ref|XP_002527601.1|  pentatricopeptide repeat-containing protein,...  89.4    4e-17   Ricinus communis
ref|XP_002322749.2|  hypothetical protein POPTR_0016s06320g           89.4    4e-17   
ref|XP_009627474.1|  PREDICTED: pentatricopeptide repeat-containi...  89.4    4e-17   
ref|XP_004229380.2|  PREDICTED: pentatricopeptide repeat-containi...  89.4    4e-17   Solanum lycopersicum
ref|XP_008812226.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    4e-17   Phoenix dactylifera
ref|XP_011039574.1|  PREDICTED: uncharacterized protein LOC105136086  90.1    4e-17   Populus euphratica
ref|XP_009368491.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    6e-17   Pyrus x bretschneideri [bai li]
ref|XP_011032725.1|  PREDICTED: pentatricopeptide repeat-containi...  89.0    6e-17   Populus euphratica
ref|XP_002307578.1|  pentatricopeptide repeat-containing family p...  88.6    6e-17   Populus trichocarpa [western balsam poplar]
emb|CDP14776.1|  unnamed protein product                              88.6    6e-17   Coffea canephora [robusta coffee]
ref|XP_010062875.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    7e-17   Eucalyptus grandis [rose gum]
ref|XP_011087932.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    7e-17   Sesamum indicum [beniseed]
ref|XP_003567580.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    8e-17   Brachypodium distachyon [annual false brome]
ref|XP_009387580.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    8e-17   
gb|KDP21467.1|  hypothetical protein JCGZ_21938                       88.6    8e-17   Jatropha curcas
ref|XP_006347050.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    8e-17   Solanum tuberosum [potatoes]
ref|XP_009382489.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    9e-17   
gb|KCW49953.1|  hypothetical protein EUGRSUZ_K03412                   87.8    9e-17   Eucalyptus grandis [rose gum]
ref|XP_003526072.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    9e-17   Glycine max [soybeans]
gb|KEH37793.1|  PPR containing plant protein                          88.2    9e-17   Medicago truncatula
ref|XP_008337472.1|  PREDICTED: pentatricopeptide repeat-containi...  88.2    9e-17   
ref|XP_002457728.1|  hypothetical protein SORBIDRAFT_03g012450        88.2    9e-17   Sorghum bicolor [broomcorn]
gb|EYU46819.1|  hypothetical protein MIMGU_mgv1a004991mg              88.2    9e-17   Erythranthe guttata [common monkey flower]
ref|XP_010690204.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010249890.1|  PREDICTED: pentatricopeptide repeat-containi...  87.8    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010038139.1|  PREDICTED: pentatricopeptide repeat-containi...  87.8    1e-16   Eucalyptus grandis [rose gum]
ref|XP_011042275.1|  PREDICTED: pentatricopeptide repeat-containi...  87.8    1e-16   Populus euphratica
gb|KDP24137.1|  hypothetical protein JCGZ_25794                       87.4    1e-16   Jatropha curcas
ref|XP_004295631.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    2e-16   Fragaria vesca subsp. vesca
ref|XP_002871373.1|  hypothetical protein ARALYDRAFT_487758           86.7    2e-16   
ref|XP_008339193.1|  PREDICTED: putative pentatricopeptide repeat...  88.2    2e-16   
gb|KJB23095.1|  hypothetical protein B456_004G080600                  87.4    2e-16   Gossypium raimondii
ref|XP_002520753.1|  pentatricopeptide repeat-containing protein,...  87.4    2e-16   
ref|XP_010677631.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136821.1|  PREDICTED: pentatricopeptide repeat-containi...  87.0    2e-16   
gb|KGN43609.1|  hypothetical protein Csa_7G047440                     87.0    2e-16   Cucumis sativus [cucumbers]
ref|XP_010662164.1|  PREDICTED: pentatricopeptide repeat-containi...  87.4    2e-16   Vitis vinifera
ref|XP_010039270.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    2e-16   Eucalyptus grandis [rose gum]
ref|XP_002466988.1|  hypothetical protein SORBIDRAFT_01g017960        87.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_007144631.1|  hypothetical protein PHAVU_007G171700g           87.0    2e-16   Phaseolus vulgaris [French bean]
emb|CBI36964.3|  unnamed protein product                              87.0    2e-16   Vitis vinifera
ref|XP_004137019.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    3e-16   
ref|XP_006444085.1|  hypothetical protein CICLE_v10019771mg           86.7    3e-16   Citrus clementina [clementine]
ref|XP_008810294.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    3e-16   
gb|AES61635.2|  PPR containing plant protein                          86.7    3e-16   Medicago truncatula
ref|XP_006396507.1|  hypothetical protein EUTSA_v10028573mg           86.7    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008237223.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    3e-16   Prunus mume [ume]
gb|KDP28274.1|  hypothetical protein JCGZ_14045                       86.7    3e-16   Jatropha curcas
ref|XP_004495896.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    3e-16   Cicer arietinum [garbanzo]
ref|XP_003591384.1|  Pentatricopeptide repeat-containing protein      86.7    3e-16   
ref|XP_003632411.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  86.7    3e-16   
ref|XP_004495206.1|  PREDICTED: pentatricopeptide repeat-containi...  86.7    3e-16   Cicer arietinum [garbanzo]
ref|XP_002884218.1|  pentatricopeptide repeat-containing protein      86.7    3e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_008237222.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    3e-16   Prunus mume [ume]
gb|EPS72236.1|  hypothetical protein M569_02523                       86.3    3e-16   Genlisea aurea
ref|XP_008796719.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    4e-16   Phoenix dactylifera
ref|XP_011041046.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    5e-16   Populus euphratica
ref|NP_001042820.1|  Os01g0301000                                     86.3    5e-16   
ref|NP_001288478.1|  uncharacterized protein LOC103635083             85.9    6e-16   Zea mays [maize]
emb|CAN64701.1|  hypothetical protein VITISV_037299                   87.0    6e-16   Vitis vinifera
emb|CBI40661.3|  unnamed protein product                              83.6    6e-16   Vitis vinifera
ref|XP_008655858.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  85.9    6e-16   
ref|XP_011079842.1|  PREDICTED: pentatricopeptide repeat-containi...  85.9    7e-16   Sesamum indicum [beniseed]
gb|AFN53641.1|  pentatricopeptide repeat-containing protein           85.5    7e-16   Linum usitatissimum
ref|XP_006287850.1|  hypothetical protein CARUB_v10001077mg           84.7    7e-16   Capsella rubella
ref|XP_006287851.1|  hypothetical protein CARUB_v10001077mg           84.7    8e-16   Capsella rubella
ref|XP_010918492.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    8e-16   Elaeis guineensis
ref|XP_007029137.1|  Tetratricopeptide repeat-like superfamily pr...  84.0    9e-16   
ref|XP_006357486.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    9e-16   
ref|XP_010241951.1|  PREDICTED: pentatricopeptide repeat-containi...  85.5    9e-16   Nelumbo nucifera [Indian lotus]
gb|KEH19654.1|  PPR containing plant protein                          85.1    9e-16   Medicago truncatula
ref|XP_009615280.1|  PREDICTED: pentatricopeptide repeat-containi...  85.1    1e-15   Nicotiana tomentosiformis
ref|XP_004146598.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    1e-15   
ref|NP_179663.1|  pentatricopeptide repeat-containing protein         84.7    1e-15   
emb|CDP05907.1|  unnamed protein product                              85.5    1e-15   
ref|XP_009390562.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    1e-15   
ref|XP_010452937.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    2e-15   
ref|XP_004967563.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    2e-15   
ref|XP_002282230.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    2e-15   
ref|XP_010555122.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    2e-15   
gb|EAY73658.1|  hypothetical protein OsI_01545                        84.3    2e-15   
ref|XP_010422981.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    2e-15   
ref|XP_002268952.2|  PREDICTED: pentatricopeptide repeat-containi...  83.6    2e-15   
ref|XP_002277733.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    2e-15   
emb|CAN71816.1|  hypothetical protein VITISV_023421                   84.0    2e-15   
ref|XP_006841256.1|  hypothetical protein AMTR_s00135p00094440        83.2    2e-15   
gb|AFK33523.1|  unknown                                               82.8    2e-15   
dbj|BAK06496.1|  predicted protein                                    84.3    2e-15   
ref|XP_010422661.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    2e-15   
ref|XP_011037317.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    2e-15   
ref|XP_010656672.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    3e-15   
ref|NP_568214.1|  pentatricopeptide repeat-containing protein         83.2    3e-15   
ref|XP_004240342.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    3e-15   
ref|XP_002322750.1|  hypothetical protein POPTR_0016s06330g           84.0    3e-15   
gb|KDO42278.1|  hypothetical protein CISIN_1g015370mg                 83.2    3e-15   
gb|KHG24373.1|  hypothetical protein F383_30483                       84.0    3e-15   
ref|XP_006307239.1|  hypothetical protein CARUB_v10008848mg           84.0    3e-15   
ref|XP_010491574.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    3e-15   
gb|EYU18441.1|  hypothetical protein MIMGU_mgv1a007532mg              82.8    3e-15   
ref|XP_008386165.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    3e-15   
dbj|BAJ86699.1|  predicted protein                                    83.6    3e-15   
ref|XP_007029136.1|  Tetratricopeptide repeat-like superfamily pr...  83.6    4e-15   
ref|XP_006492603.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    4e-15   
ref|XP_011098322.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    4e-15   
ref|XP_004514343.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    4e-15   
gb|AAM64472.1|  unknown                                               82.8    4e-15   
ref|XP_004303401.2|  PREDICTED: uncharacterized protein LOC101303140  84.3    4e-15   
gb|KDP27040.1|  hypothetical protein JCGZ_20975                       83.6    4e-15   
ref|XP_009762284.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    4e-15   
emb|CBI20322.3|  unnamed protein product                              84.0    5e-15   
ref|XP_006287578.1|  hypothetical protein CARUB_v10000787mg           83.2    5e-15   
ref|NP_001060183.1|  Os07g0598500                                     83.2    5e-15   
gb|AGN52922.1|  hypothetical protein                                  80.9    5e-15   
ref|XP_002515265.1|  pentatricopeptide repeat-containing protein,...  83.2    5e-15   
ref|XP_009768016.1|  PREDICTED: pentatricopeptide repeat-containi...  83.2    6e-15   
ref|XP_010539219.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    6e-15   
ref|XP_009589051.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    6e-15   
ref|XP_010910082.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    7e-15   
ref|XP_006366127.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    7e-15   
ref|XP_002517927.1|  pentatricopeptide repeat-containing protein,...  82.8    7e-15   
ref|XP_002872860.1|  hypothetical protein ARALYDRAFT_490379           82.4    8e-15   
ref|XP_010439439.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    8e-15   
ref|XP_006661923.1|  PREDICTED: pentatricopeptide repeat-containi...  82.8    8e-15   
ref|XP_008668553.1|  PREDICTED: hypothetical protein isoform X1       82.4    8e-15   
ref|XP_010547648.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    8e-15   
gb|KFK25252.1|  hypothetical protein AALP_AA8G088000                  81.6    9e-15   
ref|XP_010449015.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    9e-15   
ref|XP_010245038.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    9e-15   
gb|KHN08626.1|  Pentatricopeptide repeat-containing protein, mito...  82.0    1e-14   
ref|XP_006396396.1|  hypothetical protein EUTSA_v10029427mg           82.0    1e-14   
ref|XP_007145137.1|  hypothetical protein PHAVU_007G213200g           82.0    1e-14   
gb|EYU26391.1|  hypothetical protein MIMGU_mgv1a004262mg              82.4    1e-14   
ref|XP_004982702.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    1e-14   
gb|KGN64672.1|  hypothetical protein Csa_1G073790                     81.6    1e-14   
ref|XP_004168984.1|  PREDICTED: pentatricopeptide repeat-containi...  81.6    1e-14   
ref|XP_010489001.1|  PREDICTED: pentatricopeptide repeat-containi...  82.0    1e-14   
ref|XP_009380887.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    1e-14   
gb|KEH40167.1|  PPR containing plant protein                          81.3    1e-14   
dbj|BAK01251.1|  predicted protein                                    81.6    1e-14   
ref|XP_006597358.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    2e-14   
ref|XP_003594185.1|  Pentatricopeptide repeat-containing protein      77.0    2e-14   
ref|XP_009367213.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    2e-14   
ref|XP_003545705.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    2e-14   
ref|XP_011458411.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    2e-14   
ref|XP_010267968.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    2e-14   
ref|XP_009800693.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    2e-14   
gb|KHG24281.1|  hypothetical protein F383_04038                       81.3    2e-14   
ref|XP_010065705.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    2e-14   
ref|XP_007200782.1|  hypothetical protein PRUPE_ppa024012mg           80.9    3e-14   
ref|XP_004243349.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    3e-14   
gb|KGN43772.1|  hypothetical protein Csa_7G066290                     80.5    3e-14   
ref|XP_004290423.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    3e-14   
ref|XP_009119640.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    3e-14   
ref|XP_009757637.1|  PREDICTED: pentatricopeptide repeat-containi...  80.9    3e-14   
emb|CDY39781.1|  BnaA09g10330D                                        80.5    3e-14   
gb|KFK40443.1|  hypothetical protein AALP_AA3G373800                  80.5    3e-14   
emb|CDX89976.1|  BnaA10g01060D                                        80.9    3e-14   
ref|XP_009112678.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    3e-14   
ref|XP_009125763.1|  PREDICTED: pentatricopeptide repeat-containi...  80.1    4e-14   
gb|KJB24418.1|  hypothetical protein B456_004G144700                  80.5    4e-14   
emb|CDY15237.1|  BnaC05g01160D                                        80.5    4e-14   
emb|CDY03299.1|  BnaC09g10490D                                        80.5    4e-14   
ref|XP_006418350.1|  hypothetical protein EUTSA_v10007036mg           80.9    4e-14   
ref|XP_002283946.2|  PREDICTED: pentatricopeptide repeat-containi...  80.5    4e-14   
gb|KDP35619.1|  hypothetical protein JCGZ_09057                       80.5    4e-14   
gb|KHN33548.1|  Pentatricopeptide repeat-containing protein, mito...  80.5    4e-14   
ref|XP_004136896.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    5e-14   
emb|CBI19224.3|  unnamed protein product                              80.5    5e-14   
gb|EMT28017.1|  hypothetical protein F775_21804                       79.7    5e-14   
ref|XP_011037318.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    5e-14   
ref|XP_004233832.2|  PREDICTED: pentatricopeptide repeat-containi...  79.7    5e-14   
ref|XP_003545936.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    6e-14   
ref|XP_008442448.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    7e-14   
ref|XP_006361033.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    7e-14   
ref|XP_010538695.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    7e-14   
ref|XP_006376509.1|  hypothetical protein POPTR_0013s13650g           79.7    7e-14   
ref|XP_006658770.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    8e-14   
ref|XP_008455133.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-14   
ref|XP_002438962.1|  hypothetical protein SORBIDRAFT_10g029030        79.3    8e-14   
ref|XP_011037316.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    8e-14   
ref|XP_008455132.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    8e-14   
ref|XP_006483923.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    9e-14   
ref|XP_011043090.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    1e-13   
ref|XP_002464423.1|  hypothetical protein SORBIDRAFT_01g017970        79.3    1e-13   
ref|XP_010538697.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    1e-13   
gb|KDO82307.1|  hypothetical protein CISIN_1g011226mg                 79.0    1e-13   
ref|XP_006438303.1|  hypothetical protein CICLE_v10031342mg           79.0    1e-13   
ref|XP_009400074.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    1e-13   
gb|EMT15886.1|  hypothetical protein F775_07739                       79.0    1e-13   
ref|XP_007148381.1|  hypothetical protein PHAVU_006G203700g           78.2    1e-13   
ref|XP_010467773.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    1e-13   
ref|XP_010538678.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    1e-13   
ref|XP_010467774.1|  PREDICTED: pentatricopeptide repeat-containi...  79.0    1e-13   
gb|EAY79103.1|  hypothetical protein OsI_34209                        79.0    1e-13   
emb|CAN73943.1|  hypothetical protein VITISV_032243                   78.6    1e-13   
dbj|BAJ93740.1|  predicted protein                                    79.0    1e-13   
ref|XP_002889397.1|  pentatricopeptide repeat-containing protein      79.0    1e-13   
ref|XP_009789509.1|  PREDICTED: pentatricopeptide repeat-containi...  78.6    2e-13   
ref|XP_002522615.1|  pentatricopeptide repeat-containing protein,...  78.2    2e-13   
ref|XP_010108203.1|  hypothetical protein L484_014529                 78.6    2e-13   
ref|XP_006299518.1|  hypothetical protein CARUB_v10015690mg           78.6    2e-13   
ref|XP_002517929.1|  pentatricopeptide repeat-containing protein,...  78.2    2e-13   
ref|XP_008442434.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-13   
gb|KHN26767.1|  Pentatricopeptide repeat-containing protein, mito...  77.8    2e-13   
ref|XP_010480914.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-13   
ref|XP_006429968.1|  hypothetical protein CICLE_v10011545mg           78.2    2e-13   
gb|AAM93669.1|  putative leaf protein                                 78.6    2e-13   
ref|XP_010087220.1|  hypothetical protein L484_009729                 77.8    2e-13   
ref|XP_010429011.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-13   
ref|XP_010474650.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-13   
gb|EAZ30910.1|  hypothetical protein OsJ_14991                        77.8    3e-13   
ref|XP_008800895.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    3e-13   
ref|XP_006481675.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    3e-13   
emb|CAD40831.1|  OSJNBa0086B14.3                                      77.4    3e-13   
ref|XP_004499170.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    3e-13   
gb|KDO70776.1|  hypothetical protein CISIN_1g011472mg                 77.8    3e-13   
gb|EAY94330.1|  hypothetical protein OsI_16098                        77.4    3e-13   
ref|NP_001042824.1|  Os01g0301700                                     77.8    3e-13   
ref|XP_009770415.1|  PREDICTED: pentatricopeptide repeat-containi...  77.8    3e-13   
gb|KJB13385.1|  hypothetical protein B456_002G071700                  77.8    3e-13   
ref|XP_003531533.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    4e-13   
emb|CDY44801.1|  BnaC02g00860D                                        77.0    4e-13   
ref|XP_009618814.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    4e-13   
ref|XP_006283610.1|  hypothetical protein CARUB_v10004666mg           77.4    4e-13   
ref|XP_010439441.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    4e-13   
ref|XP_009379589.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    4e-13   
ref|XP_006355517.1|  PREDICTED: pentatricopeptide repeat-containi...  77.4    5e-13   
ref|XP_003594181.1|  Pentatricopeptide repeat-containing protein      75.1    5e-13   
ref|XP_010553613.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    5e-13   
gb|KDP40947.1|  hypothetical protein JCGZ_24946                       76.6    5e-13   
ref|XP_010023484.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    5e-13   
ref|XP_009368291.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    5e-13   
ref|XP_010542838.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    5e-13   
gb|KFK42596.1|  hypothetical protein AALP_AA1G016200                  77.0    5e-13   
gb|KJB69510.1|  hypothetical protein B456_011G027300                  77.0    6e-13   
gb|KHF99488.1|  hypothetical protein F383_17053                       77.0    6e-13   
ref|XP_009612934.1|  PREDICTED: pentatricopeptide repeat-containi...  77.0    6e-13   
ref|XP_006381714.1|  pentatricopeptide repeat-containing family p...  76.6    7e-13   
ref|XP_004982703.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-13   
ref|XP_010693618.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-13   
ref|XP_010686505.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-13   
ref|XP_007211848.1|  hypothetical protein PRUPE_ppa004720mg           76.6    8e-13   
gb|AFW86057.1|  hypothetical protein ZEAMMB73_674343                  77.0    8e-13   
ref|NP_001168600.1|  uncharacterized protein LOC100382384             76.6    8e-13   
ref|XP_008786836.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    9e-13   
ref|XP_002436399.1|  hypothetical protein SORBIDRAFT_10g001830        76.3    1e-12   
emb|CAH66166.1|  H0107B07.5                                           76.3    1e-12   
ref|NP_001052458.1|  Os04g0320200                                     76.3    1e-12   
ref|XP_010925090.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_008368256.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_010679402.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_003574143.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_003571944.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    1e-12   
ref|XP_006302183.1|  hypothetical protein CARUB_v10020193mg           75.9    1e-12   
ref|XP_007149856.1|  hypothetical protein PHAVU_005G104300g           75.9    1e-12   
emb|CBI23460.3|  unnamed protein product                              75.9    1e-12   
ref|XP_006344770.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    1e-12   
ref|NP_001064983.1|  Os10g0501000                                     75.5    1e-12   
ref|XP_007044736.1|  Tetratricopeptide repeat (TPR)-like superfam...  75.9    1e-12   
ref|NP_567220.1|  pentatricopeptide repeat-containing protein         75.9    1e-12   
emb|CDO99549.1|  unnamed protein product                              75.9    1e-12   
gb|AAD22661.1|AC007138_25  hypothetical protein                       75.9    1e-12   
ref|XP_007153764.1|  hypothetical protein PHAVU_003G063200g           75.9    1e-12   
ref|XP_006467809.1|  PREDICTED: pentatricopeptide repeat-containi...  75.9    2e-12   
ref|XP_002267979.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_006449328.1|  hypothetical protein CICLE_v10015002mg           75.5    2e-12   
ref|XP_007025640.1|  Tetratricopeptide repeat-like superfamily pr...  76.3    2e-12   
ref|XP_006409008.1|  hypothetical protein EUTSA_v10001972mg           75.5    2e-12   
ref|XP_006644107.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
gb|KEH20176.1|  PPR containing plant protein                          75.5    2e-12   
ref|XP_010924205.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_008801961.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_009595568.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_009798980.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
ref|XP_010105079.1|  hypothetical protein L484_012430                 75.5    2e-12   
ref|NP_001064985.1|  Os10g0501300                                     75.5    2e-12   
ref|XP_010436455.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_002869870.1|  hypothetical protein ARALYDRAFT_354609           75.5    2e-12   
ref|XP_010473256.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_010449016.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_010510912.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_010455119.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    2e-12   
ref|XP_009628193.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
ref|XP_002446580.1|  hypothetical protein SORBIDRAFT_06g018360        74.7    2e-12   
ref|XP_004248795.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
ref|NP_171739.1|  pentatricopeptide repeat-containing protein         75.5    2e-12   
ref|XP_006348243.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
ref|XP_004244223.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
gb|AAL38889.1|  unknown protein                                       75.1    2e-12   
ref|XP_008384387.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    2e-12   
ref|XP_006376504.1|  pentatricopeptide repeat-containing family p...  74.7    3e-12   
ref|XP_004964414.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    3e-12   
gb|AIZ68164.1|  pentatricopeptide repeat-containing protein At1g6...  74.7    3e-12   



>ref|XP_011085741.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Sesamum indicum]
Length=546

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 144/186 (77%), Gaps = 8/186 (4%)
 Frame = +3

Query  87   NLLPFPSGF---STLTLLNPL-----KSRRKGLAITCASISQVHSYGTVDYEKRPMPNWG  242
            N + F SG    ST  L  P+     K+ +    + C+SISQVHSYGTVDYEKRPM  W 
Sbjct  20   NPISFSSGLLQNSTFFLKQPILSISRKTHKNPAFVACSSISQVHSYGTVDYEKRPMLKWN  79

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
             IYK+ISM+E P  G+++VLN+ E+EGKR+S+ EL  VV++LRKF R+  ALEV EWMN+
Sbjct  80   AIYKKISMLENPNMGSASVLNEVENEGKRLSKWELCRVVKELRKFRRYRFALEVYEWMNN  139

Query  423  RAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
            RAE Y+ITTSDTAIQLDLI+KVHGIS+AEKYF+ LP++LKD+RIYGSLLNAYVR  MREK
Sbjct  140  RAESYRITTSDTAIQLDLIAKVHGISSAEKYFMKLPDALKDKRIYGSLLNAYVRARMREK  199

Query  603  AESLFD  620
            AESL D
Sbjct  200  AESLMD  205



>ref|XP_009774058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana sylvestris]
Length=538

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = +3

Query  63   LSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWG  242
            +SFSSS+   L FPSGF  L  L   K+    + I+C+SISQVHSYGTVDYE+RP+  W 
Sbjct  17   VSFSSSLCYSLSFPSGFCNLGGLTCPKNHT--VVISCSSISQVHSYGTVDYERRPIVKWN  74

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
             IYKRISM + P++G+ +VLNQ E+EGK++++ EL  V+++LRKF R+ LALEV EWMN+
Sbjct  75   AIYKRISMNDGPERGSVSVLNQWENEGKKVTKWELSRVIKELRKFRRYKLALEVYEWMNN  134

Query  423  RAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
            RAER+++TTSDTAIQLDLI+KVHGIS+AE+YF+ LP++LKD+RIYGSLLNA+VR   +E+
Sbjct  135  RAERFRLTTSDTAIQLDLIAKVHGISSAEEYFVKLPDTLKDKRIYGSLLNAFVRARKKEQ  194

Query  603  AESLFD  620
            AESL D
Sbjct  195  AESLID  200



>gb|EYU40343.1| hypothetical protein MIMGU_mgv1a004109mg [Erythranthe guttata]
Length=543

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = +3

Query  144  SRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEG  323
            + R  L + C+SISQVHSYGT+DYE+RPM NW  +YK+ISM++ P+ G+++VLNQ E++ 
Sbjct  47   THRNPLFVACSSISQVHSYGTLDYERRPMLNWNAVYKQISMLDDPKLGSASVLNQVENDD  106

Query  324  KRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISN  503
            KR+++ EL  +V++LRKF R   ALEV +WMN+RAERY+ITTSDTAIQLDLI+KVHGI++
Sbjct  107  KRLTKWELCRIVKELRKFKRFKYALEVYDWMNNRAERYRITTSDTAIQLDLIAKVHGIAS  166

Query  504  AEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AE YFL LP++LKD+RIYGSLLN Y R  MREK+ESL D
Sbjct  167  AEHYFLKLPDALKDKRIYGSLLNVYARSRMREKSESLMD  205



>ref|XP_009592903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana tomentosiformis]
Length=539

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +3

Query  108  GFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKG  287
            GF     L   K+ R  + I+C+SISQVHSYGTVDYE+RP+  W  IYKRISM + P++G
Sbjct  32   GFCFTKPLTSPKNNRT-VVISCSSISQVHSYGTVDYERRPIVKWNAIYKRISMNDGPERG  90

Query  288  ASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQ  467
            + +VL Q E+EGK++++ EL  V+++LRKF R+ LALEV EWMN+RAER+++TTSDTAIQ
Sbjct  91   SVSVLKQWENEGKKVTKWELSRVIKELRKFRRYKLALEVYEWMNNRAERFRLTTSDTAIQ  150

Query  468  LDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            LDLI+KVHGIS+AE+YF+ LP++LKD+RIYGSLLNA+VR   +E+AESL D
Sbjct  151  LDLIAKVHGISSAEEYFVKLPDTLKDKRIYGSLLNAFVRARKKEQAESLID  201



>ref|XP_010052788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Eucalyptus grandis]
 gb|KCW76861.1| hypothetical protein EUGRSUZ_D01216 [Eucalyptus grandis]
Length=528

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            +R  S S S+    P  S  S + +L    S  K  AI+C S+SQVHSY T+DYE+RPM 
Sbjct  9    NRNPSISPSLSYSRPLQSRVSQI-ILRQSSSPFKPPAISC-SVSQVHSYNTMDYERRPMV  66

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  ++KRIS++E P+ GA++VLNQCEDEGK++++ EL  VV++LRK+ R+ LALEV +W
Sbjct  67   KWNAVFKRISLMENPELGAASVLNQCEDEGKKLTKWELCRVVKELRKYKRYKLALEVYDW  126

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER++++ SD AIQLDLI+KV GIS+AE +FL LP++LKDRRIYG+LLNAYVR  M
Sbjct  127  MNNRGERFRLSASDAAIQLDLIAKVRGISSAEDFFLKLPDALKDRRIYGALLNAYVRAKM  186

Query  594  REKAESLFD  620
            +EKAESL +
Sbjct  187  KEKAESLIE  195



>ref|XP_009338668.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Pyrus x bretschneideri]
Length=530

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            H   + SSS+   LPFP    TLTL  P     + L     SISQVH+YGTVDYE+RPM 
Sbjct  10   HHNATLSSSLAYALPFPYKIPTLTL--PTFINFQKLPTISCSISQVHNYGTVDYERRPMI  67

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY++IS+ E PQ  ++ VLNQ E EG+++++ EL  V+++LRK+ R+  ALEV +W
Sbjct  68   KWNAIYRKISLTEDPQVRSADVLNQWEKEGRKLTKWELCRVIKELRKYKRYDRALEVYDW  127

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            M++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNAYVR  M
Sbjct  128  MSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVRARM  187

Query  594  REKAESLFD  620
            +EKAE+L D
Sbjct  188  KEKAEALLD  196



>ref|XP_002301239.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80512.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 2/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            H ++S SS+I    P P      TL   +  ++  L +   SISQ+H+YGTVDYE+RPM 
Sbjct  9    HHKVSLSSTISYSHPLPWKNPNFTLHQTVNYKK--LPVITCSISQIHNYGTVDYERRPMM  66

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY+RIS++E P+ G+ +VLNQ E++GKR+++ EL  VV++LRK+ R+  ALEV +W
Sbjct  67   KWNAIYRRISLMENPELGSGSVLNQWENDGKRLTKWELCRVVKELRKYKRYQQALEVYDW  126

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER+ ++ SD AIQLDLI+KV G+S+AE +FL LPN+ KDRRIYG+LLNAYVR  M
Sbjct  127  MNNRQERFGLSPSDAAIQLDLIAKVRGVSSAEDFFLRLPNTFKDRRIYGALLNAYVRNRM  186

Query  594  REKAESLFD  620
            REKAESL D
Sbjct  187  REKAESLID  195



>gb|KDP28877.1| hypothetical protein JCGZ_14648 [Jatropha curcas]
Length=528

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 136/190 (72%), Gaps = 3/190 (2%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCA-SISQVHSYGTVDYEKRPM  230
            H++ S SS+I    P P       L   +  R+  L ITC  SISQVH+YGTVDYE+RPM
Sbjct  9    HQKASLSSTISYSQPLPGKNPDFALRQTINFRK--LPITCKISISQVHNYGTVDYERRPM  66

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
             NW  IY++IS++E P  GA TVLNQ E  GK++++ EL  VV++LRKF R+  ALEV +
Sbjct  67   MNWNSIYRKISLMENPGLGAGTVLNQIEKNGKKLTKWELCRVVKELRKFKRYKQALEVYD  126

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WMN+R ER++++ SD AIQLDLI+KV G+ +AE +F  LP+S+KDRRIYG+LLNAYVR  
Sbjct  127  WMNNREERFRVSASDAAIQLDLIAKVRGVYSAEDFFFRLPDSVKDRRIYGALLNAYVRAK  186

Query  591  MREKAESLFD  620
            MREKAE   D
Sbjct  187  MREKAECWID  196



>ref|XP_004229730.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Solanum lycopersicum]
Length=545

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  AITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRL  341
             I+C+S SQVHSYGTVDYE+RP+  W  IYKRISM + P++G+ +VLNQ E+EGK++++ 
Sbjct  55   VISCSSTSQVHSYGTVDYERRPIVKWNAIYKRISMNDGPERGSVSVLNQWENEGKKVTKW  114

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
            EL  V+++LRKF R+ LA EV EWMN+R ER+++TTSDTAIQLDLI+KVHGIS+AE+YF 
Sbjct  115  ELSRVIKELRKFRRYKLAFEVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSAEEYFD  174

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             LP++LKD+RIYGSLLNA+VR   +E+AESL D
Sbjct  175  KLPDTLKDKRIYGSLLNAFVRSRKKEQAESLLD  207



>ref|XP_011017395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Populus euphratica]
Length=539

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            H + S SS+I    P P      TL   +  ++  L +   SISQ+H+YGTVDYE+RPM 
Sbjct  9    HHKGSLSSTISYSHPLPWKNPNFTLHQTVNYKK--LPVITCSISQLHNYGTVDYERRPMM  66

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY+RIS++E P+ G+ +VLNQ E+EGKR+++ EL  VV++LRK+ R+  ALEV +W
Sbjct  67   KWNAIYRRISLMENPELGSGSVLNQWENEGKRLTKWELCRVVKELRKYKRYQQALEVYDW  126

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER+ ++ SD AIQLDLI+KV G+S+AE +FL LPN+ KDRRIYG+LLNAYVR  M
Sbjct  127  MNNRQERFGLSPSDAAIQLDLIAKVRGVSSAEDFFLRLPNTFKDRRIYGALLNAYVRNRM  186

Query  594  REKAESLFD  620
            REKAESL D
Sbjct  187  REKAESLID  195



>ref|XP_006347992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Solanum tuberosum]
Length=545

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  AITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRL  341
             I+C+S  QVHSYGTVDYE+RP+  W  IYKRISM + P++G+ +VLNQ E+EGK++++ 
Sbjct  55   VISCSSTPQVHSYGTVDYERRPIVKWNAIYKRISMNDGPERGSVSVLNQWENEGKKVTKW  114

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
            EL  V+++LRKF R+ LA EV EWMN+R ER+++TTSDTAIQLDLI+KVHGIS+AE+YF 
Sbjct  115  ELSRVIKELRKFRRYKLAFEVYEWMNNRPERFRLTTSDTAIQLDLIAKVHGISSAEEYFE  174

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             LP++LKD+RIYGSLLNA+VR   +E+AESL D
Sbjct  175  KLPDTLKDKRIYGSLLNAFVRSRKKEQAESLLD  207



>ref|XP_010692029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
            FPSG  + + ++    R   L+I C S+ QV+SYGT+DYEKRPM  W  IYKRIS++E P
Sbjct  26   FPSG--SRSFISFSNGRPFNLSIQC-SVPQVYSYGTMDYEKRPMLKWVDIYKRISLMENP  82

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
            Q G ++VLNQCE EGK++++ EL  +VR+LRKF R  LALEV EWMN+R ER+++++SDT
Sbjct  83   QIGVASVLNQCEKEGKKVNKWELCKIVRELRKFKRFKLALEVYEWMNNRIERFRLSSSDT  142

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI+KV G+S+AE YF+ LP++LKD+RIYG+LLNAYV    REKAESL +
Sbjct  143  AIQLDLIAKVRGVSSAEDYFMRLPDTLKDKRIYGALLNAYVGAKEREKAESLME  196



>ref|XP_008343713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Malus domestica]
Length=531

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = +3

Query  72   SSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIY  251
            ++++P  LPF     TLTL   L  ++  L     SISQVH+YGTVDYE+RPM  W  IY
Sbjct  12   NATLPYFLPFXYKIPTLTLPTFLNFQK--LPTISCSISQVHNYGTVDYERRPMVKWNAIY  69

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            ++IS+ E PQ  ++ VLNQ E EG+++++ EL  VV++LRK+ R+  ALEV +WM++R E
Sbjct  70   RKISLTEDPQVRSADVLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGE  129

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
            R++I+TSD AIQLDL++KV G+++AE YFL+LP +LKDRRIYG+LLNAYVR  M+EKAE+
Sbjct  130  RFRISTSDAAIQLDLVAKVRGVASAENYFLSLPGTLKDRRIYGALLNAYVRARMKEKAEA  189

Query  612  LFD  620
            L D
Sbjct  190  LLD  192



>ref|XP_002270492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Vitis vinifera]
Length=527

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +3

Query  105  SGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQK  284
            SGF + TL   +  R+   +ITC SISQ+HSYGTVDYE+RP+  W  +Y+RIS++E P+ 
Sbjct  16   SGFPSFTLPRSVNYRKH--SITC-SISQIHSYGTVDYERRPLVKWNAVYRRISLMENPEM  72

Query  285  GASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAI  464
            G+++VLNQ E+EGKR+++ EL  VV++LRKF R  +ALEV EWMN+R ER+++++SD AI
Sbjct  73   GSASVLNQWENEGKRLTKWELCRVVKELRKFKRFKMALEVYEWMNNRGERFRLSSSDAAI  132

Query  465  QLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            QLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNAYV+  MR+KAE L +
Sbjct  133  QLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNAYVQAKMRDKAEILIE  184



>ref|XP_002526471.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35862.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=533

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 142/189 (75%), Gaps = 3/189 (2%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            H++ S SS+I    P P      TL   +  R+  L ITC SIS+VHSYGTVDYE+RPM 
Sbjct  10   HQQASLSSTISYSRPLPWKNPHYTLHQTVNYRK--LPITC-SISKVHSYGTVDYERRPMI  66

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  +Y+RIS++E P+ GA+TVLN+ E +GK++++ EL  VV++LRK+ RH  ALEV +W
Sbjct  67   KWNSVYRRISLMEKPELGAATVLNEMEKDGKKLTKWELCRVVKELRKYKRHKQALEVYDW  126

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER++++ SD AIQLDL++KV G+S+AE YF+ L +++KDRR+YG+LLN+YV+  M
Sbjct  127  MNNREERFRLSASDAAIQLDLVAKVRGVSSAEDYFMRLSDNVKDRRVYGALLNSYVKARM  186

Query  594  REKAESLFD  620
            REKAESL +
Sbjct  187  REKAESLIE  195



>ref|XP_008438222.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Cucumis melo]
Length=537

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            HR +S  SS+     F     +    + +  RR  L++TC SISQVHSYGTVD+E+RPM 
Sbjct  9    HRTVSLPSSVSYSRKFLPPIQSQPFFHNVNYRRLRLSVTC-SISQVHSYGTVDFERRPMV  67

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY+RIS++E P+ G+++VLNQ E+EGK +++ EL  VV++LRK+ R   ALE+ +W
Sbjct  68   KWNAIYRRISLMENPELGSASVLNQWENEGKNLTKWELSRVVKELRKYKRFERALEIYDW  127

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            M++R ER+++TTSD AIQLDLISKV GI +AE YFL LP++LKDRRIYG+LLNAY +   
Sbjct  128  MSNREERFRLTTSDAAIQLDLISKVRGIKSAEDYFLRLPDNLKDRRIYGALLNAYAKARQ  187

Query  594  REKAESLF  617
            REKAE+L 
Sbjct  188  REKAENLL  195



>ref|XP_004133941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 ref|XP_004169913.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 gb|KGN56639.1| hypothetical protein Csa_3G127020 [Cucumis sativus]
Length=537

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            HR +S  S I     F     +    + +  RR  L++TC SISQVHSYGTVD+E+RPM 
Sbjct  9    HRTVSLPSPISYSRKFLPLIQSQPFFHNVNYRRLPLSVTC-SISQVHSYGTVDFERRPMF  67

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY+RIS++E P+ G+++VLNQ E+EGK I++ EL  VV++LRK+ R   ALE+ +W
Sbjct  68   KWNAIYRRISLMENPELGSASVLNQWENEGKNITKWELSRVVKELRKYKRFERALEIYDW  127

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            M++R ER+++TTSD AIQLDLISKV GI +AE+YFL LPN LKDRRIYG+LLNAY +   
Sbjct  128  MSNREERFRLTTSDAAIQLDLISKVRGIKSAEEYFLRLPNHLKDRRIYGALLNAYAKGRQ  187

Query  594  REKAESLFD  620
            REKAE+L +
Sbjct  188  REKAENLLE  196



>ref|XP_011032472.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Populus euphratica]
Length=539

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  153  KGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRI  332
            K L +   SISQ+H+YGTVDYE+RPM  W  IY+RIS++E P+ G+ +VLNQ E+EGKR+
Sbjct  40   KKLPVIICSISQIHNYGTVDYERRPMIKWNGIYRRISLMENPELGSGSVLNQWENEGKRL  99

Query  333  SRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEK  512
            ++ EL  VV++LRK+ R+  ALEV +WM +R ER++++ SD AIQLDLI+KV G+S AE 
Sbjct  100  TKWELCRVVKELRKYKRYQQALEVYDWMKNRQERFRLSPSDAAIQLDLIAKVRGVSTAED  159

Query  513  YFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            +FL+LPN+ KDRR+YG+LLNAYV+  MREKAE+LFD
Sbjct  160  FFLSLPNTFKDRRVYGALLNAYVQNRMREKAETLFD  195



>ref|XP_006375170.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP52967.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  153  KGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRI  332
            K L +   SISQVH+YGTVDYE+RPM  W  IY+RIS++E P+ G+ +VLN+ E+EGKR+
Sbjct  40   KKLPVIICSISQVHNYGTVDYERRPMIKWNGIYRRISLMENPELGSGSVLNRWENEGKRL  99

Query  333  SRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEK  512
            ++ EL  VV++LRK+ R+  ALEV +WM +R ER++++ SD AIQLDLI+KV G+S AE 
Sbjct  100  TKWELCRVVKELRKYKRYQQALEVYDWMKNRQERFRLSPSDAAIQLDLIAKVRGVSTAED  159

Query  513  YFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            +FL+LPN+ KDRR+YG+LLNAYV+  MREKAE+LFD
Sbjct  160  FFLSLPNTFKDRRVYGALLNAYVQNRMREKAETLFD  195



>emb|CDY15126.1| BnaC05g00050D [Brassica napus]
Length=512

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
             P   S +  + PLK R    AI   SISQV+ YGTVDYE+RP+  W  IYK+IS++E P
Sbjct  22   LPRSRSPVVSVAPLKMR---TAIIVCSISQVYGYGTVDYERRPIIQWNAIYKKISLMEKP  78

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
            + GA++VLNQ E  G+++++ EL  VV++LRK+ R + ALEV +WMN R ER++++ SD 
Sbjct  79   ELGAASVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNKRDERFRLSASDA  138

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNAYVR   REKAE+L D
Sbjct  139  AIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNAYVRAKSREKAEALID  192



>gb|KHG14992.1| hypothetical protein F383_17735 [Gossypium arboreum]
Length=533

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  159  LAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            L ITC SISQVHSYGTVD+E+RPM  W  +YK+IS++E P+ G+++VLN+ E  G+++++
Sbjct  43   LPITC-SISQVHSYGTVDFERRPMVKWNALYKKISLMENPELGSASVLNEWEKGGRKLTK  101

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  VV++LRK+ R   ALEV EWMN+R ER++ + SD AIQLDLISKV G+S+AE +F
Sbjct  102  WELCRVVKELRKYKRFKQALEVYEWMNNRGERFRFSASDAAIQLDLISKVRGVSSAEDFF  161

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            L LP++LKD+RIYG+LLNAYVR  M+EKAESL D
Sbjct  162  LQLPDTLKDKRIYGALLNAYVRARMQEKAESLID  195



>ref|XP_009119759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Brassica rapa]
Length=512

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
             P   S +  + PLK   K  AI   SISQV+ YGTVDYE+RP+  W  IYK+IS++E P
Sbjct  22   LPRCRSPVVSVAPLK---KKTAIIVCSISQVYGYGTVDYERRPIIQWNAIYKKISLMEKP  78

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
            + GA++VLNQ E  G+++++ EL  VV++LRK+ R + ALEV +WMN R ER++++ SD 
Sbjct  79   ELGAASVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNKRGERFRLSASDA  138

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNAYVR   REKAE+L D
Sbjct  139  AIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNAYVRAKSREKAEALID  192



>emb|CDX90079.1| BnaA10g00030D [Brassica napus]
Length=512

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
             P   S +  + PLK   K  AI   SISQV+ YGTVDYE+RP+  W  IYK+IS++E P
Sbjct  22   LPRCRSPVVSVAPLK---KKTAIIVCSISQVYGYGTVDYERRPIIQWNAIYKKISLMEKP  78

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
            + GA++VLNQ E  G+++++ EL  VV++LRK+ R + ALEV +WMN R ER++++ SD 
Sbjct  79   ELGAASVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNKRGERFRLSASDA  138

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI KV GIS+AE++FL+LP++ KDRR+YGSLLNAYVR   REKAE+L D
Sbjct  139  AIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNAYVRAKSREKAEALID  192



>ref|XP_004307244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Fragaria vesca subsp. vesca]
Length=541

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 137/176 (78%), Gaps = 4/176 (2%)
 Frame = +3

Query  96   PFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMI-E  272
            P PS   +L+L   +  +R  L I+ +SISQVH+YGTVDYE+RP+  W  IY++IS++ +
Sbjct  23   PLPSKIPSLSLPRSINYQR--LTIS-SSISQVHNYGTVDYERRPIVKWNAIYRKISLLAD  79

Query  273  YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTS  452
             P+  AS+VLNQ E EGK++S+ EL  VV++LRKF R+  ALEV +WM +RAER++ ++S
Sbjct  80   DPELNASSVLNQWEKEGKKLSKWELCRVVKELRKFKRYGRALEVYDWMINRAERFRFSSS  139

Query  453  DTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            D AIQLDL+ KV G+S+AE YFL+LP++LKD+RIYG+LLNAYVR  M+EKAESL D
Sbjct  140  DAAIQLDLVGKVRGVSSAENYFLSLPDNLKDKRIYGALLNAYVRAKMQEKAESLLD  195



>ref|XP_006445447.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 ref|XP_006464406.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Citrus sinensis]
 gb|ESR58687.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 gb|KDO85468.1| hypothetical protein CISIN_1g009424mg [Citrus sinensis]
Length=535

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLP--FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRP  227
            H ++  S S    LP   P  F+ L   + +K +R+ L +   S+SQ+HSYGTVD+E+RP
Sbjct  10   HHKICLSQSRTQPLPCKIPRCFTRLHQQSAIKHQRQKLPVIKCSMSQIHSYGTVDFERRP  69

Query  228  MPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVC  407
            M  W  I++++S+++ PQ G+++VLN  E  G+ +++ EL  VV++LRKF R+  ALEV 
Sbjct  70   MIKWNAIFRKLSLMDNPQLGSASVLNDWEKGGRSLTKWELCRVVKELRKFRRYKHALEVY  129

Query  408  EWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  587
            +WMN+R ER++++ SD AIQLDLI+KVHG+++AE +FL+LP++LKDRR+YG+LLNAYVR 
Sbjct  130  DWMNNRGERFRLSASDAAIQLDLIAKVHGVASAEDFFLSLPDTLKDRRVYGALLNAYVRA  189

Query  588  GMREKAESLFD  620
             MR  AE L D
Sbjct  190  RMRGNAELLID  200



>ref|XP_010089787.1| hypothetical protein L484_008037 [Morus notabilis]
 gb|EXB38379.1| hypothetical protein L484_008037 [Morus notabilis]
Length=546

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = +3

Query  93   LPFPSGFSTLTLLNPLKSRRKGLAITCA-SISQVHSYGTVDYEKRPMPNWGIIYKRISMI  269
            LP+ +   +L+  +   +RR  L I C+ S SQ+HSYGTVDYE+RPM  W  IYKRIS++
Sbjct  26   LPYKAPSFSLSQCSVNHNRRLRLGIFCSISQSQIHSYGTVDYERRPMVKWNAIYKRISLM  85

Query  270  EYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITT  449
            E P+ G+ TVL+Q E EG+++S+ EL  VV++LRK+ R   ALEV +WMN+R ER+++++
Sbjct  86   EKPELGSGTVLSQWEREGRQLSKWELCRVVKELRKYKRFDRALEVYDWMNNRGERFRLSS  145

Query  450  SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            SD AIQLDLI KV GIS+AE +FL+L ++ KDRRIYG+LLNAYV+  M+EKAESL D
Sbjct  146  SDAAIQLDLIGKVRGISSAENFFLSLSDTSKDRRIYGALLNAYVQARMKEKAESLLD  202



>ref|XP_008232381.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Prunus mume]
Length=546

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
             P    TL L + +  +R   +I+C SISQVH+YGTVDYE+RPM  W  IY++IS+ + P
Sbjct  26   LPCKIPTLPLPSSINFQRLP-SISC-SISQVHNYGTVDYERRPMVKWNAIYRKISLTDDP  83

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
            +  ++ VLNQ E EG+++++ EL  VV++LRK+ R+  ALEV +WM++R ER++I+TSD 
Sbjct  84   EVRSADVLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGERFRISTSDA  143

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNAYVR  M+EKAESL D
Sbjct  144  AIQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVRTRMKEKAESLLD  197



>ref|XP_006418504.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
 gb|ESQ36857.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
Length=517

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA++VLNQ E  G++
Sbjct  36   KKKTAIVC-SISQVYGYGTVDYERRPIIQWNAIYKKISLMEKPELGAASVLNQWEKGGRK  94

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GIS+AE
Sbjct  95   LTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAE  154

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            ++FL+LP + KDRR+YGSLLNAYVR   REKAE+L D
Sbjct  155  EFFLSLPENFKDRRVYGSLLNAYVRAKSREKAEALID  191



>ref|XP_009375366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Pyrus x bretschneideri]
Length=534

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMP  233
            H     SSS+    P P    T TL   + +  K  AI C SISQVH+YGTVDYE+RPM 
Sbjct  10   HHNAILSSSLSYSRPLPCKIPTRTLPGSI-NFLKLPAIFC-SISQVHNYGTVDYERRPMV  67

Query  234  NWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
             W  IY++IS+ E P+  ++ VLNQ E EG+++++ EL  VV++LRK+ R+  ALEV +W
Sbjct  68   KWNAIYRKISLTEDPEVRSADVLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDW  127

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            M++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNAYV   M
Sbjct  128  MSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVWARM  187

Query  594  REKAESLFD  620
            +EKAE+L D
Sbjct  188  KEKAEALLD  196



>ref|XP_007052357.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX96514.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=549

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  126  LLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLN  305
            +L+  +S +K L +TC SISQ+HSYGTVDYE+RPM  W  IYK+IS++E P+ G+++VLN
Sbjct  33   ILSQTQSYQK-LPVTC-SISQIHSYGTVDYERRPMIKWNAIYKKISLMENPELGSASVLN  90

Query  306  QCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISK  485
            + E  G+++++ EL  VV++LRK+ R+  ALEV +WMN+R ER++++ SD AIQLDLI+K
Sbjct  91   EWEKGGRKLTKWELCRVVKELRKYKRYKQALEVYDWMNNRGERFRLSASDAAIQLDLIAK  150

Query  486  VHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            V G+S+AE +F+ LP+++KD+RIYG+LLNAYVR  MR+KAE+L D
Sbjct  151  VRGVSSAEDFFVQLPDTMKDKRIYGALLNAYVRAKMRDKAETLID  195



>ref|XP_007218971.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
 gb|EMJ20170.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
Length=546

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = +3

Query  102  PSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQ  281
            P    TL L + +  +R   +I+C SISQVH+YGTVDYE+RPM  W  IY++IS+ + P+
Sbjct  27   PCKIPTLPLPSSINFQRLP-SISC-SISQVHNYGTVDYERRPMVKWNAIYRKISLTDDPE  84

Query  282  KGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTA  461
              ++ VLNQ E EG+++++ EL  VV++LRK+ R+  ALEV +WM++R ER++I+TSD A
Sbjct  85   VRSADVLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEVYDWMSNRGERFRISTSDAA  144

Query  462  IQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            IQLDL++KV G+++AE YFL+LP++LKDRRIYG+LLNAYVR  M+EKAESL D
Sbjct  145  IQLDLVAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVRTRMKEKAESLLD  197



>ref|XP_006306047.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
 gb|EOA38945.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
Length=524

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA++VLNQ E  G++
Sbjct  36   KKTAAIVC-SISQVYGYGTVDYERRPIIQWNAIYKKISLMEKPELGAASVLNQWEKGGRK  94

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GIS+AE
Sbjct  95   LTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAE  154

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            ++FLTLP + KDRR+YGSLLNAYVR   REKAE+L +
Sbjct  155  EFFLTLPETFKDRRVYGSLLNAYVRAKSREKAEALLN  191



>ref|XP_002892022.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68281.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=523

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA++VLNQ E  G++
Sbjct  37   KKTAAIVC-SISQVYGYGTVDYERRPIVQWNAIYKKISLMEKPELGAASVLNQWEKGGRK  95

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GIS+AE
Sbjct  96   LTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAE  155

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ++FLTLP + KDRR+YGSLLNAYVR   REKAE+L 
Sbjct  156  QFFLTLPENFKDRRVYGSLLNAYVRAKSREKAEALL  191



>ref|XP_010496474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=521

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA +VLNQ E  G++
Sbjct  36   KKTAAIVC-SISQVYGYGTVDYERRPIIQWNAIYKKISLMEKPELGAGSVLNQWEKGGRK  94

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GIS+AE
Sbjct  95   LTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAE  154

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ++FLTLP + KDRR+YGSLLNAYVR   REKAESL 
Sbjct  155  EFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLL  190



>ref|XP_010479321.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Camelina sativa]
Length=559

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA +VLNQ E  G++
Sbjct  74   KKTAAIVC-SISQVYGYGTVDYERRPIIQWNAIYKKISLMEKPELGAGSVLNQWEKGGRK  132

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GIS+AE
Sbjct  133  LTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGISDAE  192

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ++FLTLP + KDRR+YGSLLNAYVR   REKAESL 
Sbjct  193  EFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLL  228



>ref|XP_008343643.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X2 [Malus domestica]
Length=421

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 137/192 (71%), Gaps = 8/192 (4%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTL---LNPLKSRRKGLAITCASISQVHSYGTVDYEKR  224
            H   + SSS+    P      T TL   +N LK     L     SISQVH+YGTVDYE+R
Sbjct  10   HHNATLSSSLFYTRPLLCKIPTGTLPGSINFLK-----LPTISCSISQVHNYGTVDYERR  64

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            PM  W  IY++IS+ E P+  ++ +LNQ E EG+++++ EL  VV++LRK+ R+  ALEV
Sbjct  65   PMVKWNAIYRKISLTEDPEVRSADMLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEV  124

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             +WM++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNAYVR
Sbjct  125  YDWMSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVR  184

Query  585  VGMREKAESLFD  620
              M++KAE+L +
Sbjct  185  ARMKQKAEALLE  196



>ref|NP_171717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q8LPS6.2|PPR3_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02150 
[Arabidopsis thaliana]
 gb|AAC24372.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE27393.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=524

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA++VLNQ E  G++
Sbjct  38   KKTAAIVC-SISQVYGYGTVDYERRPIVQWNAIYKKISLMEKPELGAASVLNQWEKAGRK  96

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + ALEV +WMN+R ER++++ SD AIQLDLI KV GI +AE
Sbjct  97   LTKWELCRVVKELRKYKRANQALEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDAE  156

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            ++FL LP + KDRR+YGSLLNAYVR   REKAE+L +
Sbjct  157  EFFLQLPENFKDRRVYGSLLNAYVRAKSREKAEALLN  193



>gb|KJB22842.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22843.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22844.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
Length=533

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  159  LAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            L + C SISQVHSYGTVD+E+RPM  W  +YK+IS++E P+ G+++VLN+ E  G+++++
Sbjct  43   LPVMC-SISQVHSYGTVDFERRPMVKWNALYKKISLMENPELGSASVLNEWEKGGRKLTK  101

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  VV++LRK+ R   ALEV EWMN+R ER++ + SD AIQLDLISKV G+S+AE +F
Sbjct  102  WELCRVVKELRKYKRFKQALEVYEWMNNRGERFRFSASDAAIQLDLISKVRGVSSAEDFF  161

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            L L ++LKD+RIYG+LLNAYVR  M+EKAESL D
Sbjct  162  LQLSDTLKDKRIYGALLNAYVRARMQEKAESLID  195



>gb|AAM19786.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
 gb|AAO64747.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
Length=524

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  RKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            +K  AI C SISQV+ YGTVDYE+RP+  W  IYK+IS++E P+ GA++VLNQ E  G++
Sbjct  38   KKTAAIVC-SISQVYGYGTVDYERRPIVQWNAIYKKISLMEKPELGAASVLNQWEKAGRK  96

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  VV++LRK+ R + A+EV +WMN+R ER++++ SD AIQLDLI KV GI +AE
Sbjct  97   LTKWELCRVVKELRKYKRANQAIEVYDWMNNRGERFRLSASDAAIQLDLIGKVRGIPDAE  156

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            ++FL LP + KDRR+YGSLLNAYVR   REKAE+L +
Sbjct  157  EFFLQLPENFKDRRVYGSLLNAYVRAKSREKAEALLN  193



>ref|XP_004515320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cicer arietinum]
Length=543

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  144  SRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEG  323
            S + G+++TC SIS++H+YGTVDYE+RP   W ++YKRIS+++ P+ G+++VLNQ E+EG
Sbjct  44   SYKGGVSVTC-SISKIHNYGTVDYERRPTVKWNVLYKRISLMDNPEFGSASVLNQWENEG  102

Query  324  KRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISN  503
            K +++ EL  VV++LRK+ +H  AL++ +W+N+R ER++I+ SD AIQLDLI++VHG+S+
Sbjct  103  KTLTKWELCRVVKELRKYRKHDRALQIYDWINNRPERFRISASDAAIQLDLIARVHGVSS  162

Query  504  AEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AE +FL L N LKD+R YG+LLNAYV    REKAESL D
Sbjct  163  AEGFFLNLVNDLKDKRTYGALLNAYVHSRSREKAESLLD  201



>gb|KEH18913.1| PPR containing plant protein [Medicago truncatula]
Length=300

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  159  LAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            +++TC SIS++H+YGT+DYE++P   W  IYKRISM++ P+ G+++VLNQ E+EG+ +++
Sbjct  78   VSVTC-SISKIHNYGTLDYERKPNLKWNAIYKRISMMQNPELGSASVLNQWENEGRNLTK  136

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  VV++LRK+ +H  AL+V +W+N+R ER++I+ SD AIQLDLI++VHG+S+AE +F
Sbjct  137  WELCRVVKELRKYRKHDRALQVYDWINNRPERFRISASDVAIQLDLIARVHGVSSAEGFF  196

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            L L N LKD+R YG+LLNAYV    REKAESL +
Sbjct  197  LNLTNDLKDKRTYGALLNAYVHSRSREKAESLLE  230



>ref|XP_008343638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X1 [Malus domestica]
Length=535

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 137/192 (71%), Gaps = 8/192 (4%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSGFSTLTL---LNPLKSRRKGLAITCASISQVHSYGTVDYEKR  224
            H   + SSS+    P      T TL   +N LK     L     SISQVH+YGTVDYE+R
Sbjct  10   HHNATLSSSLFYTRPLLCKIPTGTLPGSINFLK-----LPTISCSISQVHNYGTVDYERR  64

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            PM  W  IY++IS+ E P+  ++ +LNQ E EG+++++ EL  VV++LRK+ R+  ALEV
Sbjct  65   PMVKWNAIYRKISLTEDPEVRSADMLNQWEKEGRKLTKWELCRVVKELRKYKRYDRALEV  124

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             +WM++R ER++I+TSD AIQLDL +KV G+++AE YFL+LP++LKDRRIYG+LLNAYVR
Sbjct  125  YDWMSNRGERFRISTSDAAIQLDLFAKVRGVASAENYFLSLPDTLKDRRIYGALLNAYVR  184

Query  585  VGMREKAESLFD  620
              M++KAE+L +
Sbjct  185  ARMKQKAEALLE  196



>ref|XP_010246096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nelumbo nucifera]
Length=515

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  162  AITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRL  341
            +I+C SISQVH+YGTVDYE++P+  W  +Y+RIS++E P+ G+STVL+Q E EG+++S+ 
Sbjct  46   SISC-SISQVHNYGTVDYERKPVLKWNSLYRRISLMENPELGSSTVLDQWEKEGRKLSKW  104

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
             L  VV++LRKF R+  ALEV EWM ++ +R+++ +SD AIQLDLISKVHGIS AE YF 
Sbjct  105  VLSRVVKELRKFRRYKFALEVYEWMTNQGDRFRVASSDAAIQLDLISKVHGISTAEDYFS  164

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             LP +LKDRR YGSLLNAY +  MREKAE++ +
Sbjct  165  RLPETLKDRRTYGSLLNAYAQSKMREKAENVIE  197



>ref|XP_003520417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
Length=555

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  159  LAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            L++   SIS +HSYGTVDYE+RP+  W  +Y+RIS+ + PQ G++ VLNQ E+EG+ +++
Sbjct  53   LSVVTCSISNIHSYGTVDYERRPIVRWNDVYRRISLNQNPQVGSAEVLNQWENEGRHLTK  112

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  VV++LRK+ R   ALEV +WMN+R ER++++ SD AIQLDLI+KV G+S+AE +F
Sbjct  113  WELSRVVKELRKYKRFPRALEVYDWMNNRPERFRVSESDAAIQLDLIAKVRGVSSAEAFF  172

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            L+L + LKD+R YG+LLN YV    +EKAESLFD
Sbjct  173  LSLEDKLKDKRTYGALLNVYVHSRSKEKAESLFD  206



>ref|XP_003530115.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
 gb|KHN12244.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=546

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  AITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRL  341
             +T  SIS++HSYGTVDYE+RP+  W  +Y+RIS+   PQ G++ VLNQ E+EG+ +++ 
Sbjct  55   VVTTCSISKIHSYGTVDYERRPIVGWNDVYRRISLNPNPQVGSAEVLNQWENEGRHLTKW  114

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
            EL  VV++LRK+ R   ALEV +WMN+R ER++++ SD AIQLDLI+KV G+S+AE +FL
Sbjct  115  ELSRVVKELRKYKRFRRALEVYDWMNNRPERFRVSESDAAIQLDLIAKVRGLSSAEAFFL  174

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            +L + LKD++ YG+LLN YV    +EKAESLFD
Sbjct  175  SLEDKLKDKKTYGALLNVYVHSRSKEKAESLFD  207



>ref|XP_007134411.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
 gb|ESW06405.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
Length=542

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = +3

Query  99   FPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYP  278
            FP   S+ TL   L +R   L +   S+S+VHSYGTVDYE+RP+  W  +Y+RI++   P
Sbjct  25   FPFKLSSSTLPFAL-TRATCLPLITCSVSKVHSYGTVDYERRPIVRWNEVYRRITLNPDP  83

Query  279  QKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
               ++ VLN+ E+EGK +++ EL  VV++LRK+ +   ALEV +W+N+R ER++++ SD 
Sbjct  84   DMSSAEVLNRWENEGKHLTKWELSRVVKELRKYKKFRRALEVYDWINNRPERFRVSESDA  143

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI+KV G S+AE +FL+L + LK++R YG+LLN YV   ++EKAESLFD
Sbjct  144  AIQLDLIAKVRGFSSAEVFFLSLEDQLKNKRTYGALLNVYVHSRLKEKAESLFD  197



>gb|EPS66397.1| hypothetical protein M569_08380, partial [Genlisea aurea]
Length=447

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +3

Query  165  ITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLE  344
            +TC+S S   S G VDYE RP  +W  I KRIS     ++G  TVLNQ E +G+ ++R E
Sbjct  1    VTCSSFSTRDS-GIVDYESRPSRSWSAICKRISESGSEERGVFTVLNQAEKDGRYLTRWE  59

Query  345  LLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLT  524
            L  + ++LRKF R+  ALEV +WMN+R ER++ITTSDTAI+LDLI+KVHGI +AE YF  
Sbjct  60   LCRIAKELRKFRRYKFALEVFDWMNNRPERFRITTSDTAIRLDLIAKVHGIPSAESYFSR  119

Query  525  LPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            L + LKD+RIYGSLLN Y R  MRE+AE+L D
Sbjct  120  LTDELKDKRIYGSLLNVYARAKMREEAETLMD  151



>ref|XP_010540211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Tarenaya hassleriana]
Length=561

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 127/190 (67%), Gaps = 8/190 (4%)
 Frame = +3

Query  54   HRRLSFSSSIPNLLPFPSG--FSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRP  227
            H  LS + S+   LP PS   FS   L      RR+          +V+ YGTVDYE+RP
Sbjct  31   HWNLSPAPSVSYPLPSPSSAPFSVALLW-----RRRRPKPGVVGSGEVYGYGTVDYERRP  85

Query  228  MPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVC  407
            +  W  +YK +S+ + P  GA++VL+  E  G+++++ EL  VV++LRK+ RH LAL+V 
Sbjct  86   IIQWNALYKNLSL-QNPDLGAASVLDLWEKRGRKLTKWELCRVVKELRKYKRHFLALQVY  144

Query  408  EWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  587
            +WM++R ER++++ SD AIQLDLI KV GIS+AE  FL LP++ KDRR+YG+LLNAYVR 
Sbjct  145  DWMSNRGERFRLSASDAAIQLDLIGKVRGISSAEDVFLRLPDNFKDRRVYGALLNAYVRA  204

Query  588  GMREKAESLF  617
              REKAE+L 
Sbjct  205  KSREKAEALI  214



>ref|XP_010933566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Elaeis guineensis]
Length=508

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = +3

Query  51   LHRRLSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPM  230
            L R L  +SS  + +P   G S L+L    KS   G  I C S+SQVHSYGTVD E+ P 
Sbjct  14   LQRYLRSTSSSYSQVPLGFGSSALSLWADQKS---GGPIRC-SVSQVHSYGTVDPERPPA  69

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
              W  + +RIS +E P  G + VL + E+E +R+ + EL  VV++LRKF R  LALEVC+
Sbjct  70   LKWSSLARRISAMENPSLGCAAVLERWEEEERRLHKWELCRVVKELRKFRRFKLALEVCD  129

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM  + +R+  T+SD AIQLDLI+K HGIS AE++F  LP++LKD+R YG+LLN Y R  
Sbjct  130  WMTAQGDRFMFTSSDMAIQLDLIAKAHGISRAEEHFSQLPDTLKDKRTYGALLNVYGRAK  189

Query  591  MREKAESLFD  620
            M+EKAE++ +
Sbjct  190  MKEKAEAIVE  199



>ref|XP_010919766.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Elaeis guineensis]
Length=506

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  108  GFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKG  287
            GF   T+   +  +  GL I C SISQVHSYGTVDYE+RP   W  +Y+RI+ +E P  G
Sbjct  30   GFGPSTVSLRVDQKPGGL-IRC-SISQVHSYGTVDYERRPALRWSSLYRRIATMENPSVG  87

Query  288  ASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQ  467
            ++ VL + E+E +R+++ EL  +V++LRKF R  LALEV +WM  + ER+  T+SD AIQ
Sbjct  88   SAAVLERWEEEERRLNKWELCRLVKELRKFRRFKLALEVYDWMTAQGERFTFTSSDMAIQ  147

Query  468  LDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            LDLI+KVHGIS+AE++F  LP++ KDRR YG+LLN Y R  M+EKAE + +
Sbjct  148  LDLIAKVHGISHAEEHFSKLPDTFKDRRAYGALLNVYGRAKMKEKAEDIVE  198



>ref|XP_008786192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=508

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 125/186 (67%), Gaps = 4/186 (2%)
 Frame = +3

Query  63   LSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWG  242
            LS S+S  +      G STL+L    KS   G  I C S+SQVHSYGTVD E+ P   W 
Sbjct  19   LSTSTSSYSQARLGFGSSTLSLRADQKS---GGPIRC-SVSQVHSYGTVDSERPPALRWS  74

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
             +++RIS  E    G + VL + E+E  ++++ EL  VV++LRKF R  LALEVC+WM  
Sbjct  75   SLFRRISARENTSLGCAAVLLRWEEEEGQLNKWELCRVVKELRKFRRVKLALEVCDWMIA  134

Query  423  RAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
            + +R+  T+SD AIQ+DLI+K HGIS+AE+YF  LP+++KD+R YG+LLN Y +  M+EK
Sbjct  135  QGDRFMFTSSDMAIQVDLIAKAHGISHAEEYFSQLPDTMKDKRTYGALLNVYGQAKMKEK  194

Query  603  AESLFD  620
            AE++ +
Sbjct  195  AEAIVE  200



>emb|CDP09418.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  276  PQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSD  455
            P+KG+++VLNQ E+EGK++++ EL  VV++LRKF R +LALEV EWMN+R ER++I+TSD
Sbjct  4    PKKGSASVLNQWENEGKKLTKWELSRVVKELRKFKRFNLALEVYEWMNNREERFRISTSD  63

Query  456  TAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            TAIQLDLISKVHGIS+AE YFL LP+ LKD+RIYG+LLNAY R   +E+AESL D
Sbjct  64   TAIQLDLISKVHGISSAEDYFLKLPDPLKDKRIYGALLNAYGRARKKEEAESLMD  118



>ref|XP_008794909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=507

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +3

Query  147  RRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGK  326
            ++ G  I C SISQV+SYGTVDYE+RP   W  +Y+RI+ +E P  G + VL + E+E +
Sbjct  42   QKPGGPIRC-SISQVNSYGTVDYERRPALKWSSLYRRIATMENPSLGPAAVLERWEEEER  100

Query  327  RISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNA  506
            R+++ EL  VV++LRKF R  LALEV +WM  + +R+  T+SD AIQLDLI+KVHGI +A
Sbjct  101  RLNKWELCRVVKELRKFRRFKLALEVYDWMTAQRDRFTFTSSDMAIQLDLIAKVHGILHA  160

Query  507  EKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            E++F  LP++LKD+R YG+LLN Y +  M+EKAE + +
Sbjct  161  EEHFSKLPDTLKDKRAYGALLNVYGQAKMKEKAEDIIE  198



>ref|XP_006838525.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
 gb|ERN01094.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
Length=390

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 120/178 (67%), Gaps = 5/178 (3%)
 Frame = +3

Query  87   NLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISM  266
             L P+   F  +T L P+ +R     ++ ASISQVH+YGTVD+E++P   W  +YKRIS+
Sbjct  12   QLPPYFFSFCNITHLQPINTRTS--IVSSASISQVHNYGTVDFERKPPVQWNHLYKRISL  69

Query  267  IEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKIT  446
                  G+  VL +   +G++IS+ EL  + ++LRKF R +LAL+V EWM  + E++ ++
Sbjct  70   ---SGLGSGEVLEEWMMQGRKISKWELRRISKELRKFRRFYLALQVYEWMISKGEKFTLS  126

Query  447  TSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            +SD AIQLDL++KVHG+S+AE  F+ L +  K+ R YG++L+ Y +   REKAE++F+
Sbjct  127  SSDIAIQLDLVAKVHGMSSAEDIFVKLSDFQKNERTYGAILHVYSQSKEREKAETIFE  184



>emb|CBI16683.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  267  IEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKIT  446
            +E P+ G+++VLNQ E+EGKR+++ EL  VV++LRKF R  +ALEV EWMN+R ER++++
Sbjct  1    MENPEMGSASVLNQWENEGKRLTKWELCRVVKELRKFKRFKMALEVYEWMNNRGERFRLS  60

Query  447  TSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            +SD AIQLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNAYV+  MR+KAE L +
Sbjct  61   SSDAAIQLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNAYVQAKMRDKAEILIE  118



>ref|XP_010496689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=447

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  267  IEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKIT  446
            +E P+ GA +VLNQ E  G+++++ EL  VV++LRK+ R + ALEV +WMN+R ER++++
Sbjct  1    MEKPELGAGSVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEVYDWMNNRGERFRLS  60

Query  447  TSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
             SD AIQLDLI KV GIS+AE++FLTLP + KDRR+YGSLLNAYVR   REKAESL 
Sbjct  61   ASDAAIQLDLIGKVRGISDAEEFFLTLPENFKDRRVYGSLLNAYVRAKSREKAESLL  117



>dbj|BAJ85010.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            ++ VHSYGTVD+E+RP   W  +Y+R+++    +    T+ +  E E +R+ + EL  + 
Sbjct  48   VANVHSYGTVDFERRPALRWSSLYRRVAVGHGGRPVGRTLADWDEGE-RRLDKWELCRIA  106

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LALEV +WM DR +R+ +++SD AIQLDLI+KV G+ +AE+YF  LP+ L
Sbjct  107  RELRKFRRFNLALEVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDAEEYFEKLPDPL  166

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK E  F+
Sbjct  167  KDKRTYGSLLNVYAQARMKEKTEYTFE  193



>ref|XP_006652599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Oryza brachyantha]
Length=511

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYGT+DYE+R    W  +Y+RI++    + G  T+    E E +R+ + EL  + 
Sbjct  56   VAKVHSYGTLDYERRAALRWSSLYRRIAVGHGGRPGGRTLAGGDEGE-RRLDKWELCRIS  114

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+++AE+YF  LP+ L
Sbjct  115  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVAHAEEYFEELPDPL  174

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK ES F+
Sbjct  175  KDKRTYGSLLNVYAQAMMKEKTESTFE  201



>ref|XP_002448264.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
 gb|EES12592.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
Length=515

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYG VDYE+RP   W  +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  60   VAKVHSYGAVDYERRPPLRWSTLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  118

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            ++LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AEKYF  LP+++
Sbjct  119  KELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEKYFDELPDAM  178

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK E  F+
Sbjct  179  KDKRTYGSLLNVYAQAMMKEKTEDTFE  205



>ref|XP_004956425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Setaria italica]
Length=513

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYGTVDYE+R    WG +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  58   VAKVHSYGTVDYERRAPLRWGTLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  116

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            ++LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AEKYF  LP+ L
Sbjct  117  KELRKFRRFNLALQVYDWMTERRDRFPLSSSDMAIQLDLIAKVRGVSHAEKYFEELPDPL  176

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M++K E  F+
Sbjct  177  KDKRTYGSLLNVYAQAMMKDKTEDTFE  203



>ref|NP_001168310.1| hypothetical protein [Zea mays]
 gb|ACN27772.1| unknown [Zea mays]
 tpg|DAA36624.1| TPA: hypothetical protein ZEAMMB73_688721 [Zea mays]
Length=513

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYGTVDYE+R    WG +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  58   VAKVHSYGTVDYERRSPLRWGTLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  116

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            ++LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+ +AEKYF  LP+++
Sbjct  117  KELRKFRRFNLALQVYDWMTERRDRFPLSSSDMAIQLDLIAKVRGVPHAEKYFDELPDAM  176

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK E  F+
Sbjct  177  KDKRTYGSLLNVYAQAMMKEKTEETFE  203



>dbj|BAK02297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            ++ VHSYGTVD+E+RP   W  +Y+R+++    +    T+ +  E E +R+ + EL  + 
Sbjct  48   VANVHSYGTVDFERRPALRWSSLYRRVAVGHGGRPVGRTLADWDEGE-RRLDKWELCRIA  106

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LALEV +WM DR +R+ +++SD AIQLDLI+KV G+ + E+YF  LP+ L
Sbjct  107  RELRKFRRFNLALEVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDTEEYFEKLPDPL  166

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK E  F+
Sbjct  167  KDKRTYGSLLNVYAQARMKEKTEYTFE  193



>emb|CAE04345.1| OSJNBb0038F03.9 [Oryza sativa Japonica Group]
Length=511

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYG +DYE+R    W  +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  56   VAKVHSYGALDYERRAALRWSSLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  114

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ L
Sbjct  115  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPL  174

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK ES F+
Sbjct  175  KDKRTYGSLLNVYAQAMMKEKTESTFE  201



>gb|EAY95037.1| hypothetical protein OsI_16851 [Oryza sativa Indica Group]
Length=511

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYG +DYE+R    W  +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  56   VAKVHSYGALDYERRAALRWSSLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  114

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ L
Sbjct  115  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPL  174

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK ES F+
Sbjct  175  KDKRTYGSLLNVYAQAMMKEKTESTFE  201



>ref|NP_001053460.2| Os04g0544400 [Oryza sativa Japonica Group]
 dbj|BAF15374.2| Os04g0544400 [Oryza sativa Japonica Group]
Length=571

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYG +DYE+R    W  +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  56   VAKVHSYGALDYERRAALRWSSLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  114

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ L
Sbjct  115  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPL  174

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK ES F+
Sbjct  175  KDKRTYGSLLNVYAQAMMKEKTESTFE  201



>ref|XP_010227218.1| PREDICTED: uncharacterized protein LOC100829762 [Brachypodium 
distachyon]
Length=987

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            ++ VHSYGTVD+E+R    W  +Y+RI+ + + ++     L   ++  +R+ + EL  V 
Sbjct  532  VANVHSYGTVDFERRKALRWSSLYRRIA-VGHGRRPVGRTLADWDEGERRLDKWELCRVA  590

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDL++KV G+ +AE+YF +LP+ L
Sbjct  591  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLVAKVRGVPHAEEYFESLPDPL  650

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK E  F+
Sbjct  651  KDKRTYGSLLNVYAQARMKEKTEDTFE  677



>gb|EEC77735.1| hypothetical protein OsI_16848 [Oryza sativa Indica Group]
Length=1300

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            +++VHSYG +DYE+R    W  +Y+RI+ + +  +     L   ++  +R+ + EL  + 
Sbjct  56   VAKVHSYGALDYERRAALRWSSLYRRIA-VGHGGRPVGRTLGAWDEGERRLDKWELCRIA  114

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            R+LRKF R +LAL+V +WM +R +R+ +++SD AIQLDLI+KV G+S+AE+YF  LP+ L
Sbjct  115  RELRKFRRFNLALQVYDWMTERRDRFSLSSSDMAIQLDLIAKVRGVSHAEEYFEELPDPL  174

Query  540  KDRRIYGSLLNAYVRVGMREKAESLFD  620
            KD+R YGSLLN Y +  M+EK ES F+
Sbjct  175  KDKRTYGSLLNVYAQAMMKEKTESTFE  201



>gb|EAZ31514.1| hypothetical protein OsJ_15655 [Oryza sativa Japonica Group]
Length=531

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 100/174 (57%), Gaps = 35/174 (20%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLE-----  344
            +++VHSYG +DYE+R    W  +Y+RI++    +    T+     DEG+R  RL+     
Sbjct  56   VAKVHSYGALDYERRAALRWSSLYRRIAVGHGGRPVGRTL--GAWDEGER--RLDKWSSA  111

Query  345  ----------------------LLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDT  458
                                  ++FV+     F  H LA +V +WM +R +R+ +++SD 
Sbjct  112  ASRGSCASSAASTSGSRSSYSRMMFVI----SFHTHSLAKDVYDWMTERRDRFSLSSSDM  167

Query  459  AIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            AIQLDLI+KV G+S+AE+YF  LP+ LKD+R YGSLLN Y +  M+EK ES F+
Sbjct  168  AIQLDLIAKVRGVSHAEEYFEELPDPLKDKRTYGSLLNVYAQAMMKEKTESTFE  221



>ref|XP_006849761.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
 gb|ERN11342.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
Length=501

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = +3

Query  171  CASISQVHSYGTVDYE-KRPMP------NWGIIYKRISMIEYPQKGASTVLNQCEDEGKR  329
            C SI+ +    +VD E  +P+P      +W  +Y+RI ++      +S+VL +   EGK 
Sbjct  53   CKSITALSVSVSVDGECDKPLPHRPVSSDWESLYRRIQLLGSQSIMSSSVLEEWIREGKP  112

Query  330  ISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAE  509
            +++ EL  + R+LR+  R   ALEV +W+     +Y++ + D AI LDLISKV+G  +AE
Sbjct  113  LAKWELRNITRQLRQNSRFKQALEVSDWLIQHGTKYQLRSGDYAIHLDLISKVNGPHHAE  172

Query  510  KYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
            +YFL LP  +K++  Y +LLN YV+  M+E+AE+
Sbjct  173  RYFLQLPKGMKNKLTYSALLNVYVKENMKERAET  206



>ref|XP_008344410.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Malus domestica]
Length=537

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 3/80 (4%)
 Frame = +3

Query  390  LALEVC---EWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYG  560
            L +E C   +WM++R ER++I+TSD AIQLDL++KV G+++AE YFL+LP +LKDRRIYG
Sbjct  119  LIIEGCMVYDWMSNRGERFRISTSDAAIQLDLVAKVRGVASAENYFLSLPGTLKDRRIYG  178

Query  561  SLLNAYVRVGMREKAESLFD  620
            +LLNAYVR  M+EKAE+L D
Sbjct  179  ALLNAYVRARMKEKAEALLD  198



>emb|CAN75355.1| hypothetical protein VITISV_002476 [Vitis vinifera]
Length=736

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = +3

Query  63   LSFSSSIPNLLPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWG  242
            L F+ S P L    SGF + TL   +  R+   +ITC SISQ+HSYGTVDYE+RP+  W 
Sbjct  3    LQFTIS-PPLHQQLSGFPSFTLPRSVNYRKH--SITC-SISQIHSYGTVDYERRPLVKWN  58

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
             +Y+RIS++E P+ G+++VLNQ E+EGKR+++ EL  VV++LRKF R  +ALE+
Sbjct  59   AVYRRISLMENPEMGSASVLNQWENEGKRLTKWELCRVVKELRKFKRFKMALEL  112


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  399  EVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  578
            +V EWMN+R ER+++++SD AIQLDLI+KV G+S+AE YF  LP++LKD+RIYG+LLNAY
Sbjct  320  KVYEWMNNRGERFRLSSSDAAIQLDLIAKVCGVSSAEDYFSRLPDTLKDKRIYGALLNAY  379

Query  579  VRVGMREKAESLFD  620
            V+  MR+KAE L +
Sbjct  380  VQAKMRDKAEILIE  393



>ref|XP_007052358.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 ref|XP_007052359.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96515.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96516.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=420

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  402  VCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  581
            V +WMN+R ER++++ SD AIQLDLI+KV G+S+AE +F+ LP+++KD+RIYG+LLNAYV
Sbjct  2    VYDWMNNRGERFRLSASDAAIQLDLIAKVRGVSSAEDFFVQLPDTMKDKRIYGALLNAYV  61

Query  582  RVGMREKAESLFD  620
            R  MR+KAE+L D
Sbjct  62   RAKMRDKAETLID  74



>emb|CBI21839.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RI  +  P+   S +LNQ  +EG+ +S+ +L  +VR ++ F R H ALE+ +WM DR
Sbjct  24   LYDRIQAVRDPKASISPLLNQWIEEGQTVSKPQLQSLVRIMKDFRRFHHALEISQWMTDR  83

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +T SD AI+LDLIS VHG   AE YF  +PN+LK    YG+LL+ YVR    EKA
Sbjct  84   -RYFTLTPSDAAIRLDLISMVHGRVQAESYFNNIPNNLKTSSAYGALLSGYVREKSVEKA  142

Query  606  ES  611
            E+
Sbjct  143  EA  144



>gb|KJB50098.1| hypothetical protein B456_008G153900 [Gossypium raimondii]
Length=507

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+S   +P+     VLNQ  +EGK I +  L  ++R LR FGR   ALEV E+M++   R
Sbjct  45   RVSRSGHPKASIVPVLNQWLEEGKAIKQSMLHTIIRHLRSFGRFKQALEVSEFMSEEM-R  103

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
            Y I+  D A++LDLISKVHGI  AEKYF +LP++++  ++YG+LLN Y      EKAE+
Sbjct  104  YGISVGDMAVRLDLISKVHGIEQAEKYFDSLPDTMRTFQVYGALLNCYAHHKCLEKAEA  162



>ref|XP_003636175.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=790

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 108/213 (51%), Gaps = 45/213 (21%)
 Frame = +3

Query  87   NLLPFPSGFSTLTLLNPLKSRRKGLAIT-CASI----SQVHSYGTVD-YEKRPMPNWGII  248
            +LLP  SGF       P K  R+   I+ C ++    SQ  S   V  Y  RP+   G +
Sbjct  167  DLLPTDSGF-------PFKFSRRQFPISLCFAMTINKSQGQSLSKVGLYLPRPVFTHGQL  219

Query  249  YKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVR----------------------  362
            Y  +S +   +KG   ++   ++E     +L +LF+ R                      
Sbjct  220  YVAVSRVT-TKKGLKMLI--FDEEAIHAPQLSMLFIRRCFLICRNSLIRFIWLYFLVSNN  276

Query  363  -------KLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
                      K   +   L+V +WMN+R ER++I+ SD AIQLDLI++VHG+S+AE +FL
Sbjct  277  VLISATNDFMKVMTNEHVLQVYDWMNNRPERFRISASDVAIQLDLIARVHGVSSAESFFL  336

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             L N LKD+R YG+LLNAYV    REKAESL +
Sbjct  337  NLTNDLKDKRTYGALLNAYVHSRSREKAESLLE  369



>ref|XP_010272479.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=502

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P+   +Y+RI++   P+     VL +  DEG+ ++++EL  ++RKL+   +   ALE+ +
Sbjct  30   PSPDSLYERIAVTGDPKISVVPVLEKWVDEGRSVNKVELNLLIRKLKFLRKFKHALEISQ  89

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM +R   ++++ SD A++LDLISKVHG+ +AEKYF ++ N LK  + YG+LLN YVR  
Sbjct  90   WMTNR-RYFELSPSDAAMRLDLISKVHGLEHAEKYFASISNKLKALKTYGALLNCYVREK  148

Query  591  MREKAESL  614
              EKAE+L
Sbjct  149  SVEKAEAL  156



>ref|XP_002273904.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, 
mitochondrial [Vitis vinifera]
Length=968

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RI  +  P+   S +LNQ  +EG+ +S+ +L  +VR ++ F R H ALE+ +WM DR
Sbjct  24   LYDRIQAVRDPKASISPLLNQWIEEGQTVSKPQLQSLVRIMKDFRRFHHALEISQWMTDR  83

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +T SD AI+LDLIS VHG   AE YF  +PN+LK    YG+LL+ YVR    EKA
Sbjct  84   -RYFTLTPSDAAIRLDLISMVHGRVQAESYFNNIPNNLKTSSAYGALLSGYVREKSVEKA  142

Query  606  ES  611
            E+
Sbjct  143  EA  144


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDL  476
             L Q   EG+ I + +L  ++RKLR F R++ ALE+ EW+ D+   + I+  D AIQLDL
Sbjct  523  ALEQWRKEGRSIKQQDLHRLIRKLRTFKRYNHALEIYEWIRDKF-YFDISPGDVAIQLDL  581

Query  477  ISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ISKVHG+  AEKYF   PNSL+  ++YG+LLN Y +    EKAE++ 
Sbjct  582  ISKVHGLEQAEKYFNETPNSLRSFQVYGALLNCYSQKKSLEKAEAIM  628



>ref|XP_003636171.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|KEH17918.1| PPR containing protein, putative [Medicago truncatula]
Length=132

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +3

Query  159  LAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            +++TC SIS++H+YGT+DYE++P   W  IYKRISM+E P+ G+++VLNQ E+EG+ +++
Sbjct  51   VSVTC-SISKIHNYGTLDYERKPNLKWNAIYKRISMMENPELGSASVLNQWENEGRNLTK  109

Query  339  LELLFVVRKLRKFGRHHLALEV  404
             EL  VV++LRK+ RH  AL+V
Sbjct  110  WELCRVVKELRKYRRHDRALQV  131



>ref|NP_001151760.1| tetratricopeptide-like helical [Zea mays]
 gb|ACG44244.1| tetratricopeptide-like helical [Zea mays]
 gb|ACN25152.1| unknown [Zea mays]
 gb|AFW56577.1| Tetratricopeptide-like helical [Zea mays]
Length=501

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + YP++ A  VL +  DEG+ + + +L  VVR+LRK+GR   ALE+CEWM  + E
Sbjct  35   KRLLKLIYPKRSAVVVLQRWADEGRTVQKYQLNRVVRELRKYGRFKHALEICEWMRTQPE  94

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+++A K+F  +P   K      +LL+AYV+ G REKAE+
Sbjct  95   -MRLLPGDHAVHLDLVAKVRGLASATKFFEDMPERAKGPSTCNALLHAYVQNGAREKAEA  153

Query  612  LF  617
            + 
Sbjct  154  ML  155



>ref|XP_009357846.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=514

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 84/130 (65%), Gaps = 1/130 (1%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P +  +Y RIS    P+     +LNQ  +EG+ + + EL  +++  RK+ R+  AL++ E
Sbjct  34   PPFEPLYIRISRAGNPRVSVVPILNQWVEEGRGVKKWELQSLIKLFRKYRRYSHALQISE  93

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM+D   +Y +T  D A++LDLISKVH +  AE YF ++P+ L++ ++YG+LL +YV   
Sbjct  94   WMSDARNQY-LTPGDIAVRLDLISKVHSLQQAEAYFNSIPDQLRNFKVYGALLFSYVENK  152

Query  591  MREKAESLFD  620
              EKAE++F+
Sbjct  153  SSEKAETIFE  162



>ref|XP_009342634.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g20710, mitochondrial-like [Pyrus x bretschneideri]
Length=412

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS    P+     +LNQ  DEG+ + + EL   ++  RK  R+  AL++ EWM+D 
Sbjct  39   LYVRISRARNPRVSIVPILNQWVDEGRDVKKWELQSFIKLFRKHRRYSHALQISEWMSDA  98

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              +Y +T  D A++LDLISKV+ +  AE YF ++P+ L++ ++YG+LL +YV     EKA
Sbjct  99   QNQY-LTPGDIAVRLDLISKVYSLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKA  157

Query  606  ESLFD  620
            E++F+
Sbjct  158  ETIFE  162



>ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica]
 gb|EMJ00101.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica]
Length=467

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 1/130 (1%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P +  +Y RIS    P+   + VL+Q  +EG+ +++ EL   V+ LRK+ R+  AL++ E
Sbjct  34   PPFETLYHRISRAGNPRVSIAPVLDQWVEEGRDVNKSELQSFVKMLRKYRRYSHALQISE  93

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM+D A  Y ++  D AI+LDLISKV G+  AE YF +LP+ L++ ++YG+LL   V   
Sbjct  94   WMSD-ARNYDLSHGDIAIRLDLISKVCGLEQAEMYFNSLPDPLRNFKVYGALLFCSVEHK  152

Query  591  MREKAESLFD  620
              EKAE+LF+
Sbjct  153  SLEKAENLFE  162



>ref|XP_004146883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004166436.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Cucumis sativus]
Length=474

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 79/133 (59%), Gaps = 2/133 (2%)
 Frame = +3

Query  219  KRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLAL  398
            + P  N   +Y R+S +       +  +NQ   EG  + + EL   +++LRK+ R+H  L
Sbjct  2    RSPANNQRGLYPRLSALGATGGSVAKTINQFIMEGNIVKKYELEKCIKELRKYRRYHHCL  61

Query  399  EVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  578
            ++ EWM  R   Y  T  D A++LDLISKV+G++ AEKYF  LP S K+R  YG+LLN Y
Sbjct  62   QIMEWMETRKINYSFT--DYALRLDLISKVNGVTAAEKYFYDLPPSAKNRCTYGALLNCY  119

Query  579  VRVGMREKAESLF  617
             +  M EKA +LF
Sbjct  120  CKEMMEEKALTLF  132



>gb|KGN53198.1| Pentatricopeptide repeat-containing protein [Cucumis sativus]
Length=498

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 86/154 (56%), Gaps = 10/154 (6%)
 Frame = +3

Query  156  GLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRIS  335
            G    C S++++         + P  N   +Y R+S +       +  +NQ   EG  + 
Sbjct  13   GFRQLCTSLNELM--------RSPANNQRGLYPRLSALGATGGSVAKTINQFIMEGNIVK  64

Query  336  RLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKY  515
            + EL   +++LRK+ R+H  L++ EWM  R   Y  T  D A++LDLISKV+G++ AEKY
Sbjct  65   KYELEKCIKELRKYRRYHHCLQIMEWMETRKINYSFT--DYALRLDLISKVNGVTAAEKY  122

Query  516  FLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            F  LP S K+R  YG+LLN Y +  M EKA +LF
Sbjct  123  FYDLPPSAKNRCTYGALLNCYCKEMMEEKALTLF  156



>ref|XP_002442234.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
 gb|EES16072.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
Length=501

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + YP++ A  VL +  +EG+ + + +L  VVR+LRK+GR   ALE+CEWM  R E
Sbjct  34   KRLLKLIYPKRSAVVVLRRWAEEGRTVEKYQLNRVVRELRKYGRFKHALEICEWMRTRPE  93

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+++A K+F  +P   K      +LL+AYV+ G REKAE+
Sbjct  94   -MRLLPGDHAVHLDLVAKVRGLASAVKFFEDMPERAKAPSTCNALLHAYVQHGAREKAEA  152

Query  612  LF  617
            + 
Sbjct  153  MM  154



>ref|XP_006840468.1| hypothetical protein AMTR_s00045p00181820 [Amborella trichopoda]
 gb|ERN02143.1| hypothetical protein AMTR_s00045p00181820 [Amborella trichopoda]
Length=479

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +    K A   L +   EGK + + E+  ++++LRKF R H ALE+ EWM+ R
Sbjct  59   LYRRLSALGDSSKSAGQELTRWVGEGKAVKKWEIERIIKELRKFKRFHHALELSEWMDKR  118

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                 ++  D AI++DL+SK  G+ +AE YF  LP+S K++  YG+LLN Y +  + EKA
Sbjct  119  G--MNLSYGDYAIRVDLLSKTRGLESAESYFTGLPHSAKNQYSYGALLNCYCKDKLTEKA  176

Query  606  ESLF  617
            E+LF
Sbjct  177  EALF  180



>emb|CBI21840.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDL  476
             L Q   EG+ I + +L  ++RKLR F R++ ALE+ EW+ D+   + I+  D AIQLDL
Sbjct  54   ALEQWRKEGRSIKQQDLHRLIRKLRTFKRYNHALEIYEWIRDKF-YFDISPGDVAIQLDL  112

Query  477  ISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ISKVHG+  AEKYF   PNSL+  ++YG+LLN Y +    EKAE++ 
Sbjct  113  ISKVHGLEQAEKYFNETPNSLRSFQVYGALLNCYSQKKSLEKAEAIM  159



>ref|XP_010108201.1| hypothetical protein L484_014527 [Morus notabilis]
 gb|EXC18126.1| hypothetical protein L484_014527 [Morus notabilis]
Length=494

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+RIS +  P      +L Q   EGK +S++EL  ++++LR F R H ALE+ +WM+D+
Sbjct  59   LYRRISPVGNPNVSVVPILEQWVQEGKPVSQIELQRIIKELRIFKRFHHALEISQWMSDK  118

Query  426  AERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
              RY  ++T D A +LDLISKVHG+  A  YF  +P +LK   +Y +LLN Y      EK
Sbjct  119  --RYMHLSTKDVAARLDLISKVHGLDEAVNYFNDIPAALKIFEVYSTLLNCYANEKSVEK  176

Query  603  AESLF  617
            AE + 
Sbjct  177  AEEIM  181



>ref|XP_008451368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Cucumis melo]
Length=531

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 84/123 (68%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + +P++ A   + + ++EG  I + EL  +VR+LRK  R+  ALEVCEWM  + +
Sbjct  52   RRLMSLIFPKRSAVIAIRKWQEEGHTIRKYELNHIVRELRKLKRYKHALEVCEWMTLQKD  111

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+QLDLI+K+ G+++AEK+F  LP+ ++++ +  +LL+AYV+  + EKAE+
Sbjct  112  -MKLLPGDYAVQLDLIAKIRGLNSAEKFFEDLPDKIREQSVCTALLHAYVQKNLSEKAEA  170

Query  612  LFD  620
            L +
Sbjct  171  LME  173



>emb|CDP17058.1| unnamed protein product [Coffea canephora]
Length=507

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 92/170 (54%), Gaps = 6/170 (4%)
 Frame = +3

Query  120  LTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWG---IIYKRISMIEYPQKGA  290
            + L N    +RK   I   ++++  S   V+ EK      G    +YKR+S +   +   
Sbjct  1    MMLKNAGLGQRKCAGIAAEALTRGVSTA-VNVEKETTQQPGRERNLYKRLSALGAKKGLV  59

Query  291  STVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQL  470
               +N+   EG+   + EL+  +++LR+FGRHH ALE  EWM+ R    K++  D A +L
Sbjct  60   GATINEYLREGRVPHKQELMRCIKELRRFGRHHQALETMEWMDTR--NVKLSHRDHATRL  117

Query  471  DLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            DLI K  GI  AE YF  LP S K++  YG+LLN Y    M++KA  LFD
Sbjct  118  DLICKTQGIDAAEDYFNGLPPSAKNQFTYGALLNCYCVEKMKDKALDLFD  167



>ref|XP_004962880.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Setaria italica]
Length=510

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + YP++ A  VL +  +EG+ + + +L  VVR+LRK+GR+  ALE+ EWM  + E
Sbjct  43   KRLLQLIYPKRSAVVVLRRWAEEGRTVQKYQLNRVVRELRKYGRYKHALEIMEWMRTQTE  102

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+AYV+ G REKAE+
Sbjct  103  -MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKAPSTCNALLHAYVQNGAREKAEA  161

Query  612  LF  617
            + 
Sbjct  162  ML  163



>emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera]
Length=499

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDL  476
             L Q   EG+ I + +L  ++RKLR F R++ ALE+ EW+ D+   + I+  D AIQLDL
Sbjct  54   ALEQWRKEGRSIKQQDLHRLIRKLRTFKRYNHALEIYEWIRDKF-YFDISPGDVAIQLDL  112

Query  477  ISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            ISKVHG+  AEKYF   PNSL+  ++YG+LLN Y +    EKAE++ 
Sbjct  113  ISKVHGLEQAEKYFNETPNSLRSFQVYGALLNCYSQKKSLEKAEAIM  159



>ref|NP_001176986.1| Os12g0527850 [Oryza sativa Japonica Group]
 dbj|BAH95714.1| Os12g0527850 [Oryza sativa Japonica Group]
Length=313

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP++ A+ VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E
Sbjct  32   RRLLKLIYPKRSAAVVLRRWAEEGRTVQKYQLNRVVRELRKYRRFKHALEICEWMRTQPE  91

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+AYV+ G R+KAE+
Sbjct  92   -MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHAYVQHGRRDKAEA  150

Query  612  LFD  620
            + +
Sbjct  151  MLE  153



>ref|XP_010921943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Elaeis guineensis]
Length=521

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 99/177 (56%), Gaps = 15/177 (8%)
 Frame = +3

Query  99   FPSG---FSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMI  269
            FP+    FST+ + +PL +    L ++    + VH  G  D           + +R+  +
Sbjct  11   FPASRRVFSTIGVSSPLPTD-DCLTLSVTKSTTVHGGGGRD----------TLGRRLLSL  59

Query  270  EYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITT  449
             YP++ A  VL +  +EGK + + +L  VVR+LRK+ R   ALE+CEWM  +    K+  
Sbjct  60   IYPKRSAVVVLRKWAEEGKSVQKYQLNRVVRELRKYKRFKHALEICEWMTTQP-NIKLLP  118

Query  450  SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             D A+ LDLI+KV G+++AEK+F  LP  +K +    +LL+ YV+  +  KAESL +
Sbjct  119  GDYAVHLDLIAKVRGLASAEKFFEDLPERMKVQSTCTALLHTYVQNELSNKAESLME  175



>ref|XP_010237220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Brachypodium distachyon]
Length=514

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + YP++ A  VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E
Sbjct  47   KRLLKLMYPKRSAVVVLRRWTEEGRTVQKYQLNRVVRELRKYRRFKHALEICEWMRTQPE  106

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDL++KV G+++AEK+F  +P   K      +LL+AYV+ G+R+KAE+
Sbjct  107  -MKLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNALLHAYVQNGVRDKAEA  165

Query  612  LF  617
            + 
Sbjct  166  ML  167



>ref|XP_010249903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Nelumbo nucifera]
Length=500

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +   +      LN+   EGK + R+E++  V +LRK+ ++  AL++ +WM  R
Sbjct  37   LYRRLSALGGSEASVVDTLNEWVKEGKSVKRVEIIGYVNQLRKYKKYKHALQLLKWMEKR  96

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                 +T  D AI+LDL+SKV GI++AEKYF +L  S K++  YG+LLN Y +  M +KA
Sbjct  97   GR--DLTHGDQAIRLDLLSKVEGIASAEKYFDSLKESAKNKLTYGALLNCYCKEKMVDKA  154

Query  606  ESLFD  620
             SLF+
Sbjct  155  MSLFE  159



>ref|XP_008381253.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 1/130 (1%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P +  +Y RIS    P+     +LNQ  +EG+ + + EL   ++  RK+ R+  AL++ E
Sbjct  34   PPFEPLYIRISRAGNPRVSVVPILNQWVEEGRDVKKWELQSFIKLFRKYRRYSHALQISE  93

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM+D   +Y +T  D A++LDLISKV G+  AE YF ++P+ L++ ++YG+LL +YV   
Sbjct  94   WMSDARNQY-LTPGDIAVRLDLISKVXGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENK  152

Query  591  MREKAESLFD  620
              EKAE +F+
Sbjct  153  SSEKAEIIFE  162



>ref|XP_008453822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like isoform X1 [Cucumis melo]
Length=498

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 88/154 (57%), Gaps = 10/154 (6%)
 Frame = +3

Query  156  GLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRIS  335
            GL   C S++++         + P  N   +Y R+S++       +  +N+   EG  + 
Sbjct  13   GLRQLCTSVAELT--------RSPANNHRGLYPRLSVLGATGGSVAQTINRFIMEGNIVK  64

Query  336  RLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKY  515
            + EL   +++LRK+ R+  +L++ EWM  R   Y  T  D A++LDLISKV+GI+ AEKY
Sbjct  65   KYELEKCIKELRKYRRYDHSLQIMEWMEIRKINYSFT--DYALRLDLISKVNGITAAEKY  122

Query  516  FLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            F  LP S K+R  YG+LLN Y +  M EKA +LF
Sbjct  123  FYDLPPSAKNRCTYGALLNCYCKEMMEEKASTLF  156



>ref|XP_008790994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Phoenix dactylifera]
Length=533

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP++ A  VL +  +EGKR+ + +L  VVR+LRK+ R   ALE+CEWM  + +
Sbjct  66   RRLLSLIYPKRSAVVVLRKWAEEGKRVQKYQLNRVVRELRKYKRFKHALEICEWMTTQPD  125

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDL++KV G+++AEK+F  LP  +K +    +LL+ YV+  +  KAES
Sbjct  126  -IKLLPGDYAVHLDLVAKVRGLASAEKFFEDLPERMKGQSTCTALLHTYVQSELSNKAES  184

Query  612  LFD  620
            L +
Sbjct  185  LME  187



>ref|XP_004133705.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004155237.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cucumis sativus]
 gb|KGN56236.1| hypothetical protein Csa_3G104890 [Cucumis sativus]
Length=492

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P+     VLNQ  +EG+ I   EL  +VR LR   R+  ALEV EWM  +
Sbjct  48   LYARISPLGDPECTVVPVLNQWIEEGRNIKDFELRRIVRDLRTCRRYRQALEVSEWMCSK  107

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +TT D AIQLDLI +V G+ +AEKYF ++ N  +  ++YG+LLN YVR G+ +K+
Sbjct  108  G-LFSLTTRDFAIQLDLIGQVRGLDSAEKYFGSVSNQKEIGKLYGALLNCYVREGLIDKS  166



>ref|XP_008452263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cucumis melo]
Length=487

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 1/131 (1%)
 Frame = +3

Query  213  YEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHL  392
            Y  R   N   +Y  IS +  P      VLNQ   EG++I   EL  +VR LR   R+  
Sbjct  37   YSTRRSCNRRKLYAMISPLGDPDSSVVPVLNQWIKEGRKIKDFELRRIVRDLRTCRRYRQ  96

Query  393  ALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  572
            ALEV EWM  +  R+ +TT D AIQLDLI +V G+ +AEKYF ++    +  ++YGSLLN
Sbjct  97   ALEVSEWMCSKG-RFSLTTRDFAIQLDLIGQVRGLDSAEKYFGSVSKQKEIGKLYGSLLN  155

Query  573  AYVRVGMREKA  605
             YVR G+ +K+
Sbjct  156  CYVREGLIDKS  166



>ref|XP_008810293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=429

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 89/153 (58%), Gaps = 8/153 (5%)
 Frame = +3

Query  165  ITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIE-YPQKGASTVLNQCEDEGKRISRL  341
            +T AS S++ +        R    W  +Y+R+S +   P+   +  L+Q E EG R++ L
Sbjct  19   LTTASASEMKAQAA-----REEAEWKPLYRRLSALGGAPEGRVTATLDQWEMEGWRMTAL  73

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
            +L+  +R+LRK+ RH  ALE+  WM  R+   ++     A++LDLISKV G+ +AE+YF 
Sbjct  74   QLMKHIRELRKYRRHEHALEMMHWMEKRS--MEMPNGYHAVRLDLISKVKGVRSAEEYFS  131

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             LP   K++R YG+L N Y    M ++A +L +
Sbjct  132  NLPEPAKNQRTYGALFNCYCSGKMTDRAVALLE  164



>gb|KDP21918.1| hypothetical protein JCGZ_03056 [Jatropha curcas]
Length=501

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 84/149 (56%), Gaps = 11/149 (7%)
 Frame = +3

Query  201  GTVDYEKRPMPNW----------GIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELL  350
            G+  Y  +P   W          G +Y+RIS +   +     +L+Q  +EG+ ++R +L+
Sbjct  23   GSSFYSTKPSTAWKFRGPGEDNLGQLYRRISPVGDHKVSIVPILDQWIEEGRSVNRFQLI  82

Query  351  FVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLP  530
              +++LR + R+  ALE+  WM D+   + + + D A++LDL+SKVHGI  AEKYF  +P
Sbjct  83   GAIKELRYYKRYSHALEILTWMTDK-RYFALCSPDIALRLDLMSKVHGIEEAEKYFNNVP  141

Query  531  NSLKDRRIYGSLLNAYVRVGMREKAESLF  617
              LK   +YG LL+ Y      EKAE+L 
Sbjct  142  QKLKVVEVYGGLLHCYAHATHVEKAEALM  170



>ref|XP_008781129.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Phoenix dactylifera]
Length=484

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGAST-VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVC  407
            P W  +Y+R+S +   Q G+ T  +N    EG+ ++ +E+   V++LRK+ RH  ALE+ 
Sbjct  40   PMWRPLYRRLSALGGAQGGSVTETMNGWLKEGRVVTEVEIKRFVKELRKYNRHRHALELM  99

Query  408  EWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  587
            +WM  R   +     D A++L+LISKV GI  AE+YF +LP+  K+++ YG+LLN+Y++ 
Sbjct  100  DWMESRGMMFSF--GDHAVRLNLISKVKGIDMAEEYFSSLPDLAKNQQTYGALLNSYIQE  157

Query  588  GMREKAESLFD  620
             + +KA +L++
Sbjct  158  KIADKAIALYE  168



>ref|XP_008381422.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Malus domestica]
Length=505

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +    +  +  LNQ   EGK + + EL   +++LRK+ ++  ALE+ EWM  R
Sbjct  38   LYRRLSALGATGESVAKTLNQYVMEGKMVRKFELEKCIKELRKYRKYQHALEIMEWMEFR  97

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y  + +D AI++DL+SKV GI  AE YF  LP S KDR  YG+LLN Y +  M EKA
Sbjct  98   KMNY--SKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNCYCKELMEEKA  155

Query  606  ESLFD  620
             + F+
Sbjct  156  LAHFE  160



>ref|XP_010242929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Nelumbo nucifera]
Length=500

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+RIS    P+     VL+Q   EGK  +R  L  ++++LR + R+  ALE+ +WM D+
Sbjct  37   LYRRISPAGDPRDSIVPVLDQWIKEGKTFTRDYLQRIIKRLRHYRRYKHALEISQWMTDQ  96

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + ++  D AI+LDLI+KVHG+  AEKYF  +P  L+  + YG+LLN Y      +KA
Sbjct  97   -RYFDLSAGDAAIRLDLITKVHGLGEAEKYFDYIPTQLRVFQTYGALLNCYTHEKSVDKA  155

Query  606  ESLF  617
            E+LF
Sbjct  156  EALF  159



>ref|XP_009349931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Pyrus x bretschneideri]
Length=511

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +    +  +  LNQ   EGK + + EL   +++LRK+ ++  ALE+ EWM  R
Sbjct  44   LYRRLSALGATGESVAKTLNQYVMEGKMVRKFELEKCIKELRKYRKYQHALEIMEWMEFR  103

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y  + +D AI++DL+SKV GI  AE YF  LP S KDR  YG+LLN Y +  M EKA
Sbjct  104  KMNY--SKADYAIRVDLMSKVKGIGAAEDYFSGLPESSKDRFTYGALLNCYCKELMEEKA  161

Query  606  ESLFD  620
             + F+
Sbjct  162  LAHFE  166



>dbj|BAK02972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + YP++ A  VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E
Sbjct  42   KRLLKLIYPKRSAVVVLRRWAEEGRAVHKYQLNRVVRELRKYRRFKHALEICEWMRTQPE  101

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+++AEK+F  +P   K      SLL+AYV+ G R+KAE+
Sbjct  102  -IRLLPGDHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNSLLHAYVQHGARDKAEA  160

Query  612  LF  617
            + 
Sbjct  161  ML  162



>gb|KDO35896.1| hypothetical protein CISIN_1g048394mg, partial [Citrus sinensis]
Length=485

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 75/132 (57%), Gaps = 2/132 (2%)
 Frame = +3

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P  N   +YKR+S +       +  LN    EGK + +  L + VR LRKFGR+  ALEV
Sbjct  39   PTGNEDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEV  98

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             EWM  R   +  T  D A+ LDL +K +GI+ AEKYF  L    K+R  YG+LLN Y +
Sbjct  99   IEWMESRKMHFSYT--DFAVYLDLTAKTNGIAAAEKYFNGLSEYAKNRYTYGALLNCYCK  156

Query  585  VGMREKAESLFD  620
              M E+A +LF+
Sbjct  157  ELMTERALALFE  168



>gb|EMT11631.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=1113

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYP-QKG-ASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P+W  +Y+RIS + +  Q G A+  + +   E + +S  +++  +RKLRKF RH  ALE+
Sbjct  101  PSWVPLYRRISKLSHGRQPGMAAAEMTKYLRERRPLSEYQIVAYIRKLRKFKRHACALEL  160

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             +WM  R    K+T    A++LDL+SKVHGI  AE+YF +LP+ LK R+ Y SLLN Y  
Sbjct  161  MDWMEARGA--KLTPGHQALRLDLVSKVHGIQAAEEYFWSLPDILKSRKAYSSLLNCYGE  218

Query  585  VGMREKAESLFD  620
             GM  K    ++
Sbjct  219  HGMAFKGLKFYE  230


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 77/177 (44%), Gaps = 51/177 (29%)
 Frame = +3

Query  231  PNWGIIYKRIS-MIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALE--  401
            P+W  +Y+RIS +   P    +  +++   + + +S  +++  VRKLRKF  +  ALE  
Sbjct  604  PSWIPLYRRISRLYGRPPGMVAAEMDKYLRKRRPLSADQIVAYVRKLRKFKSNACALEWV  663

Query  402  -------------------------VCE-------------------WMNDRAERYKITT  449
                                     +CE                   WM  R    K+T 
Sbjct  664  RDESPFCILFVDNFDLRSLLEFGNALCELCIPHSRLKNRTNTTMLMDWMESRGA--KLTP  721

Query  450  SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
               A++L L+SKVHGI  AE+YF +LP+  K ++ Y SLLN Y    M  K   L++
Sbjct  722  GHQALRLGLVSKVHGIQAAEEYFWSLPD--KSKKTYSSLLNCYGEHRMASKGLELYE  776



>ref|XP_009387891.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like, 
partial [Musa acuminata subsp. malaccensis]
Length=132

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +3

Query  147  RRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGK  326
            RR G  I C SISQVHSYGTVDYE+RP+  W  +Y+RIS +E P  G+  VL++ E E +
Sbjct  49   RRPGYPILC-SISQVHSYGTVDYERRPVLKWNSLYRRISTMEDPSLGSGIVLDRWEAEER  107

Query  327  RISRLELLFVVRKLRKFGRHHLALE  401
            R+S+ +L  V ++LRKF RH L+LE
Sbjct  108  RLSKWDLCRVAKELRKFRRHKLSLE  132



>gb|KJB46994.1| hypothetical protein B456_008G004700 [Gossypium raimondii]
Length=514

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP+  A+  + + ++EG+ + + EL  VVR+LRK  R+  ALE+CEWM  + +
Sbjct  55   RRLIGLVYPKHSAAATIQKWKEEGRTVRKYELNRVVRELRKLKRYKHALEICEWMRLQKD  114

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D AI LDLI+K+ G+ +AEK+F  LP+ ++D+  Y +LL+ YV+  +  KAE+
Sbjct  115  -IKLLPGDYAIHLDLIAKIRGLDSAEKFFKDLPDKMRDQATYTALLHTYVQNKLSGKAEA  173

Query  612  LF  617
            L 
Sbjct  174  LM  175



>ref|XP_006827770.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
 gb|ERM95186.1| hypothetical protein AMTR_s00009p00264540 [Amborella trichopoda]
Length=503

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            I+KRIS +  P      +L +   EG+++ + +L  +V+++R++ R+  ALE+C WM+DR
Sbjct  36   IFKRISPLGDPGTSVVPLLEEWVREGRKVHKSDLQSLVKEMRRYRRYKHALEICRWMSDR  95

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y ++ SD AI+LDLISKVHG+  AE+YF  +    K    YG+LLN Y +    EKA
Sbjct  96   RYHY-LSPSDHAIRLDLISKVHGLEQAEQYFGNITKQAKTFETYGALLNCYAQERSVEKA  154

Query  606  ESL  614
            ES+
Sbjct  155  ESI  157



>ref|XP_008342918.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RIS    P+     +LNQ  +EG+ + + EL   ++  RK  R+  AL++ EWM+D   +
Sbjct  42   RISQAGNPRVSIVPILNQWVEEGRDVKKWELQSFIKLFRKHRRYSHALQISEWMSDAQNQ  101

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            Y +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +YV     EKAE +
Sbjct  102  Y-LTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKAEII  160

Query  615  FD  620
            F+
Sbjct  161  FE  162



>ref|XP_008353787.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Malus domestica]
Length=514

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RIS    P+     +LNQ  +EG+ + + EL   ++  RK  R+  AL++ EWM+D   +
Sbjct  42   RISQAGNPRVSIVPILNQWVEEGRDVKKWELQSFIKLFRKHRRYSHALQISEWMSDAQNQ  101

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            Y +T  D A++LDLISKV+G+  AE YF ++P+ L++ ++YG+LL +YV     EKAE +
Sbjct  102  Y-LTPGDIAVRLDLISKVYGLQQAEAYFNSIPDQLRNFKVYGALLFSYVENKSSEKAEII  160

Query  615  FD  620
            F+
Sbjct  161  FE  162



>gb|EPS60165.1| hypothetical protein M569_14638, partial [Genlisea aurea]
Length=505

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 88/151 (58%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  TCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLEL  347
            T  SIS   + GTV    R       + +R+  + Y ++ A+  + + ++EG  + + EL
Sbjct  10   TAVSISPEEAKGTVGVYSRSGCGRDTLGRRLLALAYAKRSAAIAIRKWKEEGHFVQKYEL  69

Query  348  LFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTL  527
              +VR+LR+  R+  ALEVCEWM  + +   +   D A+ LDLI KV G+++AEK+F  L
Sbjct  70   NRIVRELRRQKRYKHALEVCEWMRLQHD-ICLLPGDYAVHLDLIGKVRGLTSAEKFFEDL  128

Query  528  PNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            P  +++     +LL+AYVR G  EKAE+L +
Sbjct  129  PERMRNHTTCSALLHAYVRHGEEEKAEALME  159



>gb|ABA99305.2| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG94881.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=514

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP++ A+ VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E
Sbjct  47   RRLLKLIYPKRSAAVVLRRWAEEGRTVQKYQLNRVVRELRKYRRFKHALEICEWMRTQPE  106

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+AYV+ G R+KAE+
Sbjct  107  -MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCNALLHAYVQHGRRDKAEA  165

Query  612  LFD  620
            + +
Sbjct  166  MLE  168



>gb|KEH17920.1| PPR containing plant-like protein [Medicago truncatula]
Length=407

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER++I+ SD AIQLDLI++VHG+S+AE +FL L N LKD+R YG+LLNAYV    
Sbjct  1    MNNRPERFRISASDVAIQLDLIARVHGVSSAESFFLNLTNDLKDKRTYGALLNAYVHSRS  60

Query  594  REKAESLFD  620
            REKAESL +
Sbjct  61   REKAESLLE  69



>gb|KCW90381.1| hypothetical protein EUGRSUZ_A02520, partial [Eucalyptus grandis]
Length=471

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 80/126 (63%), Gaps = 3/126 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++RIS +  P+     VL+Q   EG  + R   L +++++R + RH  ALE+  WM+D+
Sbjct  14   LFRRISPLGDPKISIVPVLDQWVAEGNSVERRPFLRLIKRMRSYRRHSHALEISMWMSDK  73

Query  426  AERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
              RY  ITT D A++L+LISKVHGI  AE +F  +P  LK  ++Y +LLN Y +  + +K
Sbjct  74   --RYIAITTVDAAVRLNLISKVHGIEQAEIFFDNVPRQLKVEKVYIALLNCYAKAKLPKK  131

Query  603  AESLFD  620
            AE+L +
Sbjct  132  AEALLE  137



>gb|KDP24140.1| hypothetical protein JCGZ_25797 [Jatropha curcas]
Length=494

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 76/132 (58%), Gaps = 1/132 (1%)
 Frame = +3

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P+  +  +Y RIS    P      +L    DEG  I R EL  ++R+LRK  R+  AL++
Sbjct  17   PVLRYTDLYNRISRTADPAVSMVPILENWLDEGNEIKRPELQEIIRQLRKDRRYTHALQI  76

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             +WM DR   + ++  D A QLDLISKV+G+  AEKYF ++P + +  R+Y +LLN Y  
Sbjct  77   SQWMTDRV-CFNLSPEDAASQLDLISKVYGLEEAEKYFSSIPENSRGYRVYSALLNCYAH  135

Query  585  VGMREKAESLFD  620
                EKA +L +
Sbjct  136  TKCLEKAGALME  147



>ref|XP_004148903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004158945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 gb|KGN44819.1| hypothetical protein Csa_7G390000 [Cucumis sativus]
Length=531

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + +P++ A T + + ++EG+ + + EL   VR+LRK  R+  ALEVCEWM  + +
Sbjct  52   RRLMSLIFPKRSAVTAIRKWQEEGRTVRKYELNRNVRELRKLKRYKHALEVCEWMTLQKD  111

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDLI K+ G++ AEK+F  LP+ ++++ +  SLL+AYV+  + EKAE+
Sbjct  112  -MRLVPGDYAVHLDLICKIRGLNRAEKFFEDLPDKIREQSVCTSLLHAYVQNNLSEKAEA  170

Query  612  LFD  620
            L +
Sbjct  171  LME  173



>ref|XP_008366628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=501

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +3

Query  177  SISQVHSYGTVDYEKRPMPNW----GIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLE  344
            ++  V  Y T  Y +    +W      +Y+RIS    P    + +L++  +EG+   +  
Sbjct  19   NVPGVSLYSTETYARPYRESWRGTLNTLYRRISRSGDPAAPITPILDKWVEEGRTAHKDA  78

Query  345  LLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLT  524
            L+ ++++LR++ +H  ALEV  W++D+   +++T  D AI+LDLI KVHGI  AE YF  
Sbjct  79   LVTIIKELRQYKKHXHALEVSMWVSDK-RYFELTIPDVAIRLDLIGKVHGIKQAEDYFNN  137

Query  525  LPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            +P  LK R +Y +LLN +    + EKAE + 
Sbjct  138  IPKQLKGRDVYCALLNVFAHAKLVEKAEEIM  168



>ref|XP_009379667.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=502

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 85/150 (57%), Gaps = 5/150 (3%)
 Frame = +3

Query  180  ISQVHSYGTVDYEKRPMPNW----GIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLEL  347
            +  V  Y T  Y +    +W      +Y+RIS    P    + +L++  +EG+   +  L
Sbjct  21   VPGVSLYSTETYPRPYRESWRGTLNTLYRRISRAGDPAAPITPILDKWVEEGRTAHKDAL  80

Query  348  LFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTL  527
            + ++++LR++ +H  ALEV  W++D+   +++T  D AI+LDLI KVHGI  AE YF  +
Sbjct  81   VTIIKELRQYKKHKHALEVSMWLSDK-RYFELTIPDVAIRLDLIGKVHGIKQAEDYFNNI  139

Query  528  PNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            P  LK R +Y +LLN +    + EKAE + 
Sbjct  140  PKQLKGRDVYCALLNIFAHAKLVEKAEEIM  169



>ref|XP_007021400.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12925.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=506

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RI+ +  P+ G   VL Q   EG+ ++ L+L  ++R LR   R+  ALEVC+WM++ 
Sbjct  43   LYSRINAVGDPRCGVDPVLQQWVQEGRHVNELQLQRIIRDLRARRRYSHALEVCKWMSN-  101

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                + ++SD A+QLDLI +VHG+ +A+ +F ++ +  K  + YG+LLN YVR G+ +++
Sbjct  102  -SDLEFSSSDCAVQLDLIGRVHGLMSAKSFFSSMRDQEKTVKTYGALLNCYVREGLLDES  160

Query  606  ESLF  617
             SL 
Sbjct  161  LSLM  164



>ref|XP_010058578.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Eucalyptus grandis]
Length=550

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 80/126 (63%), Gaps = 3/126 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++RIS +  P+     VL+Q   EG  + R   L +++++R + RH  ALE+  WM+D+
Sbjct  63   LFRRISPLGDPKISIVPVLDQWVAEGNSVERRPFLRLIKRMRSYRRHSHALEISMWMSDK  122

Query  426  AERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
              RY  ITT D A++L+LISKVHGI  AE +F  +P  LK  ++Y +LLN Y +  + +K
Sbjct  123  --RYIAITTVDAAVRLNLISKVHGIEQAEIFFDNVPRQLKVEKVYIALLNCYAKAKLPKK  180

Query  603  AESLFD  620
            AE+L +
Sbjct  181  AEALLE  186



>gb|EMT17732.1| hypothetical protein F775_09007 [Aegilops tauschii]
Length=510

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +3

Query  273  YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTS  452
            YP++ A  VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E  ++   
Sbjct  49   YPKRSAVVVLRRWAEEGRPVHKYQLNRVVRELRKYRRFKHALEICEWMRTQPE-MRLLPG  107

Query  453  DTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            D A+ LDL++KV G+++AEK+F  +P   K      SLL+AYV+ G R+KAE++ 
Sbjct  108  DHAVHLDLVAKVRGLASAEKFFEDVPERAKGPSTCNSLLHAYVQHGARDKAEAML  162



>ref|XP_008227878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Prunus mume]
Length=501

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +       +  LNQ   EGK + + EL   +++LRK+ +   ALE+ EWM  R
Sbjct  38   LYRRLSALGATGGSVAKTLNQYIMEGKMLKKYELERCIKELRKYRKFQHALEIMEWMEFR  97

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y  + +D AI+LDL SKV GI  AE YF  L  SLKDR  YG+LLN Y +  M EKA
Sbjct  98   KMNY--SKADFAIRLDLTSKVKGIEAAEDYFSGLSPSLKDRFTYGALLNCYCKELMEEKA  155

Query  606  ESLFD  620
             SL++
Sbjct  156  LSLYE  160



>ref|XP_006429067.1| hypothetical protein CICLE_v10011521mg [Citrus clementina]
 gb|ESR42307.1| hypothetical protein CICLE_v10011521mg [Citrus clementina]
Length=508

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 2/132 (2%)
 Frame = +3

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P  N   +YKR+S +       +  LN    EGK + +  L + VR LRKFGR+  ALEV
Sbjct  39   PTGNEDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEV  98

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             EWM  R   +  T  D A+ LDL +K  GI+ AE+YF +L    K+R  YG+LLN Y +
Sbjct  99   IEWMESRKIHFSYT--DFAVYLDLTAKTKGIAAAEEYFNSLSEYAKNRYTYGALLNCYCK  156

Query  585  VGMREKAESLFD  620
              M E+A +LF+
Sbjct  157  ELMTERALALFE  168



>ref|XP_009144540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Brassica rapa]
Length=514

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 92/154 (60%), Gaps = 4/154 (3%)
 Frame = +3

Query  168  TCASISQVHSYGTVDY-EKRPMPNWG--IIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            T AS+ +V S  T +  E   +   G   +  R+  + Y ++ A   + + ++EG  + +
Sbjct  13   TVASLCRVFSAATAETTESGALVGGGRDTLGGRLLRLTYTKRSAVVSIRKWKEEGHTVGK  72

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  +VR+LRK  R+  ALE+CEWM  + E  K+   D A+ LDLISK+ G+++AEK+F
Sbjct  73   YELNRIVRELRKIKRYKHALEICEWMVVQ-EDIKLQPGDYAVHLDLISKIRGLNSAEKFF  131

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
              +P+ ++D     SLL+ YV+  + +KAE+LF+
Sbjct  132  QDMPDQMRDHAACTSLLHTYVKNKLSDKAEALFE  165



>ref|XP_007221478.1| hypothetical protein PRUPE_ppa005037mg [Prunus persica]
 gb|EMJ22677.1| hypothetical protein PRUPE_ppa005037mg [Prunus persica]
Length=480

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +       +  LNQ   EGK + + EL   +++LRK+ +   ALE+ EWM  R
Sbjct  38   LYRRLSALGATGGSVAKTLNQYIMEGKMLKKYELERCIKELRKYRKFQHALEIMEWMEFR  97

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y  + +D AI+LDL SKV GI  AE YF  L  SLKDR  YG+LLN Y +  M EKA
Sbjct  98   KMNY--SKADFAIRLDLTSKVKGIEAAEDYFSGLSPSLKDRFTYGALLNCYCKELMEEKA  155

Query  606  ESLFD  620
             +L++
Sbjct  156  LALYE  160



>ref|XP_008229148.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=467

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P +  +Y RIS    P+     VL+Q  +EG+ +++ EL   V+ LRK+ R+  AL++ E
Sbjct  34   PPFETLYHRISRAGNPRVSIVPVLDQWIEEGRDVNKSELQSFVKMLRKYRRYSHALQISE  93

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM+D   R   +  D AI+LDLISKV G+  AE YF +LP+ L++ ++YG+LL   V   
Sbjct  94   WMSDARNR-DPSPGDIAIRLDLISKVCGLEQAEMYFNSLPDPLRNFKVYGALLFCSVEHK  152

Query  591  MREKAESLFD  620
              EKAE+LF+
Sbjct  153  SLEKAENLFE  162



>ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=300

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 81/135 (60%), Gaps = 1/135 (1%)
 Frame = +3

Query  213  YEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHL  392
            + +R   N   +Y+RIS +  P+     +L+Q  +EGK +++ +L   +++LR   R+  
Sbjct  40   FRERGKDNLNQLYRRISPVGDPKVSIVPILDQWIEEGKSVNKDQLQVFIKELRYCKRYTH  99

Query  393  ALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  572
            ALE+  WM+D+   + +T+ D AI+LDL+SKV GI  AEKYF  +P  LK   +Y +LLN
Sbjct  100  ALEISMWMSDK-RYFALTSRDVAIRLDLMSKVLGIEQAEKYFENVPQKLKVLEVYNALLN  158

Query  573  AYVRVGMREKAESLF  617
             Y      +KAE++ 
Sbjct  159  CYAYAKSVDKAEAVM  173



>ref|XP_009354430.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=509

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 87/146 (60%), Gaps = 4/146 (3%)
 Frame = +3

Query  189  VHSYGTVDYEKRPMPNWGII---YKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            V  Y T  Y     P+ G +   Y+RIS     +   S +L+Q  +EG+   +   + ++
Sbjct  24   VSLYSTTTYRPHREPSKGTLNELYRRISRAGDHRAPISPILDQWIEEGRTAPKDAFVTII  83

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            ++LR++ ++  ALE+  W++D+   +++T +D AI+LDLI+KVHGI  AE YF  +P +L
Sbjct  84   KELRQYKQYKHALEISMWLSDK-RYFELTIADVAIRLDLIAKVHGIEQAEDYFNNIPKNL  142

Query  540  KDRRIYGSLLNAYVRVGMREKAESLF  617
            K   +Y +LLN+Y R  + EKAE + 
Sbjct  143  KVLEVYCALLNSYARAKLVEKAEDIM  168



>ref|XP_008235277.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Prunus mume]
Length=511

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 84/139 (60%), Gaps = 1/139 (1%)
 Frame = +3

Query  201  GTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFG  380
             T   EK        + +R+  + +P++ A   + + ++EG ++ + EL  +VR+LRK  
Sbjct  27   ATASVEKSSSGGRDTLGRRLMSLVFPKRSAVIAIRKWKEEGHKVRKYELNRIVRELRKLK  86

Query  381  RHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYG  560
            R+  ALE+CEWM  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ + DR    
Sbjct  87   RYKHALEICEWMTLQQD-MKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDQMTDRPTCT  145

Query  561  SLLNAYVRVGMREKAESLF  617
            +LL+ YV+  + +KAE+L 
Sbjct  146  ALLHTYVQNKLSDKAEALM  164



>ref|XP_006664068.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Oryza brachyantha]
Length=510

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP++ A+ VL +  +EG+ + + +L  VVR+LRK+ R   ALE+CEWM  + E
Sbjct  43   RRLLKLIYPKRSAAVVLRRWSEEGRTVQKYQLNRVVRELRKYRRFKHALEICEWMRTQPE  102

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              ++   D A+ LDL++KV G+ +AEK+F  +P   K      +LL+ YV+ G R+KAE+
Sbjct  103  -MRLLPGDHAVHLDLVAKVRGLPSAEKFFEDMPERAKGPSTCSALLHTYVQHGRRDKAEA  161

Query  612  LF  617
            + 
Sbjct  162  ML  163



>ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Nelumbo nucifera]
Length=513

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            I +R+  + YP++ A   + +  +EGK + + EL  VVR+LRK  R+  ALE+CEWM  +
Sbjct  43   IGRRLLTLIYPKRSAVVTIRKWTEEGKTVRKYELNRVVRELRKLKRYKHALEICEWMTVQ  102

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
             +  K+   D A+ LDL++KV G  +AEK+F  LP  +K    Y +LL+ YV+  + EKA
Sbjct  103  PD-IKLLPGDYALHLDLVAKVRGWVSAEKFFEDLPEHMKGEPTYSALLHTYVQHNLSEKA  161

Query  606  ESLF  617
            E+L 
Sbjct  162  EALM  165



>emb|CDX97288.1| BnaA02g20790D [Brassica napus]
Length=514

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 92/154 (60%), Gaps = 4/154 (3%)
 Frame = +3

Query  168  TCASISQVHSYGTVDY-EKRPMPNWG--IIYKRISMIEYPQKGASTVLNQCEDEGKRISR  338
            T AS+ +V S  T +  E   +   G   +  R+  + Y ++ A   + + ++EG  + +
Sbjct  13   TVASLCRVFSAATAETTESGALVGGGRDTLGGRLLRLTYTKRSAVVSIRKWKEEGHTVGK  72

Query  339  LELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYF  518
             EL  +VR+LRK  R+  ALE+CEWM  + E  K+   D A+ LDLISK+ G+++AEK+F
Sbjct  73   YELNRIVRELRKIKRYKHALEICEWMVVQ-EDIKLQPGDYALHLDLISKIRGLNSAEKFF  131

Query  519  LTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
              +P+ ++D     SLL+ YV+  + +KAE+LF+
Sbjct  132  QDMPDQMRDHAACTSLLHTYVKNKLSDKAEALFE  165



>ref|XP_008349216.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=509

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 86/146 (59%), Gaps = 4/146 (3%)
 Frame = +3

Query  189  VHSYGTVDYEKRPMPNWGII---YKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVV  359
            V  Y T  Y     P+ G +   Y+RIS         S +L+Q  +EG+   +   + ++
Sbjct  24   VSLYSTTTYRPHREPSRGTLNDLYRRISRAGDHTAPISPILDQWIEEGRTAPKGAFVTII  83

Query  360  RKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSL  539
            ++LR++ ++  ALE+  W++D+   +++T +D AI+LDLI+KVHGI  AE YF  +P +L
Sbjct  84   KELRQYKQYKHALEISMWLSDK-RYFELTIADVAIRLDLIAKVHGIEQAEDYFNNIPKNL  142

Query  540  KDRRIYGSLLNAYVRVGMREKAESLF  617
            K   +Y +LLN+Y R  + EKAE + 
Sbjct  143  KVLEVYCALLNSYARAKLVEKAEDIM  168



>ref|XP_010940923.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Elaeis guineensis]
Length=428

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 87/153 (57%), Gaps = 8/153 (5%)
 Frame = +3

Query  165  ITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIE-YPQKGASTVLNQCEDEGKRISRL  341
            +T AS +++ +        R    W  +Y+R+S++   P+   +  L+Q E EG R++ L
Sbjct  19   LTTASAAELKTQAA-----REEAEWKPLYRRLSVLGGAPEGSVTATLDQWEMEGWRMTAL  73

Query  342  ELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFL  521
             L+  +R+LRK+ RH  ALE+  WM  R    +      A+++DLISKV GI +AE+YF 
Sbjct  74   WLMKHIRELRKYRRHEHALEMMHWMEKRG--METPNGYHAVRIDLISKVKGIRSAEEYFS  131

Query  522  TLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             LP   K+RR YG+L + Y    M ++A +L +
Sbjct  132  NLPEPAKNRRTYGALFSCYCSGRMTDRAIALLE  164



>ref|XP_006480799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Citrus sinensis]
Length=508

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 74/132 (56%), Gaps = 2/132 (2%)
 Frame = +3

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P  N   +YKR+S +       +  LN    EGK + +  L + VR LRKFGR+  ALEV
Sbjct  39   PTGNEDKLYKRLSALGATGGSVTGALNAYIMEGKTVRKDMLEYCVRSLRKFGRYRHALEV  98

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
             EWM  R   +  T  D A+ LDL +K  GI+ AE+YF  L    K+R  YG+LLN Y +
Sbjct  99   IEWMESRKIHFSYT--DFAVYLDLTAKTKGIAAAEEYFNGLSEYAKNRYTYGALLNCYCK  156

Query  585  VGMREKAESLFD  620
              M E+A +LF+
Sbjct  157  ELMTERALALFE  168



>gb|EPS68015.1| hypothetical protein M569_06760, partial [Genlisea aurea]
Length=365

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +3

Query  276  PQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSD  455
            P++  S VL +  DEG+RI   +L  + R LR+  R+  ALE+ EWM    E Y +++SD
Sbjct  60   PKRSVSNVLQKWIDEGRRIEASDLRSISRDLRRSQRYKHALEISEWMVSH-EEYHLSSSD  118

Query  456  TAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             AI++DL++KV G S AE+YF  LP+S K    Y +LL+ Y  +   E AE+LF+
Sbjct  119  YAIRIDLMAKVFGTSAAERYFEALPSSAKTNETYTALLHCYASLKQVENAEALFE  173



>ref|XP_010921472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial [Elaeis guineensis]
Length=513

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = +3

Query  237  WGIIYKRISMIE-YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEW  413
            W  +Y+R+S +   P+   +  LN+   EG+    +EL+  V++LRK+ R++ ALE+ +W
Sbjct  47   WKPLYRRLSALGGAPEGSVTKTLNKWVREGRPARAVELMKYVKELRKYRRYNHALELMDW  106

Query  414  M-NDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            M N R     ++ ++ AI+LDLI+KV GI +AE+YF  LP   K+ R YG+LLN Y    
Sbjct  107  MVNTRG--MNMSYTNHAIRLDLIAKVRGIESAEEYFFKLPEPAKNERTYGALLNCYCSEK  164

Query  591  MREKAESLFD  620
            M +KA +L++
Sbjct  165  MADKANALYE  174



>ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=493

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++ + +L  ++++LRKFGR + AL++CEW+  R
Sbjct  38   LFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKFGRFNQALQLCEWV--R  95

Query  426  AERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER + ++T D A++L LISK  G+  AEKYF ++  S +D ++YG+LL+ YV     +K
Sbjct  96   NERNQCLSTGDIAVELHLISKARGLEQAEKYFSSIGESSRDHKVYGALLHCYVENKNLKK  155

Query  603  AESLF  617
            AE++ 
Sbjct  156  AEAIM  160



>ref|XP_010556784.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Tarenaya hassleriana]
Length=512

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +3

Query  273  YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTS  452
            Y ++ A   + + ++EG+ + + EL  +VR+LRK  R+  ALE+CEWM  + E  K+   
Sbjct  59   YRKRSAVVAIRKWKEEGRTVRKYELNRIVRELRKLKRYKHALEICEWMVLQ-EDIKLQPG  117

Query  453  DTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            D A+ LDLI+K+ G+++AEK+F  +P+ ++D  +  SLL+ YV+  + +KAE+LF+
Sbjct  118  DYAVHLDLITKIRGLNSAEKFFEDIPDRMRDHSVCTSLLHTYVQSKLSDKAEALFE  173



>ref|XP_010456952.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Camelina sativa]
Length=193

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  67   RLLGLTYTKRSAVVTIRKWREEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  125

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  126  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  185

Query  615  FD  620
            F+
Sbjct  186  FE  187



>gb|KHG13694.1| hypothetical protein F383_19313 [Gossypium arboreum]
Length=514

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP+  A   + + ++EG+ + + EL  VVR+LRK  R+  ALE+CEWM  + +
Sbjct  55   RRLIGLVYPKHSAVATIQKWKEEGRTVRKYELNRVVRELRKLKRYKHALEICEWMRLQKD  114

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D AI LDLI+K  G+ +AEK+F  LP+ ++D+  Y +LL+ YV+  +  KAE+
Sbjct  115  -IKLLPGDYAIHLDLIAKNRGLDSAEKFFEDLPDKMRDQATYTALLHTYVQNKLSGKAEA  173

Query  612  LF  617
            L 
Sbjct  174  LM  175



>ref|XP_004514446.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cicer arietinum]
Length=521

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RIS    P    + +LNQ   EG+ I + EL F ++KLR + R + AL++ EWM++ 
Sbjct  28   LFTRISRAGDPIIPMTPILNQWIQEGRDIKQSELQFFIKKLRSYRRFNQALQISEWMSNE  87

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + + + D AI+LDLI+KV G+  ++KYF ++PN+ +D +IY +LLN Y +    EKA
Sbjct  88   RNLH-LLSGDIAIRLDLIAKVRGLDESQKYFDSIPNTSRDFKIYSALLNCYAQYNSVEKA  146

Query  606  ES  611
            E+
Sbjct  147  EA  148



>gb|KDO74080.1| hypothetical protein CISIN_1g011236mg [Citrus sinensis]
Length=490

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P    + VL+Q   EG++IS LEL  V+R+LR   R   AL+V EWM+ +
Sbjct  39   LYSRISPLGDPDVSLTPVLDQWVLEGQKISELELQRVIRQLRSRKRFKHALQVSEWMSGQ  98

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +   D A+QLDLI KV G+ +AE YF +L +  K  ++YG+LLN YVR G+ +++
Sbjct  99   GLAFSV--HDHAVQLDLIGKVRGLESAETYFNSLNDEDKVDKLYGALLNCYVREGLVDES  156

Query  606  ESLF  617
             SL 
Sbjct  157  LSLM  160



>emb|CDX91277.1| BnaC02g26880D [Brassica napus]
Length=519

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  50   RLLRLTYTKRSAVVSIRKWKEEGHTVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  108

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++D     SLL++YV+  + +KAE+L
Sbjct  109  IKLQPGDYAVHLDLISKIRGLNSAEKFFQDMPDKMRDHAACTSLLHSYVKNKLSDKAEAL  168

Query  615  FD  620
            F+
Sbjct  169  FE  170



>gb|KHN31110.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=418

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +3

Query  414  MNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGM  593
            MN+R ER++++ SD AIQLDLI+KV G+S+AE +FL+L + LKD+R YG+LLN YV    
Sbjct  1    MNNRPERFRVSESDAAIQLDLIAKVRGVSSAEAFFLSLEDKLKDKRTYGALLNVYVHSRS  60

Query  594  REKAESLFD  620
            +EKAESLFD
Sbjct  61   KEKAESLFD  69



>ref|XP_010520653.1| PREDICTED: uncharacterized protein LOC104799713 [Tarenaya hassleriana]
Length=1018

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 79/127 (62%), Gaps = 3/127 (2%)
 Frame = +3

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
            ++++RIS I  P      VL+Q   EG  +++ +L  +++ LR F R+  AL++  WM++
Sbjct  72   LLFERISPIGDPTASMVPVLDQWVKEGNEVNKSQLTNIIKDLRSFKRYSHALQISMWMSE  131

Query  423  RAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMRE  599
            +  RY ++T+SD +++LDL+SK+HGI  AE +F  +P   +   +YG+LLN Y      E
Sbjct  132  K--RYIELTSSDISVRLDLVSKIHGIEEAESHFNNVPVHQRSLEVYGALLNCYANAKCVE  189

Query  600  KAESLFD  620
            KAE L D
Sbjct  190  KAEGLMD  196


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 73/124 (59%), Gaps = 1/124 (1%)
 Frame = +3

Query  243  IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
            ++ +RI  I  P      VL+Q   EG ++S+  L  ++++LR F RH  AL++  WM++
Sbjct  564  LLSRRIYSIGDPAASLVPVLDQWAREGNQVSKFWLSKIIKELRSFKRHSQALQISMWMSE  623

Query  423  RAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
            +     +   D +++LDLISKV+G+  AE Y+  +P   +  ++YG+LLN Y      EK
Sbjct  624  KM-NISLDPRDISLRLDLISKVNGVEAAENYYNYIPTHQRTIQVYGALLNCYANAKCVEK  682

Query  603  AESL  614
            AE++
Sbjct  683  AENV  686



>ref|XP_004288536.2| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=493

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +    + A+  LN    EG++I + EL   V++LRK+ +   ALE+ EWM  R
Sbjct  25   LYRRLSALGGSGRSAAKALNDYIMEGRKIQKYELDRCVKELRKYRQFQTALEIMEWMEFR  84

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               Y +   D A++LDL +K  GI  AE YF  LP S K++  YGSLLN Y +  M EKA
Sbjct  85   KINYSLP--DYAVRLDLTAKAKGIEAAESYFSNLPQSAKNKLTYGSLLNCYCKEVMEEKA  142

Query  606  ESLF  617
             +L+
Sbjct  143  LALY  146



>ref|XP_008368855.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Malus domestica]
Length=511

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + +P++ A   + + ++EG  + + EL  +VR+LRK  R+  ALEVCEWM  + +
Sbjct  44   RRLLSLVFPKRSAVITIRKWKEEGHTVRKYELNRIVRELRKLKRYKHALEVCEWMTLQQD  103

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+ + D A+ LDLI+KV G+++AEK+F  LP  + DR    +LL+ YV+  + +KAE+
Sbjct  104  -LKLVSGDYAVHLDLIAKVRGMNSAEKFFEDLPLQMTDRATCTALLHTYVQNKVTDKAEA  162

Query  612  LF  617
            L 
Sbjct  163  LI  164



>gb|KGN43610.1| hypothetical protein Csa_7G047450 [Cucumis sativus]
Length=493

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++ + +L  ++++LRKFGR + AL++CEW+  R
Sbjct  38   LFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKFGRFNQALQLCEWV--R  95

Query  426  AERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER + ++T D A++L LISK  G+  AE+YF ++  S +D ++YG+LL+ YV     +K
Sbjct  96   NERNQCLSTGDIAVELHLISKARGLEQAEEYFSSIGESSRDHKVYGALLHCYVENKNLKK  155

Query  603  AESLF  617
            AE++ 
Sbjct  156  AEAIM  160



>ref|XP_009398991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=520

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + YP++ A  VL +  +E K I + +L  VVR+LRK+ R+  ALE+CEWM  ++ 
Sbjct  53   RRLLSLIYPKRSAVVVLRKWAEEDKPIQKYQLNRVVRELRKYKRYKHALEICEWMTTQS-  111

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDL++KV G+++A+K+F  LP  +K      +LL+ YV+  + +KAES
Sbjct  112  HIKLLPGDYAVHLDLVAKVCGLASAQKFFEDLPVRMKGPSTCTALLHTYVQCKLTDKAES  171

Query  612  LFD  620
            L +
Sbjct  172  LME  174



>ref|XP_007042879.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOX98710.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=399

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A+TV+ +   E  R+S  +L  + ++LRK  R   ALE+ EWM    E 
Sbjct  48   RIFWLRLPKRSATTVIEKWVGEDNRVSISDLRQISKELRKSQRFKHALEISEWMVTH-EE  106

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            YK++ SD AI++DL++KV GI  AE+YF  LP + K    Y +LL+ Y    + EKAE L
Sbjct  107  YKLSDSDYAIRIDLMTKVFGIDAAERYFEDLPPTAKTSETYTALLHCYAAAKLTEKAEEL  166

Query  615  FD  620
            F+
Sbjct  167  FE  168



>gb|EYU46589.1| hypothetical protein MIMGU_mgv1a004554mg [Erythranthe guttata]
Length=521

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E
Sbjct  55   RRLFALVYKKRSAVVAVRKWKEEGHVVRKYELNRIVRELRKLKRYKHALEICEWMMTQ-E  113

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+ + D A+ LDLI+K+ G+ +AEK+FL LP   +D     +LL+ YVR     KAE+
Sbjct  114  DMKLVSGDYAVHLDLIAKIRGLDSAEKFFLDLPEKTRDSATCSALLHTYVRHNESGKAEA  173

Query  612  LFD  620
            L +
Sbjct  174  LME  176



>ref|XP_008455539.1| PREDICTED: uncharacterized protein LOC103495690 [Cucumis melo]
Length=1067

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++++ ++  ++++LRKFGR + AL++CEW+++ 
Sbjct  612  LFRRVFRAGDPRISIVRVLDQWIEEGRKVNQSDIQALIKQLRKFGRFNHALQLCEWIHN-  670

Query  426  AERYK-ITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER K  +  D A+QL LISK  G+  AEKYF ++  S +D ++YG+LLN YV     EK
Sbjct  671  -ERNKNPSPGDIAVQLHLISKARGLEQAEKYFSSIRESSRDHKVYGALLNCYVENKNLEK  729

Query  603  AESLF  617
            AE++ 
Sbjct  730  AEAIM  734


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +3

Query  204  TVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGR  383
            ++ +   P P   I+  +I  I  P+     VL +   +G+ I + EL ++V   + F R
Sbjct  35   SLPFSSTPPPQSTILRNQIIDIRDPKISVIPVLEKWVGDGRAIWKPELQYLVYLTKNFRR  94

Query  384  HHLALEVCEWMNDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYG  560
             + ALE+ +WM DR  RY  ++ SD A++LDLI  VHG+ +AE YF ++   LK   +YG
Sbjct  95   FNHALEISQWMTDR--RYLSLSASDAALRLDLIHSVHGLEHAENYFNSISTRLKTSNVYG  152

Query  561  SLLNAYVRVGMREKAESLF  617
            SLL+ YVR    EKAE++ 
Sbjct  153  SLLSCYVREKSVEKAEAIM  171



>ref|XP_006376506.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP54303.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=501

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 74/120 (62%), Gaps = 1/120 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +RISM+E P      V+ +   EG+ ++  +L   +RKLRK  R   AL++ +WM+D+  
Sbjct  37   RRISMVEDPMVPVIPVIEKWVQEGQVVTNSDLKHFIRKLRKIHRFSHALQISQWMSDQ-R  95

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
             + ++  D A++LDLISKVHG+  A  YF ++P SL+   +YG+LLN Y      E+AE+
Sbjct  96   GHNLSPGDVAVRLDLISKVHGLEQAVTYFNSVPESLRGLEVYGALLNCYAHYKHLEEAEA  155



>ref|XP_008781131.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Phoenix dactylifera]
Length=514

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (60%), Gaps = 4/141 (3%)
 Frame = +3

Query  204  TVDYEKRPMPNWGIIYKRISMIE-YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFG  380
             V  EK     W  +Y+R+S +   P+   +  LN+   EG+    +EL+  V++LRK+ 
Sbjct  37   AVAEEKGGTKEWKPLYRRLSALGGAPEGSVTKTLNKWVREGRPARAVELMKYVKELRKYR  96

Query  381  RHHLALEVCEWM-NDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIY  557
            R+  ALE+ +WM N R     ++ ++ AI+LDLI+KV GI +AE+YF  LP   K+ R Y
Sbjct  97   RYKHALELMDWMVNTRG--MNMSYTNHAIRLDLIAKVRGIESAEEYFSKLPEPAKNERTY  154

Query  558  GSLLNAYVRVGMREKAESLFD  620
            G+LLN Y    M +KA +L++
Sbjct  155  GALLNCYCSEKMLDKAIALYE  175



>emb|CDP03624.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALEVCEWM  + E
Sbjct  48   RRLLSLVYTKRSAVIAIRKWKEEGHVVQKYELNRIVRELRKLKRYKHALEVCEWMRIQ-E  106

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+ + D A+ LDLI+KV G+++AEK+F  LP+ +KD     SLL+ Y +     KAE+
Sbjct  107  NVKLLSGDYAVHLDLIAKVRGMNSAEKFFEDLPDKMKDHTTCSSLLHTYAQHKESAKAEA  166

Query  612  LFD  620
            L +
Sbjct  167  LIE  169



>ref|XP_010069830.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Eucalyptus grandis]
 gb|KCW58313.1| hypothetical protein EUGRSUZ_H01002 [Eucalyptus grandis]
Length=521

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            IY+R+S +       S  LN+   EG+++S+++L+   ++LRK+ R+  ALEV +WM  R
Sbjct  42   IYRRLSPLAGFGGSVSKTLNEYFMEGRKVSKIDLVRCAKELRKYRRYEHALEVMQWMEKR  101

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                    +D A+ LDLISKV G+  AEKYF  LP S K+   YG+LLN Y +    +KA
Sbjct  102  --NINFAYADYALNLDLISKVKGLDAAEKYFNGLPESAKNIITYGTLLNCYCKEANEDKA  159

Query  606  ESLF  617
             +LF
Sbjct  160  LALF  163



>ref|XP_006429969.1| hypothetical protein CICLE_v10013712mg [Citrus clementina]
 gb|ESR43209.1| hypothetical protein CICLE_v10013712mg [Citrus clementina]
Length=468

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 73/123 (59%), Gaps = 3/123 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++RIS +  P      +LNQ  +EG  + + +L   +++LR F R   ALE+  WM D+
Sbjct  48   LFRRISPMGNPNVSIVPLLNQWVEEGHPVDKQQLQRFIKELRFFSRFTHALEISMWMTDK  107

Query  426  AERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
              RY  IT +D A+QLDLI+KV GI  AE YF  +P  +K   +Y +LLN Y  V   +K
Sbjct  108  --RYLNITAADAAVQLDLIAKVKGIEEAENYFSYIPEKIKGLEVYSALLNCYSNVKSTDK  165

Query  603  AES  611
            AE+
Sbjct  166  AEA  168



>emb|CDO99551.1| unnamed protein product [Coffea canephora]
Length=449

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 74/124 (60%), Gaps = 1/124 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P+     VL+Q  + GK++   ELL ++  LRK  R   AL+VCEWM  +
Sbjct  63   LYSRISPLGNPKIKIGPVLDQWVESGKKVRFAELLRIIHDLRKRSRFSHALQVCEWMK-K  121

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
            +  +  + ++ A+QLDLI +VHG  +AE YF  L    K  + YG+LL++Y R G  +K+
Sbjct  122  SGMFTYSPTEHAVQLDLIGRVHGYLSAENYFTDLSEEDKTEKTYGALLHSYARQGQSDKS  181

Query  606  ESLF  617
             SL 
Sbjct  182  LSLL  185



>ref|XP_009779118.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana sylvestris]
Length=477

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 77/141 (55%), Gaps = 2/141 (1%)
 Frame = +3

Query  198  YGTVDYEKRPMPNWG-IIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRK  374
            YGT    K+     G  +Y RIS +  P+     VL Q   EG ++ R EL +++++LR 
Sbjct  25   YGTTTSAKQDKDERGEWVYTRISPLGSPEVSMVPVLEQWVKEGNQVLRSELQWIIKRLRS  84

Query  375  FGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRI  554
            + R+  ALEV  WM DR   + +  +D A ++DL+ KV G+   E+YF + P  LK   +
Sbjct  85   YKRYKHALEVSHWMTDR-RYFSLQPADVATRIDLMYKVKGLEEVEEYFNSTPQKLKRLTV  143

Query  555  YGSLLNAYVRVGMREKAESLF  617
            Y SLLN Y      EKAE+L 
Sbjct  144  YTSLLNCYTSEKSAEKAEALM  164



>gb|EMT27370.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=949

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  390  LALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLL  569
            L  +V +WM DR +R+ +++SD AIQLDLI+KV G+ +AE+YF  LP+ LKD+R YGSLL
Sbjct  561  LTGKVYDWMTDRRDRFSLSSSDMAIQLDLIAKVRGVPDAEEYFEKLPDPLKDKRTYGSLL  620

Query  570  NAYVRVGMREKAESLFD  620
            N Y +  M+EK E  F+
Sbjct  621  NVYAQARMKEKTEYTFE  637



>ref|XP_002874893.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51152.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=525

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  59   RLLSLVYTKRSAVVTIRKWKEEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  117

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  LP+ ++      SLL++YV+  + +KAE+L
Sbjct  118  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDLPDQMRGHAACTSLLHSYVQNKLSDKAEAL  177

Query  615  FD  620
            F+
Sbjct  178  FE  179



>ref|XP_002316903.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa]
 gb|EEE97515.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa]
Length=500

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = +3

Query  213  YEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHL  392
            Y K+       +Y RIS +  P+   + VL+Q  +EGK++   EL  +V+ LR+  R   
Sbjct  25   YFKKATTQRNNLYSRISPLGDPRISLAPVLDQWVEEGKKVKDYELRTIVKGLRERKRFKQ  84

Query  393  ALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLN  572
            ALEV +WM+        + SD A++LDLI KVHG+ +AE YF  L    K  + YG+LLN
Sbjct  85   ALEVSQWMSSN-RLCNFSPSDDAVRLDLIGKVHGLESAESYFKNLDEKDKIHKTYGALLN  143

Query  573  AYVRVGMREKA  605
             YVR G+ EK+
Sbjct  144  CYVRGGLVEKS  154



>ref|XP_006451898.1| hypothetical protein CICLE_v10007647mg [Citrus clementina]
 gb|ESR65138.1| hypothetical protein CICLE_v10007647mg [Citrus clementina]
Length=681

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P    + VL+Q   EG++IS LEL  ++R+LR   R   AL+V EWM+ +
Sbjct  39   LYSRISPLGDPDVSLTPVLDQWVLEGQKISELELQRIIRQLRSRKRFKHALQVSEWMSGQ  98

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +   D A+QLDLI KV G+ +AE YF +L +  K  ++YG+LLN YVR G+ +++
Sbjct  99   GLAFSV--RDHAVQLDLIGKVRGLESAETYFNSLNDEDKVDKLYGALLNCYVREGLVDES  156

Query  606  ESLF  617
             SL 
Sbjct  157  LSLM  160



>ref|XP_009610168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=498

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = +3

Query  240  GIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMN  419
            G +Y+R+S +   +   +  +N+   EG+ + + EL   +++LRK+ R+  ALE+ EWM 
Sbjct  34   GRLYRRLSALGATKGSVTETINEYMREGRVVKKYELEKCIKELRKYKRYQHALEIMEWME  93

Query  420  DRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMRE  599
             R     ++  D  ++LDLI+KV GI+ AE YF  L  S++++  YG+LLN Y    M +
Sbjct  94   KRG--INLSFGDYGVRLDLIAKVQGITAAENYFGGLSPSMQNQSTYGALLNCYCVEKMTD  151

Query  600  KAESLFD  620
            KA SLF+
Sbjct  152  KALSLFE  158



>ref|XP_009357845.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=505

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RI +I  P+     VL Q   EG+ + + +L  +VR L+ F R + ALE+ +WM DR
Sbjct  46   LHDRIKVIRDPKASVLPVLEQWVSEGQAVEKQQLQSLVRLLKDFRRFNHALEISQWMTDR  105

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + ++ SD A +L+LI +VHG+ +AE YF  LP SLK    YG+LL  YV+    EKA
Sbjct  106  -RYFDLSPSDAAARLNLIHRVHGLDHAENYFNNLPKSLKSLNAYGALLCIYVQERSVEKA  164

Query  606  ES  611
            E+
Sbjct  165  EA  166



>ref|XP_010939721.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, 
mitochondrial [Elaeis guineensis]
Length=409

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 96/169 (57%), Gaps = 8/169 (5%)
 Frame = +3

Query  132  NPLKSRRKGL------AITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGAS  293
            NP+ +  +GL      ++ C S S       +  E+ P  +   +  R+  + +P++ A+
Sbjct  18   NPMATHLRGLPFSHLESLRCFSSSPSRGEA-LAVEEEPAASPDDLRSRLFRLRFPKRSAT  76

Query  294  TVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLD  473
              L++   EG++++  EL  + + L++  R+  ALE+ EWM    E  +++ SD A+++D
Sbjct  77   AALDKWVGEGRKVTASELRQIAKDLKRSQRYKHALEISEWMKTHQES-ELSDSDYAMRID  135

Query  474  LISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            LI+KV G+++AE +F  LP S K   +Y +LL++Y    + E+AE LF+
Sbjct  136  LITKVFGVNSAENFFQGLPPSAKSCEVYTALLHSYAAAKLTEQAEDLFE  184



>gb|KFK30887.1| hypothetical protein AALP_AA6G038700 [Arabis alpina]
Length=533

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + Q ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  67   RLLSLTYTKRSAVVTIRQWKEEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  125

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             ++   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  126  IQLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  185

Query  615  F  617
            F
Sbjct  186  F  186



>ref|NP_192191.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SY07.1|PP302_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15353.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77767.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82233.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=532

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  66   RLLSLVYTKRSAVVTIRKWKEEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVVQ-ED  124

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  125  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  184

Query  615  FD  620
            F+
Sbjct  185  FE  186



>ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=504

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS    P      +L +  +EG  + + EL   V++LRK+ R   AL+V EWM D+
Sbjct  41   LYGRISKAGKPSISIVPILEKWLEEGNDVKKPELQKFVKQLRKYRRFTHALQVSEWMTDK  100

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
             +   +   D A++LDLISKVHG+  AE+YF ++P++ +DR++YG+LLN      +  KA
Sbjct  101  -KGCSLLPGDVAVRLDLISKVHGLVKAEEYFNSIPDTSRDRQVYGALLNCCAHSKLLGKA  159

Query  606  ES  611
            E+
Sbjct  160  EA  161



>emb|CDO97403.1| unnamed protein product [Coffea canephora]
Length=409

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI+ +  P++ A+ VL++   EG RI+  +L  + + LRK  R+  ALE+ EWM    E 
Sbjct  63   RITRLRLPKRSATNVLHRWVSEGNRITISDLRQISKDLRKSQRYKHALEISEWMVAHDE-  121

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            ++++ SD A+ +DL++KV GI  AE+YF  LP S K    Y +LL++Y    + EKAE L
Sbjct  122  FELSDSDYAVCIDLMTKVFGIDAAERYFEGLPPSAKTCETYTALLHSYAASKLTEKAEDL  181

Query  615  FD  620
            FD
Sbjct  182  FD  183



>gb|AAL32523.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO00924.1| Unknown protein [Arabidopsis thaliana]
Length=532

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  66   RLLSLVYTKRSAVVTIRKWKEEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVVQ-ED  124

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  125  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  184

Query  615  FD  620
            F+
Sbjct  185  FE  186



>ref|XP_010091037.1| hypothetical protein L484_006401 [Morus notabilis]
 gb|EXB42055.1| hypothetical protein L484_006401 [Morus notabilis]
Length=464

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +3

Query  273  YPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTS  452
            YP++ A   + + ++EG+ + + EL  VV++LRK  R+  ALE+CEWM    +  K+   
Sbjct  2    YPKRSAVIAIRKWKEEGRTVRKFELSHVVKELRKRRRYKHALEICEWMTQEKD-IKLQAG  60

Query  453  DTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            D A+ LDL++KV GI  AEK+F  L   + D   + +LLN YV+  +  KAE+L 
Sbjct  61   DYAVHLDLVAKVRGIHRAEKFFEDLLGPMADHSTHSTLLNIYVQNNLSAKAEALM  115



>ref|XP_004290659.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=520

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A+  + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + +
Sbjct  43   RRLLSLVYAKRSAAVTIGKWKEEGGTVRKYELNRIVRELRKLRRYKHALEICEWMTLQKD  102

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A++LDLI+KV G+++AEK+F  LP  ++D     +LL+ YV+     KAE+
Sbjct  103  -IKLLAGDYAVELDLIAKVRGMNSAEKFFEDLPEQMRDGITCSALLHTYVQNKESAKAEA  161

Query  612  LFD  620
            LF+
Sbjct  162  LFE  164



>gb|KJB79603.1| hypothetical protein B456_013G057100 [Gossypium raimondii]
Length=393

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A++V+ +   EG RIS  +L  + + LRK  R   ALE+ EWM    E 
Sbjct  48   RIFRLRLPKRSATSVIEKWVGEGNRISISDLRQISKDLRKSQRFKHALEISEWMVSH-EE  106

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            YK++ +D AI++DL++KV GI  AE+YF  LP + K    Y +LL++Y    + EKAE L
Sbjct  107  YKLSDTDYAIRIDLMTKVFGIDAAERYFEDLPLTAKTSETYTALLHSYAAAKLTEKAEEL  166

Query  615  FD  620
            ++
Sbjct  167  YE  168



>ref|XP_009629681.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=477

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 1/124 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RI+ +  P+     VL Q   EG ++ R EL +++++LR + R+  ALEV  WM DR
Sbjct  42   VYARIAPLGSPEVSMVPVLEQWVKEGNQVLRSELQWIIKRLRSYKRYKHALEVSHWMTDR  101

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +  +D A ++DL+ KV G+   EKYF + P  LK   +Y SLLN Y      EKA
Sbjct  102  -RYFSVQPADVATRIDLMYKVKGLEEVEKYFNSTPQKLKRLTVYTSLLNCYTSEKSAEKA  160

Query  606  ESLF  617
            E+L 
Sbjct  161  EALM  164



>ref|XP_010099567.1| hypothetical protein L484_011573 [Morus notabilis]
 gb|EXB79633.1| hypothetical protein L484_011573 [Morus notabilis]
Length=515

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  249  YKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            ++RI +I  P+     VL Q  DEG+ I + EL ++VR ++ F R + ALE+  WM D +
Sbjct  52   FQRIQVIRDPKASVLPVLRQWVDEGRPIGKTELGWLVRTMKDFRRFNHALEISLWMTD-S  110

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
               +I+ SD AI+LDLI +VHG+  AE YF ++   L+ R  Y +LL +YVR    EKA+
Sbjct  111  RFLRISPSDAAIRLDLIYRVHGLERAENYFNSVSRKLRTRSAYVALLRSYVRENSVEKAK  170

Query  609  S  611
            +
Sbjct  171  A  171



>ref|XP_007203456.1| hypothetical protein PRUPE_ppa022158mg, partial [Prunus persica]
 gb|EMJ04655.1| hypothetical protein PRUPE_ppa022158mg, partial [Prunus persica]
Length=485

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +         +L++  +EG    + +L+ ++++LR+F  +  ALEV  WM D+
Sbjct  48   LYGRISRVGDRNACILPILDEWIEEGGNAEKDDLVTIIKELRQFKYYKHALEVSMWMTDK  107

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + +  +D AI+LDLISKVHGI  AE YF  +P  LK   +Y +LLN Y  V + EKA
Sbjct  108  -RYFSLMKADVAIRLDLISKVHGIEQAENYFENIPKQLKALEVYCTLLNCYAHVKLVEKA  166

Query  606  ES  611
            E+
Sbjct  167  EA  168



>ref|XP_006481674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Citrus sinensis]
Length=518

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 73/123 (59%), Gaps = 3/123 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++RIS +  P      +LNQ  +EG  + + +L   ++KLR F R   ALE+  WM D+
Sbjct  48   LFRRISPMGNPNVSIVPLLNQWVEEGHPVDKQQLQRFIKKLRFFSRFTHALEISMWMTDK  107

Query  426  AERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
              RY  IT +D A++LDLI+KV GI  AE YF  +P  +K   +Y +LLN Y  V   +K
Sbjct  108  --RYLNITAADAAVRLDLIAKVKGIEEAENYFSYIPEKIKGLEVYSALLNCYSNVKSTDK  165

Query  603  AES  611
            AE+
Sbjct  166  AEA  168



>gb|KHG20865.1| hypothetical protein F383_27144 [Gossypium arboreum]
 gb|KHG20987.1| hypothetical protein F383_28000 [Gossypium arboreum]
Length=393

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A+TV+ +   EG R+S  +L  + + LRK  R   ALE+ EWM    E 
Sbjct  48   RIFQLRLPKRSATTVIEKWVGEGNRVSISDLRQISKDLRKSQRFKHALELSEWMVSH-EE  106

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            YK++ +D A+++DL++KV GI  AE+YF  LP + K    Y +LL++Y    + EKAE L
Sbjct  107  YKLSDTDYAVRIDLMTKVFGIDAAERYFEDLPLTAKTSETYTALLHSYAAAKLTEKAEEL  166

Query  615  F  617
            +
Sbjct  167  Y  167



>ref|XP_010422532.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Camelina sativa]
Length=532

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  66   RLLGLTYTKRSAVVTIRKWREEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  124

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  125  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  184

Query  615  FD  620
            F+
Sbjct  185  FE  186



>ref|XP_010455929.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Camelina sativa]
Length=533

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  67   RLLGLTYTKRSAVVTIRKWREEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  125

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  126  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  185

Query  615  FD  620
            F+
Sbjct  186  FE  187



>emb|CDP14775.1| unnamed protein product [Coffea canephora]
Length=534

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ R+  +  P+     VL +  DEG+ +    +  +++  R + R+  AL V EW+N  
Sbjct  71   LFTRLVRVRKPKDSVPQVLQKWVDEGREVDLDNVRIIIKYFRSYKRYSYALPVSEWINS-  129

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
             +  K+  +D A+ LDLI+KVHG+  AEKYF +LP++L+  + YG+LLN YV+     KA
Sbjct  130  IQHSKLKPADAAVHLDLIAKVHGLEQAEKYFESLPDNLRVIQTYGALLNCYVKFKSLRKA  189

Query  606  ESL  614
            E +
Sbjct  190  EEI  192



>ref|XP_010430409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Camelina sativa]
Length=532

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  66   RLLGLTYTKRSAVVTIRKWREEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  124

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  125  IKLQAGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  184

Query  615  FD  620
            F+
Sbjct  185  FE  186



>ref|XP_011079543.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Sesamum indicum]
Length=500

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 74/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +   +   ++ +N+   EG+ + + EL   V++LRK+ R+  ALE+ EWM  R
Sbjct  38   LYRRLSKLGRNEGAVASTINEYIREGRPVKKFELDLCVKELRKYKRYSHALEIIEWMEAR  97

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              ++     D A++LDLI K  G++ AE YF  L  S K    YGSLLN Y +V M +KA
Sbjct  98   --KFNFGHKDCAVRLDLIGKARGLAAAENYFSGLSPSAKVPCTYGSLLNCYCKVKMTDKA  155

Query  606  ESLF  617
             +LF
Sbjct  156  LNLF  159



>ref|XP_003536907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Glycine max]
Length=516

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISR-LELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            +R+  + YP++ A   +N+ ++EG    R  +L  +VR+LRK  R+  ALEVCEWM  + 
Sbjct  48   RRLLSLVYPKRSAVVAINKWKEEGHEPPRKYQLNRIVRELRKDKRYKHALEVCEWMTLQK  107

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
            +  K+   D A+ LDLI+KV G+++AEK+F  LP+ ++ ++   +LL+AYV+  + +KAE
Sbjct  108  D-MKLVQGDYAVHLDLITKVRGLNSAEKFFEDLPDRMRGKQTCSALLHAYVQNNLVDKAE  166

Query  609  SLF  617
            +L 
Sbjct  167  ALM  169



>ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX94786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=513

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + YP++ A   + + ++EG+ + + EL  VVR+LRK  R+  ALE+CEWM  + + 
Sbjct  48   RLIGLVYPKRSAVVTIRKWQEEGRTVRKYELNRVVRELRKLKRYKHALEICEWMRLQQD-  106

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLI+KV G+++AEK+F  LP+ ++ +    +LL+ YV+  +  KAE+L
Sbjct  107  IKLLPGDYAVHLDLIAKVRGLASAEKFFEDLPDQMRGQATCTALLHTYVQNKLFAKAETL  166

Query  615  F  617
             
Sbjct  167  M  167



>ref|XP_011029462.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like isoform X1 [Populus euphratica]
Length=500

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P+   + VL Q  +EGK++   EL  +V+ LR+  R   ALEV +WM+  
Sbjct  36   LYSRISPLGDPRISLAPVLEQWVEEGKKVKDYELRTIVKGLRERKRFKQALEVSQWMSSN  95

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                  + SD A++LDLI KVHG+ +AE YF  L    K  + YG+LLN YVR G+ EK+
Sbjct  96   -RLCNFSPSDHAVRLDLIGKVHGLESAESYFKNLDEKDKIHKTYGALLNCYVRSGLVEKS  154



>ref|XP_002301516.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80789.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=511

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +       S  LN+   EG + S++ L   ++KLRK+GR   A+EV EWM  R
Sbjct  36   MYRRLSELGASGGSVSKTLNELILEGGKTSKINLTTCIKKLRKYGRFDHAIEVMEWMQKR  95

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              +   +  D A+ LDL +K  GI+ AE YF  LP S+++   Y +LLN Y +  M EKA
Sbjct  96   --KMNFSHVDHAVYLDLTAKTKGIAAAENYFDNLPPSVQNHVTYSTLLNCYCKERMSEKA  153

Query  606  ESLFD  620
             +LF+
Sbjct  154  LTLFE  158



>gb|ACU24296.1| unknown [Glycine max]
Length=484

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 5/130 (4%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            PN   +Y+ +S ++      S  L+Q   EGK I + EL   V +LRK+ R   ALE+ E
Sbjct  28   PN---LYRMLSALDITGGTVSQTLDQYIMEGKVIKKPELERCVEQLRKYRRFQHALEIIE  84

Query  411  WMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVG  590
            WM  R  +   + S+ A+QLDL+SK  G+  AE +F  LP   K+R  YG+LLN Y +  
Sbjct  85   WMEIR--KVNFSWSNYAVQLDLVSKTKGVDAAENFFGGLPPPAKNRYTYGALLNCYCKEL  142

Query  591  MREKAESLFD  620
            M++KA S FD
Sbjct  143  MKDKALSHFD  152



>gb|KHN16203.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=476

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+ +S ++      S  L+Q   EGK I + EL   V +LRK+ R   ALE+ EWM  R
Sbjct  30   LYRMLSALDITGGTVSQTLDQYIMEGKVIKKPELERCVEQLRKYRRFQHALEIIEWMEIR  89

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              +   + S+ A+QLDL+SK  G+  AE +F  LP   K+R  YG+LLN Y +  M++KA
Sbjct  90   --KVNFSWSNYAVQLDLVSKTKGVDAAENFFGGLPPPAKNRYTYGALLNCYCKELMKDKA  147

Query  606  ESLFD  620
             S FD
Sbjct  148  LSHFD  152



>ref|XP_006287476.1| hypothetical protein CARUB_v10000687mg [Capsella rubella]
 gb|EOA20374.1| hypothetical protein CARUB_v10000687mg [Capsella rubella]
Length=532

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + E 
Sbjct  66   RLLGLTYTKRSAVVTIRKWREEGHSVRKYELNRIVRELRKIKRYKHALEICEWMVLQ-ED  124

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLISK+ G+++AEK+F  +P+ ++      SLL++YV+  + +KAE+L
Sbjct  125  IKLQPGDYAVHLDLISKIRGLNSAEKFFEDMPDQMRGHAACTSLLHSYVQNKLSDKAEAL  184

Query  615  FD  620
            F+
Sbjct  185  FE  186



>gb|ABR18022.1| unknown [Picea sitchensis]
Length=561

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+RIS +  P++ A   L +   EG+ + +  L  +VR+LRK+ RH  ALEV EWM   
Sbjct  96   LYRRISRLGDPKRSAVEELERWITEGREVKKWVLREIVRELRKYYRHKHALEVFEWM---  152

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
            ++++  +  D A+ L LI+KVHGI++AEKY++ L +  K+   Y +LLN YV+    EK+
Sbjct  153  SKKFPCSVGDRAMHLGLIAKVHGIASAEKYYVDLHHYEKNHLTYFALLNCYVQEKNIEKS  212

Query  606  ESLFD  620
            E++ +
Sbjct  213  EAIME  217



>ref|XP_004155478.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=259

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 80/124 (65%), Gaps = 3/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++++ +L  ++++LR FGR + AL++CEW  +R
Sbjct  38   LFRRVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRTFGRFNHALQLCEW--ER  95

Query  426  AERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+ YV     +K
Sbjct  96   NERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLHCYVENKNLKK  155

Query  603  AESL  614
            AE++
Sbjct  156  AEAI  159



>ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
 gb|EMJ00188.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
Length=511

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 82/139 (59%), Gaps = 1/139 (1%)
 Frame = +3

Query  201  GTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFG  380
             T   EK        + +R+  + +P++ A   + + ++EG ++ + EL  +VR+LRK  
Sbjct  27   ATASVEKSSSGGRDTLGRRLMSLVFPKRSAVIAIRKWKEEGHKVRKYELNRIVRELRKLK  86

Query  381  RHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYG  560
            R+  ALE+CEWM  + +  K+   D A+ LDLI+KV G+++AEK+F  LP+ +       
Sbjct  87   RYKHALEICEWMTLQQD-MKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDQMTGHPTCT  145

Query  561  SLLNAYVRVGMREKAESLF  617
            +LL+ YV+  + +KAE+L 
Sbjct  146  ALLHTYVQNKLSDKAEALM  164



>ref|XP_008229146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=506

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  249  YKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            + RI +I  P+     VL Q   EG  + + EL  +VR L+ F R + ALE+ +WM DR 
Sbjct  47   HDRIKVIRDPKASVLPVLEQWVTEGGAVEKQELQSLVRLLKDFRRFNHALEISQWMTDR-  105

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
              + ++ SD A +L+LI +VHG+ +AEKYF  +  +LK    YG+LL+ YV+    EKAE
Sbjct  106  RYFDLSPSDAAARLNLIHRVHGLEDAEKYFNNMSKNLKSVNAYGALLSIYVQENSVEKAE  165

Query  609  S  611
            +
Sbjct  166  A  166



>ref|XP_009401682.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=546

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = +3

Query  225  PMP-NW-GIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLAL  398
            P+P  W   +Y R++    P++    +L +   EG+ + + +L  +V+K+R F R+  AL
Sbjct  41   PLPKGWHDCLYNRVAASGDPRRSIVPLLERWVQEGRPVDQSDLREMVKKMRSFRRNFHAL  100

Query  399  EVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  578
            E+  WM+DR   + ++  D A +LDLI KVHG+  AE +F  LP  LK  +++G+LL+ Y
Sbjct  101  EISTWMSDR-RYFCLSPGDVADRLDLIKKVHGLEQAESFFGNLPKQLKVYQVHGALLSCY  159

Query  579  VRVGMREKAESLF  617
            V+    EKAE+ F
Sbjct  160  VQDKCVEKAEAFF  172



>ref|XP_003590654.1| WD repeat-containing protein [Medicago truncatula]
Length=562

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISR-LELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            +R+  + YP++ A   +N+ ++EG  + R  +L  ++R+LRK  R+  ALEVCEWM  + 
Sbjct  40   RRLLSLVYPKRSAVIAINKWKEEGHTLPRKYQLNRMIRELRKNKRYKHALEVCEWMKLQN  99

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
            +  K+   D A+QLDLI+KV G+++AEK+F  LP+ ++ +    +LL+AYV+  +  KAE
Sbjct  100  D-IKLVEGDYAVQLDLITKVRGLNSAEKFFEDLPDKMRGQPTCTALLHAYVQNNLTNKAE  158

Query  609  SLF  617
            +L 
Sbjct  159  ALM  161



>ref|XP_006399423.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum]
 gb|ESQ40876.1| hypothetical protein EUTSA_v10013686mg [Eutrema salsugineum]
Length=410

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A+TVL +   EG +IS  EL ++ R+L++  R+  ALE+ EWM    E 
Sbjct  62   RIFRLRLPKRSATTVLEKWAGEGNQISVTELRYISRELKRTRRYKHALEIIEWMVHHEES  121

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             KI+ +D A ++DLISKV GI  AE+YF  L  + K    Y SLL+AY      E+AE+L
Sbjct  122  -KISDADYASRIDLISKVFGIDAAERYFEGLHLASKTTETYTSLLHAYAGSKQTERAEAL  180

Query  615  F  617
            F
Sbjct  181  F  181



>gb|AES60905.2| PPR containing plant protein [Medicago truncatula]
Length=512

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISR-LELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            +R+  + YP++ A   +N+ ++EG  + R  +L  ++R+LRK  R+  ALEVCEWM  + 
Sbjct  40   RRLLSLVYPKRSAVIAINKWKEEGHTLPRKYQLNRMIRELRKNKRYKHALEVCEWMKLQN  99

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
            +  K+   D A+QLDLI+KV G+++AEK+F  LP+ ++ +    +LL+AYV+  +  KAE
Sbjct  100  D-IKLVEGDYAVQLDLITKVRGLNSAEKFFEDLPDKMRGQPTCTALLHAYVQNNLTNKAE  158

Query  609  SLF  617
            +L 
Sbjct  159  ALM  161



>ref|XP_006349176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Solanum tuberosum]
Length=495

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +   +   +  +N    EG+ + + EL   +++LRK+ R+  ALE+ EWM  R
Sbjct  34   LYRRLSALGATKGSVTETINAYTREGRVVKKYELEKCIKELRKYKRYQHALEIMEWMEKR  93

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               +  +  D  ++LDLI+KV GI+ AEKYF  L  S++++  YG+LLN Y    M +KA
Sbjct  94   GINF--SYGDYGVRLDLIAKVQGITAAEKYFGGLSPSMQNQSTYGALLNCYCVEKMADKA  151

Query  606  ESLFD  620
             S F+
Sbjct  152  LSFFE  156



>ref|XP_007051132.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX95289.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=501

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 79/149 (53%), Gaps = 4/149 (3%)
 Frame = +3

Query  171  CASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELL  350
            C + S+            PM N   +Y R+S +       S  LN    EGK+I + EL 
Sbjct  18   CTATSEKAKIKAAVAAASPMRN--RLYPRLSALAATGGTVSEALNDFIMEGKKIRKDELG  75

Query  351  FVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLP  530
              V++LRK+ R+  AL++ +WM  R     ++  D AI+LDLI+K  GI  AE Y   LP
Sbjct  76   RCVKELRKYRRYQHALDIMDWMERR--NLHLSHVDHAIRLDLIAKTKGIDAAENYLSALP  133

Query  531  NSLKDRRIYGSLLNAYVRVGMREKAESLF  617
             S K++  YG+LLN Y    M++KA SLF
Sbjct  134  PSAKNQLTYGALLNCYCNNLMKDKASSLF  162



>ref|XP_002527601.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34782.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=502

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RIS +  P      VL+    EGK+I   EL  ++R LR   R+  AL+V EWMN +
Sbjct  37   LFARISPLGEPDISLVPVLDNWVQEGKKIRGFELQKIIRDLRCHRRYTQALQVSEWMNGK  96

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
             +    + +D A+QLDLI +V G+ +AE YF  L N  ++ + YG+LLN YVR G+ +K+
Sbjct  97   GQS-GFSPADHAVQLDLIGRVRGLESAESYFQNLVNQDRNDKTYGALLNCYVREGLVDKS  155



>ref|XP_002322749.2| hypothetical protein POPTR_0016s06320g [Populus trichocarpa]
 gb|EEF04510.2| hypothetical protein POPTR_0016s06320g [Populus trichocarpa]
Length=522

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 2/133 (2%)
 Frame = +3

Query  219  KRPMPN-WGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLA  395
            K+P  +   ++Y RIS +   +   S  LN    EG+ +++ +L   +++LR   R+  A
Sbjct  51   KKPWTDAMNVLYNRISSLADQRITISLFLNHWVLEGQPVNKNQLREFIKELRFHKRYAHA  110

Query  396  LEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  575
            LE+  WM D    +++ + D A+QLDLISKVHGI  A+K F   P  LK  ++Y +LLN 
Sbjct  111  LEISTWMTDSG-YFELASQDVAVQLDLISKVHGIEQAQKLFNNTPQHLKVLKVYSALLNC  169

Query  576  YVRVGMREKAESL  614
            Y +  + EKAES+
Sbjct  170  YAKAKLVEKAESV  182



>ref|XP_009627474.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=506

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDL  476
            VL+Q   E K +   +L  + ++LR + R + AL++ EW+N +++ + I + D A+QLDL
Sbjct  77   VLDQWVSEEKPLKHEDLQIIAKQLRAYRRFNHALQIYEWIN-KSKHFDILSGDVAVQLDL  135

Query  477  ISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
            +SK HG+  AEKYF ++P++L+  R+YG+LLN Y      +KAE
Sbjct  136  VSKSHGVKAAEKYFASVPDNLRTYRVYGALLNVYADAKCLKKAE  179



>ref|XP_004229380.2| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Solanum lycopersicum]
Length=509

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +   +   +  +N    EG+ + + EL   +++LRK+ R+  ALE+ EWM  R
Sbjct  48   LYRRLSALGATKGSVTETINAYTREGRVVKKYELEKCIKELRKYKRYQHALEIMEWMEKR  107

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                  +  D  ++LDLI+KV GI+ AEKYF +L  S++++  YG+LLN Y    M +KA
Sbjct  108  G--INFSYGDYGVRLDLIAKVQGITAAEKYFGSLSPSMQNQSTYGALLNCYCVEKMTDKA  165

Query  606  ESLFD  620
             + F+
Sbjct  166  LTFFE  170



>ref|XP_008812226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, 
mitochondrial [Phoenix dactylifera]
Length=409

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 97/181 (54%), Gaps = 20/181 (11%)
 Frame = +3

Query  84   PNL--LPFPSGFSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKR  257
            PNL  LPF S   +L   +   SR + LA+                E+ P      +  R
Sbjct  22   PNLRALPF-SHLESLRCFSSGPSRGEALAV----------------EEEPTGPPDDLRSR  64

Query  258  ISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERY  437
            +  + +P++ A+  L++   EG++++  EL  + + L++  R+  ALE+ EWM    E  
Sbjct  65   LFRLRFPKRSATAALDKWVGEGRKVTTTELRQIAQDLKRSQRYKHALEISEWMKTHQES-  123

Query  438  KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            +++ SD A+++DL++KV G++ AE +F  LP + K   +Y +LL++Y    + EKAE LF
Sbjct  124  ELSDSDYAMRIDLVTKVFGVNAAEDFFQRLPPTAKSCEVYMALLHSYAAAKLTEKAEDLF  183

Query  618  D  620
            +
Sbjct  184  E  184



>ref|XP_011039574.1| PREDICTED: uncharacterized protein LOC105136086 [Populus euphratica]
Length=1072

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 2/133 (2%)
 Frame = +3

Query  219  KRPMPN-WGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLA  395
            K+P  +   ++Y RIS +   +   S  LNQ   EG+ +++ +L   +++LR   R+  A
Sbjct  51   KKPWTDAMNVLYNRISSLADQRITISLFLNQWVLEGQPVNKNQLREFIKELRFHKRYAHA  110

Query  396  LEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  575
            LE+  WM D    +++ + D A+QLDLIS VHGI  A+K F   P  LK  ++Y +LLN 
Sbjct  111  LEISTWMTDSG-YFELASQDVAVQLDLISNVHGIEQAQKLFNNTPQHLKVLKVYSALLNC  169

Query  576  YVRVGMREKAESL  614
            Y +  + EKAES+
Sbjct  170  YAKAKLAEKAESV  182


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERY-KITTSDTAIQLD  473
            VL++   EG+ I    +  ++++LR + R+H ALE+  WM D+  RY  +T+   A++LD
Sbjct  621  VLDKWIQEGETIWEDLIHALIKELRHYRRYHHALEISMWMTDK--RYLALTSRAVAVRLD  678

Query  474  LISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            LISKVHGI   E YF  +P  LK    YG+LLN Y  V   EKAE++ 
Sbjct  679  LISKVHGIEQVENYFNNIPTKLKGLESYGALLNCYAYVKSVEKAEAVM  726



>ref|XP_009368491.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=481

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +3

Query  276  PQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSD  455
            P+     VL+Q  +EG+ + R EL   +++LRKF R+  AL++ EWM+D    + +   D
Sbjct  56   PRVSILPVLHQWLEEGRNVERSELQDFIKQLRKFRRYTQALQIAEWMSDEL-NHDLHPGD  114

Query  456  TAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
             AI+L+LISKV G+  AEKYF ++P  L+  ++ G+LL+ Y      EKAE+LF+
Sbjct  115  IAIRLELISKVRGLEEAEKYFYSIPELLRVVQVCGALLSCYAEHNCLEKAEALFE  169



>ref|XP_011032725.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
 ref|XP_011032726.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
Length=513

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALEVCEWM  +++
Sbjct  44   RRLFSLVYGKRSAVITIRKWKEEGHNVRKYELNRIVRELRKLKRYKHALEVCEWMTKQSD  103

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+K+ G+++AEK+F  +P+ ++D +   +LL+ YV+     KAE+
Sbjct  104  -IKLVPGDYAVHLDLIAKIRGLNSAEKFFEDIPDKMRDYQACSALLHVYVQNKSISKAEA  162

Query  612  LFD  620
            L +
Sbjct  163  LME  165



>ref|XP_002307578.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE94574.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=513

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALEVCEWM  +++
Sbjct  44   RRLFSLVYGKRSAVITIRKWKEEGHNVRKYELNRIVRELRKLKRYKHALEVCEWMTKQSD  103

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+K+ G+++AEK+F  +P+ ++D +   +LL+ YV+     KAE+
Sbjct  104  -IKLVPGDYAVHLDLIAKIRGLNSAEKFFEDIPDKMRDYQACSALLHVYVQNKSISKAEA  162

Query  612  LFD  620
            L +
Sbjct  163  LME  165



>emb|CDP14776.1| unnamed protein product [Coffea canephora]
Length=491

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 3/130 (2%)
 Frame = +3

Query  225  PMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEV  404
            P PN   ++KRI     PQ     +L+Q   EG+ + R EL  + + LRK  R+  AL+ 
Sbjct  36   PSPN--TLFKRILPAGDPQVSIVPILDQWVREGRPVHRSELKTIFKILRKNRRYTHALQA  93

Query  405  CEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVR  584
            C     R +   ++  D A++LDLISKVHG+  AE YF  +P+SLK  ++YGSLLN Y +
Sbjct  94   CLLGYAR-KISNLSPEDVAVRLDLISKVHGLQEAENYFFNVPDSLKTFKVYGSLLNCYAK  152

Query  585  VGMREKAESL  614
              + E+AE++
Sbjct  153  KKLVEQAEAI  162



>ref|XP_010062875.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Eucalyptus grandis]
 gb|KCW70018.1| hypothetical protein EUGRSUZ_F03326 [Eucalyptus grandis]
Length=480

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 1/124 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RIS I  P+K    VL++  +EG ++  L+L  ++R LR   R+  AL+V EWM+ +
Sbjct  39   LFSRISPIGDPKKSVVPVLDKWVEEGNKVKGLDLKRIIRDLRSRRRYTHALQVAEWMSSK  98

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
             E   +T +D A++LDLI KV G+  AE YF  L +  K  + YG+LLN YVR    +K+
Sbjct  99   TEGL-LTPADHALKLDLIGKVQGLDVAENYFNNLRDQDKVEKTYGALLNCYVRECATDKS  157

Query  606  ESLF  617
             SL 
Sbjct  158  LSLL  161



>ref|XP_011087932.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, 
mitochondrial-like [Sesamum indicum]
Length=404

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++  + VL +   EG  I+  +L  + R LR+  R+  ALE+ EWM +  E 
Sbjct  56   RIFRLRLPKRSVTNVLQKWVSEGNNITVADLRSISRDLRRSHRYKHALEISEWMVNHDE-  114

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
            Y ++ +D AI++DL++KV GI  AE+YF  LP+S K    Y +LL++Y  + + EKAE L
Sbjct  115  YHLSDTDYAIRIDLMTKVFGIDAAERYFQALPSSAKTTETYTALLHSYAGLKLIEKAEEL  174

Query  615  FD  620
            ++
Sbjct  175  YE  176



>ref|XP_003567580.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Brachypodium distachyon]
Length=545

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 2/139 (1%)
 Frame = +3

Query  204  TVDYEKRPMPNWGIIYKRISMIEYPQKGA-STVLNQCEDEGKRISRLELLFVVRKLRKFG  380
             VD  K    +   +Y+R+S +    +G+ S VLN+   EG+    ++L   V++LRK+ 
Sbjct  66   AVDANKAVTKDSRPLYRRLSALGNAGEGSVSRVLNKWVREGREARSVDLERYVKELRKYK  125

Query  381  RHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYG  560
            RH  ALE+ +WM    +   ++ ++ AI+LDL+ KV GI  AEKYF  LP+  K+ R YG
Sbjct  126  RHAQALELMDWMV-HTKGMNMSYTNHAIRLDLVYKVRGIEAAEKYFNGLPDPAKNHRTYG  184

Query  561  SLLNAYVRVGMREKAESLF  617
            +LLN Y      EKA  LF
Sbjct  185  ALLNCYCSSKKEEKATDLF  203



>ref|XP_009387580.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150, 
partial [Musa acuminata subsp. malaccensis]
Length=377

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  402  VCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYV  581
            V  WM  + +R+ +T+SD AIQLDLI+KVHGIS+AE +F  LP++LKD+R YG+LLN Y 
Sbjct  1    VYNWMAAQGDRFTLTSSDMAIQLDLIAKVHGISHAEDHFSNLPDNLKDKRTYGALLNVYG  60

Query  582  RVGMREKAESLFD  620
            +  + +KAE++ +
Sbjct  61   QAKIEDKAEAIME  73



>gb|KDP21467.1| hypothetical protein JCGZ_21938 [Jatropha curcas]
Length=515

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 75/123 (61%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + + + EG  + + +L  +VR+LRK  R+  ALEVCEWM    E
Sbjct  48   RRLFSLAYAKRSAVIAIQKWKSEGHSVQKYQLNRIVRELRKLKRYKHALEVCEWMTQERE  107

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL+ YV+  +  KAE+
Sbjct  108  -IKLLPGDYAVHLDLIAKVRGLNSAEKFFEDLPDEMRGWHTCTALLHTYVQFKLLSKAEA  166

Query  612  LFD  620
            L +
Sbjct  167  LME  169



>ref|XP_006347050.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Solanum tuberosum]
Length=478

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 89/169 (53%), Gaps = 10/169 (6%)
 Frame = +3

Query  111  FSTLTLLNPLKSRRKGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGA  290
            FS L   NP+  +R         I++ +   +   +K    +W  ++ RI+ +  P    
Sbjct  6    FSALRKQNPIHFQR-------TIINRFYGTTSTKQDKNQKRDW--VFARIAPLGSPDVSM  56

Query  291  STVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQL  470
              VL Q  +EGK + + EL +++++L  + R+  ALEV  WM DR   Y +  +D A ++
Sbjct  57   VPVLEQWVEEGKTVVKSELQWIIKRLNSYKRYKHALEVSHWMTDR-RYYPLQPADVAARI  115

Query  471  DLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLF  617
            +L++KV G+   EKYF ++P  L+   +Y +LLN Y      EKAE++ 
Sbjct  116  NLMNKVKGLEEVEKYFNSIPQMLRRPEVYTALLNCYTNEKSVEKAEAIM  164



>ref|XP_009382489.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01990, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=519

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 78/126 (62%), Gaps = 2/126 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGAST-VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMND  422
            +Y+R+S +     G+ T  LN+   EG+ ++  +L+  V++LRK+ R+  ALE+ EWM+ 
Sbjct  54   LYRRLSALGRAPAGSVTKTLNKWLREGRTVTATQLMKYVKELRKYNRYSHALELMEWMSG  113

Query  423  RAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
                  I+ ++ AI+LDLISKV G  +AE+YF  LP   K+ R YGSLLN Y      +K
Sbjct  114  -TRGMNISYTNHAIRLDLISKVKGTESAEEYFSQLPEPAKNERTYGSLLNCYCSGKNADK  172

Query  603  AESLFD  620
            A SL++
Sbjct  173  AISLYN  178



>gb|KCW49953.1| hypothetical protein EUGRSUZ_K03412 [Eucalyptus grandis]
Length=470

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + +
Sbjct  13   KRLLSLVYAKRSAVVTIRKWKEEGGAVRKYELNRIVRELRKLKRYKHALEICEWMRLQQD  72

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL++Y +  +  KAE+
Sbjct  73   -IKLLAGDYAVHLDLIAKVRGLNSAEKFFEDLPSQMRGEHTCNALLHSYAKKQLSSKAEA  131

Query  612  LFD  620
            L +
Sbjct  132  LIE  134



>ref|XP_003526072.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Glycine max]
Length=492

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y RIS +  P      VL++  +EG  +    L  +++ LR   R+  ALEV EWM+ +
Sbjct  34   LYSRISPLGDPSISVVPVLDEWIEEGNAVDGPHLHHIIKILRTRNRNTQALEVSEWMSSK  93

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                 I++ D A+QLDLI +VHG+ +AE+Y  +L +  K  +++G+LLN YVR G+ +K+
Sbjct  94   G--LPISSRDQAVQLDLIGRVHGVESAERYLQSLSDGDKTWKVHGALLNCYVREGLVDKS  151

Query  606  ESLF  617
             SL 
Sbjct  152  LSLM  155



>gb|KEH37793.1| PPR containing plant protein [Medicago truncatula]
Length=494

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RIS    P    +++LNQ   EG+ +S  ++ F +++LR   R   AL++ EWM++ 
Sbjct  33   LFLRISRAGDPIIPITSILNQWIQEGRDVSHSDIHFFIKQLRIRRRFKQALQISEWMSNE  92

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + + + D A +LDLI+KVHG+  AEKYF ++P++ KD ++YG++LN Y +    EK 
Sbjct  93   RNLH-LLSGDIATRLDLIAKVHGLDQAEKYFNSVPHTSKDFKVYGAMLNCYAQYNSVEKV  151

Query  606  E  608
            E
Sbjct  152  E  152



>ref|XP_008337472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Malus domestica]
 ref|XP_008367878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=504

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            ++ RI +I  P+     VL Q   EG+ + + +L  +VR L+ F R + ALE+ +WM DR
Sbjct  45   LHDRIKVIRDPKASVLPVLEQWVSEGQAVEKQQLQSLVRLLKDFRRFNHALEISQWMTDR  104

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               + ++ SD A +L+LI +VHG+ +AE YF  L  SLK    YG+LL  YV+    EKA
Sbjct  105  -RYFDLSPSDAAARLNLIHRVHGLEHAENYFNNLSKSLKSLNAYGALLCXYVQERSVEKA  163

Query  606  ES  611
            E+
Sbjct  164  EA  165



>ref|XP_002457728.1| hypothetical protein SORBIDRAFT_03g012450 [Sorghum bicolor]
 gb|EES02848.1| hypothetical protein SORBIDRAFT_03g012450 [Sorghum bicolor]
Length=530

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +3

Query  243  IIYKRISMIEYPQKGA-STVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWM-  416
            ++Y+R+S +    +G+ S VLN+   EG      EL+  V++LRK+ RH  ALEV +WM 
Sbjct  65   LLYRRLSALGIAGEGSVSRVLNKWVREGGAPRSEELVKHVKELRKYKRHAHALEVMDWMV  124

Query  417  NDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMR  596
            N R     IT  + AI+LDLI KV G+  AE YF  LP+  K+ R YG+LL+ Y    M 
Sbjct  125  NARGMNMSIT--NHAIRLDLIYKVRGLEAAENYFANLPDPAKNHRTYGALLSCYCSAKME  182

Query  597  EKAESLF  617
            EKA  L+
Sbjct  183  EKATYLY  189



>gb|EYU46819.1| hypothetical protein MIMGU_mgv1a004991mg [Erythranthe guttata]
Length=501

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 75/124 (60%), Gaps = 2/124 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +   +   ++ +N+   EG+ +S+ EL   +++LRK+ R + ALE+ +WM+ R
Sbjct  39   LYRRLSALGNKKGTVASTINEYIREGRSVSKFELEACIKQLRKYKRFNHALEIMDWMDVR  98

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              ++     D A++LDLI+K  GI+ AE YF  L  S+K    YGSLLN Y    M +KA
Sbjct  99   --KFNFGHKDYAVRLDLIAKAQGIAAAENYFSGLSPSVKVHCTYGSLLNCYCTEKMTDKA  156

Query  606  ESLF  617
              LF
Sbjct  157  LDLF  160



>ref|XP_010690204.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=404

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A+ ++ +  +EG  I+  EL  + ++LRK  R+  ALE+ EWM    E 
Sbjct  58   RIFRLRLPKRSATNIIQKWVNEGNSITLPELRHISKELRKSHRYKHALEITEWMVSDNE-  116

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             +++ SD A++LDL++KV GI  AE+YF  LP+ +K    Y +LL++Y    + +KAE L
Sbjct  117  LELSDSDYAVRLDLMTKVFGIDAAERYFEGLPHDVKTSETYTALLHSYASANLIDKAEEL  176

Query  615  F  617
            F
Sbjct  177  F  177



>ref|XP_010249890.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nelumbo nucifera]
Length=497

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +       S  +N+   EGK + + ++   +++LRK+ R   AL++ EWM  R
Sbjct  36   LYRRLSALGATGGSVSQAVNKYVREGKSVKKRQIESCIKELRKYKRFQHALDLMEWMEKR  95

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
                 ++ SD A++LDL+SK  GI +AE+YF +L    K+R  YG+LLN Y +  M++KA
Sbjct  96   --DTVLSYSDYAVRLDLLSKTRGIDSAEEYFNSLSEPAKNRLTYGALLNCYCKEKMKDKA  153

Query  606  ESLFD  620
             +LF+
Sbjct  154  LALFE  158



>ref|XP_010038139.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Eucalyptus grandis]
Length=516

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEWM  + +
Sbjct  49   KRLLSLVYAKRSAVVTIRKWKEEGGAVRKYELNRIVRELRKLKRYKHALEICEWMRLQQD  108

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL++Y +  +  KAE+
Sbjct  109  -IKLLAGDYAVHLDLIAKVRGLNSAEKFFEDLPSQMRGEHTCNALLHSYAKKQLSSKAEA  167

Query  612  LFD  620
            L +
Sbjct  168  LIE  170



>ref|XP_011042275.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial [Populus euphratica]
Length=511

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+R+S +       S  LN+   EG +IS++ L   +++LRK+GR   A EV EWM  R
Sbjct  36   MYRRLSELGASGGSVSRTLNEFILEGGKISKINLTACIKELRKYGRFDHASEVMEWMQKR  95

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              +   +  D A+ LDL +K  GI+ AE YF  LP S+++   Y +LLN Y +  M EKA
Sbjct  96   --KMNFSHVDHAVYLDLTAKTKGIAAAENYFDNLPPSVQNHVTYSTLLNCYCKELMSEKA  153

Query  606  ESLFD  620
             +LF+
Sbjct  154  LTLFE  158



>gb|KDP24137.1| hypothetical protein JCGZ_25794 [Jatropha curcas]
Length=475

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +RIS    P      +L +  +EG  I   EL   +++LRKF R+  AL++ +WM D+  
Sbjct  39   RRISRAGDPSVSMVPILEKWLEEGNDIKLSELQKFIKQLRKFRRYTQALQISQWMTDQ-R  97

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
             + ++  D AIQLDLI+KV+G   AEKYF ++P + +  + YG+LLN Y      EKAE+
Sbjct  98   CFILSPGDVAIQLDLITKVYGFEEAEKYFSSIPENSRGYQAYGALLNCYAHTKRLEKAEA  157

Query  612  LFD  620
            + +
Sbjct  158  VME  160



>ref|XP_004295631.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=493

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y  IS +   ++  +  L+    +G ++S  EL  ++R LRK  R   ALEV EWMN++
Sbjct  31   LYTVISPLGDKKQTVTPELDNWVSKGNKVSVAELHRIIRDLRKRKRFSQALEVSEWMNEK  90

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
            +  YK  +S+ A+QLDLI +V G  +AE+YF  L +  KD R YG+LLN YVR    EK+
Sbjct  91   S-VYKFRSSEHAVQLDLIGRVRGFVSAEEYFTKLEDEDKDCRTYGALLNCYVRQLQTEKS  149



>ref|XP_002871373.1| hypothetical protein ARALYDRAFT_487758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47632.1| hypothetical protein ARALYDRAFT_487758 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            RI  +  P++ A+TVL +   EG +I+  EL  + ++LR+  RH  ALEV EWM    E 
Sbjct  61   RIFRLRLPKRSATTVLERWVGEGNQITINELREISKELRRTRRHKHALEVTEWMVQH-EE  119

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K++ +D A ++DLISKV GI  AE+YF  L    K    Y SLL+AY      E+AE+L
Sbjct  120  LKVSDADYASRIDLISKVFGIDAAERYFEGLHIDAKTTETYTSLLHAYAGSKQTERAEAL  179

Query  615  F  617
            F
Sbjct  180  F  180



>ref|XP_008339193.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g28020 [Malus domestica]
Length=900

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  297  VLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDL  476
            VL+Q  +EG+ + R EL   +++LRKF R+  AL++ EWM+D    + +   D AI+L+L
Sbjct  482  VLHQWLEEGRNVERSELQDFIKQLRKFRRYTQALQISEWMSDEL-NHDLHPGDIAIRLEL  540

Query  477  ISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESLFD  620
            ISKV G+  AEKYF ++P  L+  ++ G+LL+ Y      EKAE+LF+
Sbjct  541  ISKVRGLEEAEKYFYSIPELLRVVQVCGALLSCYAEHNCLEKAEALFE  588


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 4/153 (3%)
 Frame = +3

Query  153  KGLAITCASISQVHSYGTVDYEKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRI  332
            +G AI+    S  +S  T+       P +  ++ RI   + P+     VL+Q   EG+ +
Sbjct  10   RGTAISRVFGSLNYSTNTLASSSTTSPTFQSLHHRILFYKGPRVSVLPVLHQWLKEGRDV  69

Query  333  SRLELLFVVRKLRKFGRHHLALEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEK  512
             + EL   + KLR+   ++LALE+ EWM D    + +   D AI+LDLIS+VHG   AE+
Sbjct  70   EQSELRDFIIKLRRSRCYNLALEISEWMGDEM-NFDLHPGDIAIRLDLISRVHGNKRAER  128

Query  513  YFLTLPNSLKDRRIYGSLLNAYV---RVGMREK  602
            YF  +PN L D R   + L++Y     VG  EK
Sbjct  129  YFDCIPNELSDIRTLNNRLHSYAATSDVGRMEK  161



>gb|KJB23095.1| hypothetical protein B456_004G080600 [Gossypium raimondii]
Length=515

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = +3

Query  255  RISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAER  434
            R+  + YP++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + + 
Sbjct  50   RLIGLVYPKRSAVVTIRKWLEEGHTVRKYELNRIVRELRKLKRYKHALEICEWMRLQQD-  108

Query  435  YKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAESL  614
             K+   D A+ LDLI+KV G+++AEK+F  LP  ++ +    +LL+ YV+  +  KAE+L
Sbjct  109  IKLLPGDYAVHLDLIAKVRGLTSAEKFFEDLPEKMRGQATCTALLHTYVQNKLSAKAEAL  168

Query  615  FD  620
             +
Sbjct  169  ME  170



>ref|XP_002520753.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF41715.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=551

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +RI  + Y ++ A   + + + EG ++ + +L  +VR+LRK  R+  ALEVCEWM    E
Sbjct  40   RRIFSLVYSKRSAVIAIRKWKTEGHKVQKYQLNRIVRELRKMKRYKHALEVCEWMTQERE  99

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDL++KV G+++AEK+F  LP+ ++  +   +LL+ YV+     KAE+
Sbjct  100  -LKLLPGDYAVHLDLVAKVRGLTSAEKFFEDLPDEMRGWQTCTALLHTYVKCKDVVKAEA  158

Query  612  LFD  620
            L +
Sbjct  159  LME  161



>ref|XP_010677631.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Beta vulgaris subsp. vulgaris]
Length=502

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y+RIS +    +    VL++  +EG+ +S+ EL  +VR+LR++GR   AL++ +WM+D+
Sbjct  51   LYRRISPVGNSNESIVPVLDKWIEEGRPVSQNELRTIVRELRRYGRFKHALQISQWMSDK  110

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
               +     D A++L+LI+KV+GI  AE YF   P  ++   +YG+LL +Y  V   +KA
Sbjct  111  RYMHPFVC-DVAVRLELIAKVNGIEQAENYFNNTPKLMRTCEVYGALLYSYAHVKCVDKA  169

Query  606  ESLFD  620
            E + +
Sbjct  170  EGVVE  174



>ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=486

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++++ +L  ++++LR FGR + AL++CEW  +R
Sbjct  38   LFRRVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRTFGRFNHALQLCEW--ER  95

Query  426  AERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+ YV     +K
Sbjct  96   NERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLHCYVENKNLKK  155

Query  603  AESLF  617
            AE++ 
Sbjct  156  AEAIM  160



>gb|KGN43609.1| hypothetical protein Csa_7G047440 [Cucumis sativus]
Length=486

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +++R+     P+     VL+Q  +EG+++++ +L  ++++LR FGR + AL++CEW  +R
Sbjct  38   LFRRVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRTFGRFNHALQLCEW--ER  95

Query  426  AERYKITT-SDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREK  602
             ER K  +    AIQL LISK  G+  AE+YF ++  S +D ++YG+LL+ YV     +K
Sbjct  96   NERNKCPSPGHIAIQLHLISKARGLEQAEEYFSSIGESSRDHKVYGALLHCYVENKNLKK  155

Query  603  AESLF  617
            AE++ 
Sbjct  156  AEAIM  160



>ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 emb|CBI26594.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            +R+  + Y ++ A   + +  +EG  + + EL  +VR+LRK  R+  ALE+CEWM  + +
Sbjct  60   RRLLSLVYAKRSAVIAIQRWREEGHTVRKYELNRIVRELRKLKRYKHALEICEWMTKQHD  119

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+K+ G+++AEK+F  L + +K +    +LL+ YV+  + EKAE+
Sbjct  120  -IKLLAGDYAVHLDLIAKIRGLASAEKFFEDLSDKMKGQPTCTALLHTYVQNKVSEKAEA  178

Query  612  LFD  620
            L +
Sbjct  179  LME  181



>ref|XP_010039270.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Eucalyptus grandis]
Length=229

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDRAE  431
            KR+  + Y ++ A   + + ++EG  + + EL  +VR+LRK  R+  ALE+CEW+  + +
Sbjct  65   KRLLSLVYAKRSAVVTIRKWKEEGGAVRKYELNRIVRELRKLKRYKHALEICEWIRLQQD  124

Query  432  RYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAES  611
              K+   D A+ LDLI+KV G+++AEK+F  LP+ ++      +LL+ Y +  +  KAE+
Sbjct  125  -IKLLAGDYAVHLDLIAKVRGLNSAEKFFEDLPSRMRGEHTCNALLHNYAKKQLSSKAEA  183

Query  612  LFD  620
            L +
Sbjct  184  LIE  186



>ref|XP_002466988.1| hypothetical protein SORBIDRAFT_01g017960 [Sorghum bicolor]
 gb|EER93986.1| hypothetical protein SORBIDRAFT_01g017960 [Sorghum bicolor]
Length=510

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +3

Query  219  KRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLAL  398
            ++P+P+   +Y+RI  +  P    S VL Q + EG  + +  +  +V+KL    R   AL
Sbjct  38   RQPLPD--NLYRRIMNVGRPSIPLSPVLKQWDQEGHTVKKFVIQAIVKKLVGLRRFAHAL  95

Query  399  EVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAY  578
            E+  WM DR   + +T  D A +LDLISKVHG+  A +YF  +P  L+  + YGSLL  Y
Sbjct  96   ELSFWMTDRRHLH-LTAGDVAYRLDLISKVHGLEKAVEYFGMVPKRLRMPQCYGSLLKCY  154

Query  579  VRVGMREKAESLF  617
            V     +KAE  F
Sbjct  155  VEAKAVDKAEEHF  167



>ref|XP_007144631.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
 gb|ESW16625.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
Length=511

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +3

Query  252  KRISMIEYPQKGASTVLNQCEDEGKRISR-LELLFVVRKLRKFGRHHLALEVCEWMNDRA  428
            +R+  + YP++ A  V+N+ ++EG+   R  +L  +VR+LR+  R+  ALEVCEWM  + 
Sbjct  43   RRLLSLVYPKRSAVIVINKWKEEGRAPPRKYQLNRIVRELRREKRYKHALEVCEWMTLQK  102

Query  429  ERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKAE  608
            +  K+   D A+ LDLI+KV G+ +AE +F  LP+ ++ ++   +LL++YV+  + +KAE
Sbjct  103  D-IKLVPGDYAVHLDLITKVRGLESAENFFEDLPDRMRGQQTCSALLHSYVQNNLVDKAE  161

Query  609  SLF  617
            +L 
Sbjct  162  ALM  164



>emb|CBI36964.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 76/125 (61%), Gaps = 2/125 (2%)
 Frame = +3

Query  246  IYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCEWMNDR  425
            +Y R+S +       +  LN+   EGK I++ EL   +++LRK+ +   ALE+ +WM +R
Sbjct  85   LYHRLSALGATGGSVADTLNEHIKEGKLIAKHELSSCIKQLRKYRQFQHALEIMDWMENR  144

Query  426  AERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRVGMREKA  605
              +   + +D A++LDL+SK  G++ AE+YF  L  S K+   YG+LLN Y +  M EKA
Sbjct  145  --KIFFSYADYAVRLDLLSKTKGLATAEEYFNNLSPSAKNLLTYGTLLNCYCKEKMEEKA  202

Query  606  ESLFD  620
             +LF+
Sbjct  203  LALFE  207



>ref|XP_004137019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004155524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=500

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = +3

Query  231  PNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLALEVCE  410
            P   I+ ++I  I  P+     VL +   +G+ I + EL ++V  ++   R + ALE+ +
Sbjct  33   PQLAILRQKIVNIRAPKISVVPVLEKWVGDGRAIGKPELQYLVHLMKDSRRFNHALEISQ  92

Query  411  WMNDRAERY-KITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNAYVRV  587
            WM DR  RY  ++ SD A++LDLI  VHG+ +AE YF ++   LK   +YG+LL  YVR 
Sbjct  93   WMTDR--RYLSLSPSDAAVRLDLIHSVHGLEHAENYFNSISIRLKTSNVYGALLGCYVRE  150

Query  588  GMREKAESLF  617
               EKAE++ 
Sbjct  151  KSLEKAEAIM  160



>ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 ref|XP_006479730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Citrus sinensis]
 gb|ESR57325.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 gb|KDO68751.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis]
Length=510

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +3

Query  216  EKRPMPNWGIIYKRISMIEYPQKGASTVLNQCEDEGKRISRLELLFVVRKLRKFGRHHLA  395
            EK+       + +R+  + Y ++ A+  + + ++EG  + + EL  +VR+LRK  R+  A
Sbjct  31   EKKGAGGRDTLGRRLLSLVYAKRSAAITMRKWKEEGHTVHKYELNRIVRELRKLKRYKHA  90

Query  396  LEVCEWMNDRAERYKITTSDTAIQLDLISKVHGISNAEKYFLTLPNSLKDRRIYGSLLNA  575
            LEVCEWM  + +  K+ + D A+ LDLISK+ G+S+AE +F  LP+ ++      +LL++
Sbjct  91   LEVCEWMELQYD-IKLVSGDYAVHLDLISKIRGLSSAENFFENLPDKMRGPDTCSALLHS  149

Query  576  YVRVGMREKAESLFD  620
            YV+     +AE+L +
Sbjct  150  YVQNKKSAEAEALME  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520