BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF021A03

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615227.1|  PREDICTED: uncharacterized protein LOC104107982    209   4e-61   Nicotiana tomentosiformis
ref|XP_007032242.1|  Uncharacterized protein isoform 5                  204   1e-60   
ref|XP_009804785.1|  PREDICTED: uncharacterized protein LOC104249949    207   2e-60   Nicotiana sylvestris
ref|XP_007032240.1|  Uncharacterized protein isoform 3                  205   2e-60   
ref|XP_007032243.1|  Uncharacterized protein isoform 6                  205   4e-60   
ref|XP_011101979.1|  PREDICTED: uncharacterized protein LOC105180...    206   5e-60   Sesamum indicum [beniseed]
ref|XP_011101977.1|  PREDICTED: uncharacterized protein LOC105180...    206   9e-60   Sesamum indicum [beniseed]
ref|XP_011101978.1|  PREDICTED: uncharacterized protein LOC105180...    206   9e-60   Sesamum indicum [beniseed]
ref|XP_007032241.1|  Uncharacterized protein isoform 4                  205   1e-59   
ref|XP_007032239.1|  Uncharacterized protein isoform 2                  205   1e-59   
ref|XP_007032238.1|  Uncharacterized protein isoform 1                  205   1e-59   
emb|CDP06352.1|  unnamed protein product                                203   7e-59   Coffea canephora [robusta coffee]
ref|XP_004249013.1|  PREDICTED: uncharacterized protein LOC101255446    203   7e-59   Solanum lycopersicum
ref|XP_010653095.1|  PREDICTED: uncharacterized protein LOC100243...    202   3e-58   Vitis vinifera
ref|XP_002264842.2|  PREDICTED: uncharacterized protein LOC100243...    202   3e-58   Vitis vinifera
ref|XP_006362325.1|  PREDICTED: uncharacterized protein LOC102585892    199   3e-57   Solanum tuberosum [potatoes]
gb|KDO64224.1|  hypothetical protein CISIN_1g025201mg                   191   8e-57   Citrus sinensis [apfelsine]
gb|KJB27584.1|  hypothetical protein B456_005G0011002                   189   9e-57   Gossypium raimondii
gb|KDO64222.1|  hypothetical protein CISIN_1g025201mg                   191   3e-56   Citrus sinensis [apfelsine]
gb|KHG16695.1|  Retinal-binding                                         195   1e-55   Gossypium arboreum [tree cotton]
ref|XP_009370848.1|  PREDICTED: uncharacterized protein LOC103960157    192   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_006429676.1|  hypothetical protein CICLE_v10011748mg             191   3e-54   
ref|XP_006429677.1|  hypothetical protein CICLE_v10011748mg             191   3e-54   
ref|XP_006429678.1|  hypothetical protein CICLE_v10011748mg             191   4e-54   
gb|EYU42069.1|  hypothetical protein MIMGU_mgv1a006657mg                189   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_006429679.1|  hypothetical protein CICLE_v10011748mg             191   5e-54   Citrus clementina [clementine]
gb|KDO64221.1|  hypothetical protein CISIN_1g025201mg                   186   5e-54   Citrus sinensis [apfelsine]
gb|EYU42068.1|  hypothetical protein MIMGU_mgv1a006657mg                189   2e-53   Erythranthe guttata [common monkey flower]
emb|CDY38154.1|  BnaA07g02290D                                          182   2e-53   Brassica napus [oilseed rape]
gb|EYU42067.1|  hypothetical protein MIMGU_mgv1a006657mg                189   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_010036049.1|  PREDICTED: uncharacterized protein LOC104425150    189   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009337845.1|  PREDICTED: uncharacterized protein LOC103930264    188   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_010278895.1|  PREDICTED: uncharacterized protein LOC104612935    186   2e-52   Nelumbo nucifera [Indian lotus]
gb|KDO64223.1|  hypothetical protein CISIN_1g025201mg                   181   4e-52   Citrus sinensis [apfelsine]
ref|XP_006599750.1|  PREDICTED: uncharacterized protein LOC100795...    184   8e-52   Glycine max [soybeans]
ref|XP_008370316.1|  PREDICTED: uncharacterized protein LOC103433803    185   8e-52   
ref|XP_003548341.1|  PREDICTED: uncharacterized protein LOC100795...    184   1e-51   Glycine max [soybeans]
gb|KHN24577.1|  hypothetical protein glysoja_014181                     184   1e-51   Glycine soja [wild soybean]
ref|XP_010113031.1|  hypothetical protein L484_022756                   184   4e-51   
ref|XP_008244213.1|  PREDICTED: uncharacterized protein LOC103342365    182   6e-51   Prunus mume [ume]
gb|EPS68255.1|  hypothetical protein M569_06516                         183   8e-51   Genlisea aurea
ref|XP_009125386.1|  PREDICTED: uncharacterized protein LOC103850397    182   1e-50   Brassica rapa
ref|XP_009130614.1|  PREDICTED: uncharacterized protein LOC103855...    181   1e-50   Brassica rapa
ref|XP_004510081.1|  PREDICTED: uncharacterized protein LOC101493...    181   2e-50   Cicer arietinum [garbanzo]
ref|XP_009130613.1|  PREDICTED: uncharacterized protein LOC103855...    181   3e-50   Brassica rapa
gb|KDP21813.1|  hypothetical protein JCGZ_00600                         181   4e-50   Jatropha curcas
ref|XP_004302492.1|  PREDICTED: uncharacterized protein LOC101292427    180   5e-50   Fragaria vesca subsp. vesca
ref|XP_003521546.1|  PREDICTED: uncharacterized protein LOC100778...    180   5e-50   Glycine max [soybeans]
emb|CDY11168.1|  BnaA03g00040D                                          181   7e-50   Brassica napus [oilseed rape]
ref|XP_006398546.1|  hypothetical protein EUTSA_v10013603mg             179   2e-49   
ref|XP_006398547.1|  hypothetical protein EUTSA_v10013603mg             179   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006398545.1|  hypothetical protein EUTSA_v10013603mg             178   2e-49   
ref|XP_002519981.1|  conserved hypothetical protein                     179   2e-49   Ricinus communis
gb|AFK45888.1|  unknown                                                 172   3e-49   Lotus japonicus
ref|XP_002872981.1|  hypothetical protein ARALYDRAFT_486867             178   4e-49   
ref|XP_007134600.1|  hypothetical protein PHAVU_010G060400g             178   5e-49   Phaseolus vulgaris [French bean]
ref|XP_010490476.1|  PREDICTED: uncharacterized protein LOC104768...    177   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010490477.1|  PREDICTED: uncharacterized protein LOC104768...    177   5e-49   Camelina sativa [gold-of-pleasure]
dbj|BAD43795.1|  unknown protein                                        177   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195721.5|  uncharacterized protein                               177   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154688.1|  uncharacterized protein                            177   6e-49   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57023.1|  AT5G01010                                              177   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496822.1|  PREDICTED: uncharacterized protein LOC104773850    177   9e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001154687.1|  uncharacterized protein                            177   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842639.1|  hypothetical protein AMTR_s00077p00188630          176   3e-48   Amborella trichopoda
ref|XP_007205211.1|  hypothetical protein PRUPE_ppa005889mg             176   3e-48   
dbj|BAD43433.1|  unknown protein                                        175   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279346.1|  hypothetical protein CARUB_v10012733mg             174   1e-47   Capsella rubella
ref|XP_010543129.1|  PREDICTED: uncharacterized protein LOC104816...    171   5e-47   Tarenaya hassleriana [spider flower]
ref|XP_008463317.1|  PREDICTED: uncharacterized protein LOC103501...    171   6e-47   Cucumis melo [Oriental melon]
ref|XP_010543128.1|  PREDICTED: uncharacterized protein LOC104816...    170   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_008463316.1|  PREDICTED: uncharacterized protein LOC103501...    171   1e-46   Cucumis melo [Oriental melon]
ref|XP_004163944.1|  PREDICTED: uncharacterized LOC101218161            168   2e-46   
ref|NP_001190197.1|  uncharacterized protein                            171   2e-46   
ref|XP_010543127.1|  PREDICTED: uncharacterized protein LOC104816...    171   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010543126.1|  PREDICTED: uncharacterized protein LOC104816...    170   3e-46   Tarenaya hassleriana [spider flower]
ref|XP_004147520.1|  PREDICTED: uncharacterized protein LOC101218161    169   1e-45   Cucumis sativus [cucumbers]
gb|KFK24699.1|  hypothetical protein AALP_AA8G013300                    167   2e-45   Arabis alpina [alpine rockcress]
ref|XP_010673452.1|  PREDICTED: uncharacterized protein LOC104889827    165   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010938085.1|  PREDICTED: uncharacterized protein LOC105057...    165   2e-44   Elaeis guineensis
ref|XP_010938084.1|  PREDICTED: uncharacterized protein LOC105057...    165   3e-44   Elaeis guineensis
ref|XP_011006222.1|  PREDICTED: uncharacterized protein LOC105112277    163   2e-43   Populus euphratica
ref|XP_002323111.2|  hypothetical protein POPTR_0016s15030g             162   3e-43   
ref|XP_008793391.1|  PREDICTED: uncharacterized protein LOC103709...    158   6e-42   
ref|XP_008793389.1|  PREDICTED: uncharacterized protein LOC103709...    158   9e-42   Phoenix dactylifera
ref|XP_003626627.1|  hypothetical protein MTR_8g005040                  153   5e-40   Medicago truncatula
ref|XP_010921251.1|  PREDICTED: uncharacterized protein LOC105044...    153   7e-40   Elaeis guineensis
ref|XP_010921250.1|  PREDICTED: uncharacterized protein LOC105044...    153   8e-40   Elaeis guineensis
ref|XP_002440877.1|  hypothetical protein SORBIDRAFT_09g012090          145   2e-39   
gb|AFW77522.1|  hypothetical protein ZEAMMB73_436424                    147   2e-39   
ref|XP_004962481.1|  PREDICTED: uncharacterized protein LOC101772...    151   5e-39   Setaria italica
ref|XP_004962482.1|  PREDICTED: uncharacterized protein LOC101772...    150   5e-39   Setaria italica
ref|XP_004962483.1|  PREDICTED: uncharacterized protein LOC101772...    150   6e-39   
ref|XP_009391656.1|  PREDICTED: uncharacterized protein LOC103977773    150   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654248.1|  PREDICTED: uncharacterized protein LOC102707586    149   3e-38   Oryza brachyantha
gb|AFW77521.1|  hypothetical protein ZEAMMB73_436424                    147   6e-38   
ref|XP_010231534.1|  PREDICTED: uncharacterized protein LOC100826...    146   7e-38   
dbj|BAJ93195.1|  predicted protein                                      146   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568677.1|  PREDICTED: uncharacterized protein LOC100826...    146   3e-37   Brachypodium distachyon [annual false brome]
ref|XP_010231533.1|  PREDICTED: uncharacterized protein LOC100826...    145   6e-37   
ref|XP_008649464.1|  PREDICTED: uncharacterized protein LOC103630...    144   2e-36   Zea mays [maize]
ref|XP_008649463.1|  PREDICTED: uncharacterized protein LOC103630...    144   2e-36   Zea mays [maize]
ref|XP_008782731.1|  PREDICTED: uncharacterized protein LOC103702...    143   3e-36   Phoenix dactylifera
ref|NP_001055152.1|  Os05g0306000                                       140   3e-35   
gb|EEE63181.1|  hypothetical protein OsJ_17990                          140   4e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49914.1|  hypothetical protein TRIUR3_19770                       137   2e-34   Triticum urartu
gb|EMT26757.1|  hypothetical protein F775_30139                         137   7e-34   
gb|KJB27585.1|  hypothetical protein B456_005G0011002                   122   2e-31   Gossypium raimondii
ref|XP_008793390.1|  PREDICTED: uncharacterized protein LOC103709...    115   3e-26   
ref|XP_001765571.1|  predicted protein                                  109   3e-24   
ref|XP_002991009.1|  hypothetical protein SELMODRAFT_161364           99.4    1e-20   
ref|XP_002980642.1|  hypothetical protein SELMODRAFT_154057           99.4    1e-20   
gb|KDO64225.1|  hypothetical protein CISIN_1g025201mg                 94.4    6e-20   Citrus sinensis [apfelsine]
dbj|BAD43927.1|  unnamed protein product                              72.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381292.1|  hypothetical protein POPTR_0006s11480g           66.6    5e-11   
ref|XP_004353064.1|  serpin, putative                                 63.2    3e-08   Acanthamoeba castellanii str. Neff
ref|XP_010921254.1|  PREDICTED: uncharacterized protein LOC105044...  62.4    5e-08   
ref|XP_010921253.1|  PREDICTED: uncharacterized protein LOC105044...  62.4    5e-08   
ref|XP_010496718.1|  PREDICTED: uncharacterized protein LOC104773766  50.1    7e-04   



>ref|XP_009615227.1| PREDICTED: uncharacterized protein LOC104107982 [Nicotiana tomentosiformis]
Length=439

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLS++VSRL DEI SMA DL +G  L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFTPLSEDVSRLSDEIYSMANDLHEGSPLTEGESSLVR  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  PPHK+DEN+WKNREQIEEILFL + SNWP +L+ QSTA+DAEL ++L RL EKF 
Sbjct  61   EAERPPPHKVDENLWKNREQIEEILFLSESSNWPPVLKSQSTAEDAELVSLLGRLGEKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+VL TFQ+RNSE VFNTVMT
Sbjct  121  NTLKVLETFQSRNSEFVFNTVMT  143



>ref|XP_007032242.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 ref|XP_007032244.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03168.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03170.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=309

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>ref|XP_009804785.1| PREDICTED: uncharacterized protein LOC104249949 [Nicotiana sylvestris]
Length=439

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLS++VSRL D+I SMA DL +   L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFTPLSEDVSRLSDQIHSMANDLHEDSPLTEGESSLVR  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAES PPHK+DEN+WKNREQIEEILFL + SNWP +L+ QSTA+DAEL ++L RL EKF 
Sbjct  61   EAESPPPHKVDENLWKNREQIEEILFLSESSNWPPVLKSQSTAEDAELASLLGRLGEKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+V+ TFQ+RNSE VFNTVMT
Sbjct  121  NTLKVVETFQSRNSEFVFNTVMT  143



>ref|XP_007032240.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY03166.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=343

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>ref|XP_007032243.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY03169.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
Length=372

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>ref|XP_011101979.1| PREDICTED: uncharacterized protein LOC105180011 isoform X3 [Sesamum 
indicum]
Length=411

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L  FQARNSE VFNTVMT
Sbjct  121  STLKTLAYFQARNSEFVFNTVMT  143



>ref|XP_011101977.1| PREDICTED: uncharacterized protein LOC105180011 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L  FQARNSE VFNTVMT
Sbjct  121  STLKTLAYFQARNSEFVFNTVMT  143



>ref|XP_011101978.1| PREDICTED: uncharacterized protein LOC105180011 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            M STEGLVPITRAFLASYYDK+ FPPLS +VSRL D I  MA DL +    ++GE LLV 
Sbjct  1    MVSTEGLVPITRAFLASYYDKYPFPPLSIDVSRLSDRIYVMATDLLKDSPPTQGERLLVE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  PPHK+DENMWKNREQIEEILF+L+  NWP  LQQQSTA+DAEL +VL RL+EKF 
Sbjct  61   EAERQPPHKVDENMWKNREQIEEILFMLEVPNWPRALQQQSTAEDAELASVLERLREKFN  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L  FQARNSE VFNTVMT
Sbjct  121  STLKTLAYFQARNSEFVFNTVMT  143



>ref|XP_007032241.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY03167.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>ref|XP_007032239.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY03165.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>ref|XP_007032238.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03164.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+ F PLSD+VSRL  EIRS A+DL QG   ++GESLL+ 
Sbjct  1    MASTEGLVPITRTFLASYYDKYPFDPLSDDVSRLSFEIRSFAQDLLQGLPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEEILFLL+RS+WP +LQQ ST++ AE   +  RLK+KF+
Sbjct  61   EADSQPPHKIDENMWKNREHIEEILFLLERSHWPPLLQQPSTSEVAEFATICGRLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L +L +FQ+RNSE VFNTVMT
Sbjct  121  RILRILASFQSRNSERVFNTVMT  143



>emb|CDP06352.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR+FLASYYDK+ FPPLSD+VSRL  EIRS++ DL +    S+GE+LL+ 
Sbjct  1    MASTEGLVPITRSFLASYYDKYMFPPLSDDVSRLSAEIRSLSGDLLKDSPPSQGETLLIR  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            E+E  PPHKIDEN+WKNREQIEEI+FLL+ SNWPT LQQQ T +  EL ++L RLKEKFE
Sbjct  61   ESEKQPPHKIDENLWKNREQIEEIIFLLETSNWPTSLQQQLTGEHTELVSLLSRLKEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S  ++L  FQ+RNSE VFNTVMT
Sbjct  121  SIFKLLEHFQSRNSEFVFNTVMT  143



>ref|XP_004249013.1| PREDICTED: uncharacterized protein LOC101255446 [Solanum lycopersicum]
Length=435

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFL+SYYDK+ F PLS +VSRL DEI SMA++LQ+   L+EGES LV 
Sbjct  1    MASTEGLMPITRAFLSSYYDKYPFSPLSQDVSRLTDEIHSMAKNLQKDAPLTEGESSLVL  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAES PPHK+DEN+WKNREQ+EEILFLL+ SNWP  LQ QST +D EL +VL RL EKF 
Sbjct  61   EAESHPPHKVDENLWKNREQLEEILFLLESSNWPPALQLQSTTEDVELVSVLERLGEKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L TFQ++NSE VFNTVMT
Sbjct  121  STLKSLQTFQSKNSEFVFNTVMT  143



>ref|XP_010653095.1| PREDICTED: uncharacterized protein LOC100243295 isoform X2 [Vitis 
vinifera]
 emb|CAQ58613.1| Unknown gene [Vitis vinifera]
Length=432

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLAS+YDK+ F  LSD+VSRL  +IRSMA DL     L+ GE+LLV 
Sbjct  1    MASTEGLVPITRNFLASFYDKYPFQSLSDDVSRLSYQIRSMASDLHNDSPLTPGETLLVK  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNREQIEEILFLL+RS+WP +LQ+QST +DAELG +L  LK+KF+
Sbjct  61   EADCPPPHKIDENMWKNREQIEEILFLLERSHWPPLLQRQSTPEDAELGLILGHLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + +++L  FQ++NSE++FNTVMT
Sbjct  121  NTMKILQAFQSKNSENIFNTVMT  143



>ref|XP_002264842.2| PREDICTED: uncharacterized protein LOC100243295 isoform X1 [Vitis 
vinifera]
 emb|CBI31130.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLAS+YDK+ F  LSD+VSRL  +IRSMA DL     L+ GE+LLV 
Sbjct  1    MASTEGLVPITRNFLASFYDKYPFQSLSDDVSRLSYQIRSMASDLHNDSPLTPGETLLVK  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNREQIEEILFLL+RS+WP +LQ+QST +DAELG +L  LK+KF+
Sbjct  61   EADCPPPHKIDENMWKNREQIEEILFLLERSHWPPLLQRQSTPEDAELGLILGHLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + +++L  FQ++NSE++FNTVMT
Sbjct  121  NTMKILQAFQSKNSENIFNTVMT  143



>ref|XP_006362325.1| PREDICTED: uncharacterized protein LOC102585892 [Solanum tuberosum]
Length=439

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST+GL+PITRAFL+SYYDK+ F PLS +VSRL DEI SMA++LQ+   L+EGES LV 
Sbjct  1    MASTDGLMPITRAFLSSYYDKYPFSPLSQDVSRLTDEIHSMAKNLQKDAPLTEGESSLVL  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAES PPHK+DEN+WKNREQ+EE+LFLL+  NWP  LQ QST +D EL +VL RL EKF+
Sbjct  61   EAESHPPHKVDENLWKNREQLEEMLFLLEIPNWPPALQLQSTTEDVELVSVLGRLGEKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L TFQ++NSE VFNTVMT
Sbjct  121  STLKSLQTFQSKNSEFVFNTVMT  143



>gb|KDO64224.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=209

 Score =   191 bits (486),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>gb|KJB27584.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
 gb|KJB27586.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
 gb|KJB27587.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
Length=140

 Score =   189 bits (480),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST GLVPITRAFLASYY+K+ F PL D+VSRL  +IRS  +DL QG   ++GESLL+ 
Sbjct  1    MASTGGLVPITRAFLASYYEKYPFDPLPDDVSRLSSQIRSFIQDLIQGFPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L +LK+KF+
Sbjct  61   EADSEPPHKMDENMWKNREHIEEILFLLERPHWPSVLQQSSTAEVAEFATTLGQLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNT  712
            + L +L +FQ++NSE VFNT
Sbjct  121  ATLRILESFQSKNSERVFNT  140



>gb|KDO64222.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=253

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>gb|KHG16695.1| Retinal-binding [Gossypium arboreum]
Length=442

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST GLVPITRAFLASYY+K+ F PL D+VSRL  +IRS  +DL QG   ++GESLL+ 
Sbjct  1    MASTGGLVPITRAFLASYYEKYPFDPLPDDVSRLSSQIRSFIQDLIQGFPPTQGESLLIQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA++ PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L +LK+KF+
Sbjct  61   EADTQPPHKMDENMWKNRENIEEILFLLERPHWPSVLQQSSTAEVAEFATTLGQLKDKFQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L +L +FQ+RNSE VFNTVMT
Sbjct  121  ATLTILESFQSRNSERVFNTVMT  143



>ref|XP_009370848.1| PREDICTED: uncharacterized protein LOC103960157 [Pyrus x bretschneideri]
Length=440

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEG+VPITRAFLASYYD +QFPPLS++V+RL  EIRS+  DL +    ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNDVARLSAEIRSLTADLLRHSPAAQGEERLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E ES PPHK+DENMWKNRE +EEILFLL++S+WP  L++QS+  DAEL  V+ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILFLLEKSHWPQTLRKQSSPDDAELATVIDRLHQKF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +++L+ L TFQA+NSE VFNTVMT
Sbjct  121  QTSLKTLETFQAKNSERVFNTVMT  144



>ref|XP_006429676.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42916.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=424

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>ref|XP_006429677.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42917.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=422

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>ref|XP_006429678.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42918.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=437

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>gb|EYU42069.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=382

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  469
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +S L  L +FQA+NSE VFNTVMT
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMT  144



>ref|XP_006429679.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 ref|XP_006481275.1| PREDICTED: uncharacterized protein LOC102624894 [Citrus sinensis]
 gb|ESR42919.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=438

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFE  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  121  KTLNTLKSFQAVNSDRIFNTVMT  143



>gb|KDO64221.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=256

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPT---MLQQQSTAQDAELGAVLLRLKE  643
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP     LQQ S  +D EL  VL +L E
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPATVRYLQQSSAPEDVELANVLGKLSE  120

Query  644  KFESALEVLVTFQARNSEHVFNTVMT  721
            KFE  L  L +FQA NS+ +FNTVMT
Sbjct  121  KFEKTLNTLKSFQAVNSDRIFNTVMT  146



>gb|EYU42068.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=435

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  469
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +S L  L +FQA+NSE VFNTVMT
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMT  144



>emb|CDY38154.1| BnaA07g02290D [Brassica napus]
Length=193

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST+GLVPITRAFLASYY+K+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTDGLVPITRAFLASYYNKYPFPPLSDDVSRLSSDMASLIQLLTLQSPPSQGEASLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL ++L  LK+ F+
Sbjct  61   EANQQPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSILRHLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +++FQ +NSE VFNTVMT
Sbjct  121  KALAAMISFQTKNSERVFNTVMT  143



>gb|EYU42067.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=436

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMAR-DLQQGRTLSEGESLLV  469
            M STEGLVPITR+FLASYYD + F PLS +VSRL D+I +MA  DL +    ++GESLLV
Sbjct  1    MVSTEGLVPITRSFLASYYDNYPFSPLSSDVSRLTDQIFAMATTDLLKDSPPTQGESLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             EAE  PPHK+DENMWKNREQIEEILF+L+ ++WP   QQQST +DAEL ++L RL+E F
Sbjct  61   QEAERQPPHKVDENMWKNREQIEEILFMLEPTHWPRAFQQQSTVEDAELVSLLGRLQENF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +S L  L +FQA+NSE VFNTVMT
Sbjct  121  KSTLSTLESFQAKNSEFVFNTVMT  144



>ref|XP_010036049.1| PREDICTED: uncharacterized protein LOC104425150 [Eucalyptus grandis]
 gb|KCW47571.1| hypothetical protein EUGRSUZ_K01318 [Eucalyptus grandis]
Length=439

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            M+S +GLVPITR+FLA+YYDK+ FPPLS++V+ L   IRS++ DL      +EGE LL+ 
Sbjct  1    MSSMDGLVPITRSFLAAYYDKYSFPPLSEDVAALSSRIRSLSNDLLGDVPPTEGEKLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+ TPPHKIDENMWKNREQ+EEI+FLL++SNWP  LQQQ T ++ E   +  +LK+K +
Sbjct  61   EADRTPPHKIDENMWKNREQMEEIIFLLEKSNWPAALQQQLTTENTEFATIFSQLKDKVQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             +L +L++FQARNSE VFNTVMT
Sbjct  121  ESLSLLISFQARNSERVFNTVMT  143



>ref|XP_009337845.1| PREDICTED: uncharacterized protein LOC103930264 [Pyrus x bretschneideri]
Length=440

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEG+VPITRAFLASYYD +QFPPLS+ V+RL  EIRS   DL      ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNGVARLSSEIRSFTADLLHHSPAAQGEERLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E ES PPHK+DENMWKNRE +EEILFLL++ +WP  L++QS+  DAEL  V+ RL++KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILFLLEKPHWPQTLREQSSLDDAELATVIDRLRQKF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +++L+ L +FQA+NSE VFNTVMT
Sbjct  121  QTSLKTLESFQAKNSERVFNTVMT  144



>ref|XP_010278895.1| PREDICTED: uncharacterized protein LOC104612935 [Nelumbo nucifera]
Length=432

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLA YYDK+ F PL D+VS L  E+RSM+ DLQ+   L+E E +L  
Sbjct  1    MASTEGLVPITRAFLARYYDKYPFEPLPDDVSGLTAELRSMSSDLQKEFPLTEAEGVLER  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKID+NMWKNRE IEEILFLL+RS+WP  LQ+QSTA+D E+  VL +L+ K +
Sbjct  61   EADCPPPHKIDQNMWKNREHIEEILFLLERSHWPRSLQEQSTAEDIEIATVLGKLQIKLQ  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L++L  FQ++N+E+VFNTVMT
Sbjct  121  NCLKLLEAFQSKNAENVFNTVMT  143



>gb|KDO64223.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=250

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYDK+  PPLSD+VSRL  +IRS+A DL      S+ ESLL+ 
Sbjct  1    MASTEGLVPITRNFLASYYDKYPAPPLSDDVSRLSSQIRSLANDLLLDSPPSQEESLLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE +EEI+FLLKRS+WP      S  +D EL  VL +L EKFE
Sbjct  61   EADRQPPHKIDENMWKNREHMEEIIFLLKRSHWPAT---SSAPEDVELANVLGKLSEKFE  117

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQA NS+ +FNTVMT
Sbjct  118  KTLNTLKSFQAVNSDRIFNTVMT  140



>ref|XP_006599750.1| PREDICTED: uncharacterized protein LOC100795582 isoform X2 [Glycine 
max]
Length=408

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L +FQ +N+EHVFNTVMT
Sbjct  121  ITLKALESFQTKNAEHVFNTVMT  143



>ref|XP_008370316.1| PREDICTED: uncharacterized protein LOC103433803 [Malus domestica]
Length=440

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEG+VPITRAFLASYYD +QFPPLS++V+RL  EIRS   DL +    ++GE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFPPLSNDVARLSAEIRSXTADLLRHSPAAQGEERLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E E+ PPHK+DENMWKNRE +EEILFLL++ +WP  L+ Q +  DAEL  V+ RL +KF
Sbjct  61   SELETEPPHKVDENMWKNREHMEEILFLLEKPHWPQTLRMQXSPDDAELATVIDRLHQKF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +++L+ L TFQA+NSE VFNTVMT
Sbjct  121  QTSLKTLETFQAKNSERVFNTVMT  144



>ref|XP_003548341.1| PREDICTED: uncharacterized protein LOC100795582 isoform X1 [Glycine 
max]
Length=434

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L +FQ +N+EHVFNTVMT
Sbjct  121  ITLKALESFQTKNAEHVFNTVMT  143



>gb|KHN24577.1| hypothetical protein glysoja_014181 [Glycine soja]
Length=434

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GES+L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGESILIN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQSTA   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSTADSVEFAITLGKLKDKLH  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L +FQ +N+EHVFNTVMT
Sbjct  121  ITLKALESFQTKNAEHVFNTVMT  143



>ref|XP_010113031.1| hypothetical protein L484_022756 [Morus notabilis]
 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis]
Length=503

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = +2

Query  296  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  475
            ASTEGLVPITRAFL+SYYDK+ F PLSD+VSRL  EIRS A D+      ++GE LL+ E
Sbjct  67   ASTEGLVPITRAFLSSYYDKYPFSPLSDDVSRLSSEIRSFANDVIADIPPNQGEKLLLDE  126

Query  476  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  655
            A+  PPHKIDENMWKNRE IEEI+FLL+  +WP +LQQQS   DAEL  VL ++K+KF++
Sbjct  127  ADCRPPHKIDENMWKNREHIEEIIFLLESPHWPPLLQQQSI-DDAELAVVLGQIKDKFQN  185

Query  656  ALEVLVTFQARNSEHVFNTVMT  721
             L+ L TFQA NSE +FNTVMT
Sbjct  186  TLKTLQTFQAMNSERIFNTVMT  207



>ref|XP_008244213.1| PREDICTED: uncharacterized protein LOC103342365 [Prunus mume]
Length=440

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEG+VPITRAFLASYYD +QF PLS++V RL  EIRS   DL      +EGE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFSPLSNDVVRLSSEIRSFTADLLNSSPAAEGEERLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E ES PPHK+DENMWKNRE +EEIL+LL++ +WP  LQQQ +  DAEL  ++ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILYLLEKPHWPRSLQQQLSPDDAELATIIDRLHQKF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +++L+ L +FQA+NS+ VFNTVMT
Sbjct  121  QTSLKTLESFQAKNSDRVFNTVMT  144



>gb|EPS68255.1| hypothetical protein M569_06516, partial [Genlisea aurea]
Length=463

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ F PLSDE  RL D+I ++++DL +    ++  SLL+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFDPLSDEFFRLSDQIHAISKDLLRESPSTQETSLLLE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  PPHK+DENMWKNREQIE+ILFLL+ SN P  LQ+QS  +++E+  +L RL+EKF+
Sbjct  61   EAEREPPHKVDENMWKNREQIEQILFLLEVSNRPGSLQKQSNDENSEISIILCRLEEKFK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L +FQ+RNSE VFNTVMT
Sbjct  121  STLKTLESFQSRNSEFVFNTVMT  143



>ref|XP_009125386.1| PREDICTED: uncharacterized protein LOC103850397 [Brassica rapa]
 emb|CDY04819.1| BnaAnng00010D [Brassica napus]
Length=440

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST+GLVPITRAFLASYY+K+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTDGLVPITRAFLASYYNKYPFPPLSDDVSRLSSDMASLIQLLTLQSPPSQGEASLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL ++L  LK+ F+
Sbjct  61   EANQQPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSILRHLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +++FQ +NSE VFNTVMT
Sbjct  121  KALAAMISFQTKNSERVFNTVMT  143



>ref|XP_009130614.1| PREDICTED: uncharacterized protein LOC103855392 isoform X2 [Brassica 
rapa]
Length=387

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +++FQ++NSE +F+TVMT
Sbjct  121  KALTAMISFQSKNSERIFSTVMT  143



>ref|XP_004510081.1| PREDICTED: uncharacterized protein LOC101493369 isoform X1 [Cicer 
arietinum]
Length=434

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS +VSRL  E+RSMA DL      ++GE  L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSHDVSRLTTELRSMASDLLAQHPPTQGEIRLIN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+S PPHKIDENMWKNRE IEE +FLL+  NWP  L+QQST ++     +L +LK+K  
Sbjct  61   EADSQPPHKIDENMWKNREYIEETIFLLEGFNWPEALKQQSTPENVAFSIMLGKLKDKLR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L  L +FQ +N+EHVFNTVMT
Sbjct  121  HTLRSLESFQIKNAEHVFNTVMT  143



>ref|XP_009130613.1| PREDICTED: uncharacterized protein LOC103855392 isoform X1 [Brassica 
rapa]
Length=432

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +++FQ++NSE +F+TVMT
Sbjct  121  KALTAMISFQSKNSERIFSTVMT  143



>gb|KDP21813.1| hypothetical protein JCGZ_00600 [Jatropha curcas]
Length=439

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAS +GLVPITR FLASYYD++ FPPLSD+VSRL  EIRSMA DL      S+ E LLV 
Sbjct  1    MASMDGLVPITRQFLASYYDRYPFPPLSDDVSRLSSEIRSMASDLINHSPPSQEERLLVE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  P HKIDENMWKNRE +EEILFLL RS WP  ++Q ST +D+EL  V   +++ F 
Sbjct  61   EADRDPIHKIDENMWKNREHMEEILFLLDRSRWPQQIRQPSTPEDSELATVFSNIRDLFH  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ L +FQ +NSE VFNTVMT
Sbjct  121  STLKTLESFQVKNSERVFNTVMT  143



>ref|XP_004302492.1| PREDICTED: uncharacterized protein LOC101292427 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEGLVPITRAFL+SYYD +QFPPLSD++ RL  +IRS+  D       + GE  L+V
Sbjct  1    MASTEGLVPITRAFLSSYYDTYQFPPLSDDIPRLSSDIRSLTSDFLSHSPPTPGEERLVV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E+E  PPHK+DENMWKNRE +EEI+FLL R++WP  LQ+ S+ +DA+L  VL RL  KF
Sbjct  61   DESERRPPHKVDENMWKNREHMEEIIFLLDRAHWPQALQEPSSPEDAQLATVLTRLLHKF  120

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
             +AL+ L +FQA+NSE VF+TVMT
Sbjct  121  NTALKALESFQAKNSERVFSTVMT  144



>ref|XP_003521546.1| PREDICTED: uncharacterized protein LOC100778827 isoform 1 [Glycine 
max]
 gb|KHN42120.1| hypothetical protein glysoja_021610 [Glycine soja]
Length=434

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS  VS L  +IRSMA D        +GE +L++
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSAHVSTLSSQIRSMANDFLTQHPPIQGERILIN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHK+DENMWKNRE IEE +FLL+ SNWP  L+QQS A   E    L +LK+K  
Sbjct  61   EADQQPPHKMDENMWKNREYIEETIFLLQSSNWPEALKQQSAADCVEFSITLGKLKDKLH  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L +FQ +N+EHVFNTVMT
Sbjct  121  NTLKALESFQTKNAEHVFNTVMT  143



>emb|CDY11168.1| BnaA03g00040D [Brassica napus]
Length=474

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLYSDMASLIQLLALQSPPSQGEASLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++  T++DAEL + L  LK+ F+
Sbjct  61   EANREPPHKIDENMWKNREQMEEILFLLQPSRWPVQLREPCTSEDAELSSTLRHLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +++FQ++NSE +F+TVMT
Sbjct  121  KALTAMISFQSKNSERIFSTVMT  143



>ref|XP_006398546.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39999.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=418

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL  +++FQ +NSE VF+TVMT
Sbjct  121  NALTAMISFQTKNSERVFSTVMT  143



>ref|XP_006398547.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ40000.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=432

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL  +++FQ +NSE VF+TVMT
Sbjct  121  NALTAMISFQTKNSERVFSTVMT  143



>ref|XP_006398545.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39998.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=412

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ FPPLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFPPLSDDVSRLSSDIASLIQLLTLQSPPSQGEASLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  +K   +
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQLREPSTSEDAEFSSMLRHVKANID  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL  +++FQ +NSE VF+TVMT
Sbjct  121  NALTAMISFQTKNSERVFSTVMT  143



>ref|XP_002519981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42305.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITR FLASYYDK+ F PLSD+VSRL  EIRS+A DL +    S+ E LLV 
Sbjct  1    MASTEGLMPITRQFLASYYDKYPFQPLSDDVSRLTSEIRSIASDLLKDSPPSKDERLLVE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAE  P HKIDENMWKNRE +EEILFLL  S WP+ L+Q ST +D+EL   + ++++ F 
Sbjct  61   EAERDPIHKIDENMWKNRELMEEILFLLDHSRWPSALRQPSTPEDSELATAIAKVRDFFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQA+NSE VFNTVMT
Sbjct  121  KTLKTLEIFQAKNSERVFNTVMT  143



>gb|AFK45888.1| unknown [Lotus japonicus]
Length=212

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +2

Query  296  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  475
            ASTEGLVPITRAFLASYYD H F PLS  V  L   +RS+A  L      ++GES L+++
Sbjct  3    ASTEGLVPITRAFLASYYDNHPFTPLSPNVDTLSSRLRSIADHLLSQFPPNQGESNLINK  62

Query  476  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  655
            A++ PPHKIDENMW+NRE IEE +FLL+RSNWP  L+QQST  + EL  +L +LK K  +
Sbjct  63   ADAQPPHKIDENMWRNREYIEETIFLLERSNWPEALKQQSTPDNVELATMLEQLKHKLHN  122

Query  656  ALEVLVTFQARNSEHVFNTVMT  721
             L+ L +FQ +N+EHVFNTVMT
Sbjct  123  TLKSLESFQIKNAEHVFNTVMT  144



>ref|XP_002872981.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49240.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  +I S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDIASLIQLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_007134600.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
 gb|ESW06594.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
Length=445

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDKH F PLS +V+RL  +IRS+A D       ++GE++L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKHPFTPLSADVTRLSSQIRSLANDFLTQHPPTQGEAVLIE  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDENMWKNRE IEE +FLL+ SNWP +L+QQS     E      +LK+K  
Sbjct  61   EADRLPPHKIDENMWKNREYIEETIFLLESSNWPEVLKQQSAPDSVEFALTFGQLKDKLY  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL+ + +FQ +N+EHVF TVMT
Sbjct  121  NALKAVESFQIKNAEHVFYTVMT  143



>ref|XP_010490476.1| PREDICTED: uncharacterized protein LOC104768250 isoform X1 [Camelina 
sativa]
 ref|XP_010490478.1| PREDICTED: uncharacterized protein LOC104768250 isoform X3 [Camelina 
sativa]
Length=434

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST+GLVPITR FLASYYDK+ FPPLSD VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTDGLVPITRDFLASYYDKYPFPPLSDGVSRLSSDIATLIQLLTVQSPPSEGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLEPSRWPIQLREPSTSEDAEFASILRNLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             A   +++FQ +NSE +F+TVMT
Sbjct  121  IAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_010490477.1| PREDICTED: uncharacterized protein LOC104768250 isoform X2 [Camelina 
sativa]
Length=434

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST+GLVPITR FLASYYDK+ FPPLSD VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTDGLVPITRDFLASYYDKYPFPPLSDGVSRLSSDIATLIQLLTVQSPPSEGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLEPSRWPIQLREPSTSEDAEFASILRNLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             A   +++FQ +NSE +F+TVMT
Sbjct  121  IAFTAMISFQTKNSERIFSTVMT  143



>dbj|BAD43795.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|NP_195721.5| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42982.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43305.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43143.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43301.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43345.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43526.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43539.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43565.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43716.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43767.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43772.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43786.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43808.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44005.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44013.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44023.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44099.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44270.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44410.1| unknown protein [Arabidopsis thaliana]
 gb|AED90282.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=438

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|NP_001154688.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56815.1| AT5G01010 [Arabidopsis thaliana]
 gb|AED90284.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=429

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana]
Length=448

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_010496822.1| PREDICTED: uncharacterized protein LOC104773850 [Camelina sativa]
Length=434

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLASYYD + FPPLSD+VSRL  +I ++ + L      SEGE+ L+ 
Sbjct  1    MASTEGLVPITRDFLASYYDTYPFPPLSDDVSRLSSDITTLIQLLTVQSPPSEGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DA+  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPIQLREPSTSEDADFASILRNLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             A   +++FQ +NSE +F+TVMT
Sbjct  121  IAFTAMISFQTKNSERIFSTVMT  143



>ref|NP_001154687.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90283.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=479

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_006842639.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
 gb|ERN04314.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
Length=440

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAST GLVPITRA L+ YYD H F PLS++V RL DE+R  ++ LQ+      GE++L  
Sbjct  1    MASTAGLVPITRAILSRYYDNHHFNPLSEDVPRLSDELREFSKALQEEVPPIAGEAILAQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EAEST PHKIDEN+WKNRE IEEILFLL++S+WPT LQQ S+ +D EL A L +L+ K  
Sbjct  61   EAESTSPHKIDENLWKNREHIEEILFLLEKSHWPTQLQQHSSPEDVELAATLQKLEVKMR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L +FQ++N+E+VFN VMT
Sbjct  121  NILKTLESFQSKNTENVFNIVMT  143



>ref|XP_007205211.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
 gb|EMJ06410.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
Length=438

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGES-LLV  469
            MASTEG+VPITRAFLASYYD +QF PLS++V+RL  EIRS   DL      +EGE  LLV
Sbjct  1    MASTEGIVPITRAFLASYYDTYQFSPLSNDVARLSSEIRSFTADLLNSSPAAEGEERLLV  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E ES PPHK+DENMWKNRE +EEIL+LL++ +WP   + Q +  DAEL  ++ RL +KF
Sbjct  61   SELESEPPHKVDENMWKNREHMEEILYLLEKPHWP---RSQLSPDDAELATIIDRLHQKF  117

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +++L+ L +FQA+NSE VFNTVMT
Sbjct  118  QTSLKTLESFQAKNSERVFNTVMT  141



>dbj|BAD43433.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43633.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43683.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43717.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43821.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNR Q+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNRGQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_006279346.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
 gb|EOA12244.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
Length=434

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYY+K+ F PLSD+VSRL  +I S+ + L      S+G + L+ 
Sbjct  1    MASTEGLVPITRAFLASYYEKYPFTPLSDDVSRLSSDIASLIQLLTVQSPPSQGVTSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L++ ST++DA+  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPIQLREPSTSEDADFASILQNLKDNFD  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +A   +++FQ +NSE +F+TVMT
Sbjct  121  NAFTAMISFQTKNSERIFSTVMT  143



>ref|XP_010543129.1| PREDICTED: uncharacterized protein LOC104816146 isoform X4 [Tarenaya 
hassleriana]
Length=373

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L  L++FQ +NSE VF+TVMT
Sbjct  121  NTLASLISFQTKNSERVFSTVMT  143



>ref|XP_008463317.1| PREDICTED: uncharacterized protein LOC103501503 isoform X2 [Cucumis 
melo]
Length=411

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFAPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNRE +EEILFLL++S WP  +Q++S    +EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLLEKSRWPQEVQKESATGKSELANIIGKLEEKAR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL VLV FQ++NSEHVFNTVMT
Sbjct  121  NALHVLVAFQSKNSEHVFNTVMT  143



>ref|XP_010543128.1| PREDICTED: uncharacterized protein LOC104816146 isoform X3 [Tarenaya 
hassleriana]
Length=384

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L  L++FQ +NSE VF+TVMT
Sbjct  121  NTLASLISFQTKNSERVFSTVMT  143



>ref|XP_008463316.1| PREDICTED: uncharacterized protein LOC103501503 isoform X1 [Cucumis 
melo]
Length=436

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFAPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNRE +EEILFLL++S WP  +Q++S    +EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLLEKSRWPQEVQKESATGKSELANIIGKLEEKAR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL VLV FQ++NSEHVFNTVMT
Sbjct  121  NALHVLVAFQSKNSEHVFNTVMT  143



>ref|XP_004163944.1| PREDICTED: uncharacterized LOC101218161 [Cucumis sativus]
Length=331

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFTPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNRE +EEILFL ++S WP  +Q++S   ++EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLFEKSRWPQEVQKESATGESELANIIGKLEEKAR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL  LV FQ++NSEHVFNTVMT
Sbjct  121  NALHALVAFQSKNSEHVFNTVMT  143



>ref|NP_001190197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90285.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=472

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGL+PITRAFLASYYDK+ F PLSD+VSRL  ++ S+ + L      S+GE+ L+ 
Sbjct  1    MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLLTVQSPPSQGETSLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFD  120

Query  653  SALEVLVTFQARNSEHVFNT  712
            +A   +++FQ +NSE +F+T
Sbjct  121  NAFTAMISFQTKNSERIFST  140



>ref|XP_010543127.1| PREDICTED: uncharacterized protein LOC104816146 isoform X2 [Tarenaya 
hassleriana]
Length=437

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L  L++FQ +NSE VF+TVMT
Sbjct  121  NTLASLISFQTKNSERVFSTVMT  143



>ref|XP_010543126.1| PREDICTED: uncharacterized protein LOC104816146 isoform X1 [Tarenaya 
hassleriana]
Length=448

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLASYYDK+ F PLSD+V RL  EI S+ + L      SEGE  L+ 
Sbjct  1    MASTEGLVPITRAFLASYYDKYPFHPLSDDVPRLSSEIASLLQLLLLHSPPSEGEIPLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L+  +T+ D+E  ++L  L +KF 
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPPQLKDPTTSDDSEFSSMLRHLNDKFR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L  L++FQ +NSE VF+TVMT
Sbjct  121  NTLASLISFQTKNSERVFSTVMT  143



>ref|XP_004147520.1| PREDICTED: uncharacterized protein LOC101218161 [Cucumis sativus]
 gb|KGN53967.1| hypothetical protein Csa_4G197820 [Cucumis sativus]
Length=436

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MAS EGLVPITR FLASYYDK+ F PLSD VSRL  E+ ++A  L      +  ES L+ 
Sbjct  1    MASMEGLVPITRHFLASYYDKYPFTPLSDHVSRLSTEMLALANSLLDELPPTSEESTLLD  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNRE +EEILFL ++S WP  +Q++S   ++EL  ++ +L+EK  
Sbjct  61   EANQHPPHKIDENMWKNRENVEEILFLFEKSRWPQEVQKESATGESELANIIGKLEEKAR  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            +AL  LV FQ++NSEHVFNTVMT
Sbjct  121  NALHALVAFQSKNSEHVFNTVMT  143



>gb|KFK24699.1| hypothetical protein AALP_AA8G013300 [Arabis alpina]
Length=427

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 5/143 (3%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRA+L+SYYDK+ FPPLS +VSRL  +I S+   L      S GE+ L+ 
Sbjct  1    MASTEGLVPITRAYLSSYYDKYPFPPLSGDVSRLSCDISSLIHLLTLQSPPSPGEASLID  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDENMWKNREQ+EEILFLL+ S WP  L     ++DAE   +L  LK+KF+
Sbjct  61   EANRQPPHKIDENMWKNREQMEEILFLLQPSRWPLQL-----SEDAEFSCILRHLKDKFD  115

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
             AL  +V+FQ++NSE VF TVMT
Sbjct  116  IALAAMVSFQSKNSERVFTTVMT  138



>ref|XP_010673452.1| PREDICTED: uncharacterized protein LOC104889827 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 4/143 (3%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRA+LASYY+K+ F PLS +V+ L  +IRS+  + Q      +GES +V 
Sbjct  1    MASTEGLVPITRAYLASYYEKYPFVPLSADVATLSAQIRSIITNFQT----HQGESSVVD  56

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            E +   PHKIDENMWKNRE IEEI+FLL R++WPT  QQQS   D EL   L +LK KFE
Sbjct  57   EVDHEAPHKIDENMWKNREHIEEIIFLLDRTHWPTTFQQQSRLGDVELAPFLEQLKVKFE  116

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L  FQ++N+++VFNTVM+
Sbjct  117  NTLKTLEYFQSKNADYVFNTVMS  139



>ref|XP_010938085.1| PREDICTED: uncharacterized protein LOC105057244 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLA YYDK+  P LSD++ RL  E+R  A  L +    + GE L+V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPRLSDDIPRLTAELRGFADGLLREHAPTSGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDEN+WKNRE IEEILFLL  S+ P  LQ+++T +D +L AV   ++ KF+
Sbjct  61   EADCEPPHKIDENLWKNREHIEEILFLLDDSHRPRSLQEKATPEDIDLAAVFGDIEAKFK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            ++L+ L TFQ RN++++F+TVMT
Sbjct  121  TSLKTLETFQLRNADNIFSTVMT  143



>ref|XP_010938084.1| PREDICTED: uncharacterized protein LOC105057244 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLA YYDK+  P LSD++ RL  E+R  A  L +    + GE L+V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPRLSDDIPRLTAELRGFADGLLREHAPTSGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA+  PPHKIDEN+WKNRE IEEILFLL  S+ P  LQ+++T +D +L AV   ++ KF+
Sbjct  61   EADCEPPHKIDENLWKNREHIEEILFLLDDSHRPRSLQEKATPEDIDLAAVFGDIEAKFK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            ++L+ L TFQ RN++++F+TVMT
Sbjct  121  TSLKTLETFQLRNADNIFSTVMT  143



>ref|XP_011006222.1| PREDICTED: uncharacterized protein LOC105112277 [Populus euphratica]
Length=435

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARD-LQQGRTLSEGESLLV  469
            MASTEGLVPITR FLASYYDK+ F PL D+VSRL  EIRSM  D L++    S+ ESLL+
Sbjct  1    MASTEGLVPITRIFLASYYDKYPFTPLPDDVSRLSSEIRSMTSDLLKESPPSSQDESLLL  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E+E   PHKIDENMWKNRE +EEI+FLL  S  P  LQ      D+EL  V   ++ KF
Sbjct  61   KESEGESPHKIDENMWKNREHMEEIIFLLNESRCPQPLQ-----DDSELSTVFNNMRYKF  115

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +  L VL  FQA NS+HVFNTVMT
Sbjct  116  QKTLNVLQDFQAVNSDHVFNTVMT  139



>ref|XP_002323111.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
 gb|EEF04872.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
Length=435

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 6/144 (4%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARD-LQQGRTLSEGESLLV  469
            MASTEGLVPITR FLASYYDK+ F PL D+VSRL  EIRSM  D L+     S+ ESLL+
Sbjct  1    MASTEGLVPITRIFLASYYDKYPFTPLPDDVSRLSSEIRSMTSDLLKDSPPSSQDESLLL  60

Query  470  HEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKF  649
             E+E   PHKIDENMWKNRE +EEI+FLL  S+ P  LQ      D+EL  V   ++ KF
Sbjct  61   KESEGESPHKIDENMWKNREHMEEIIFLLHESHCPQPLQ-----DDSELSTVFNNIRYKF  115

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
            +  L VL  FQA NS+HVFNTVMT
Sbjct  116  QKTLNVLQDFQAVNSDHVFNTVMT  139



>ref|XP_008793391.1| PREDICTED: uncharacterized protein LOC103709697 isoform X3 [Phoenix 
dactylifera]
Length=413

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P  LQ+++T +D ++ AV   ++ KF+
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRPRSLQEKATPEDMDIAAVFGDIEAKFK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            ++L+ L TFQ RN++++F+TVMT
Sbjct  121  TSLKTLETFQLRNADNIFSTVMT  143



>ref|XP_008793389.1| PREDICTED: uncharacterized protein LOC103709697 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P  LQ+++T +D ++ AV   ++ KF+
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRPRSLQEKATPEDMDIAAVFGDIEAKFK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            ++L+ L TFQ RN++++F+TVMT
Sbjct  121  TSLKTLETFQLRNADNIFSTVMT  143



>ref|XP_003626627.1| hypothetical protein MTR_8g005040 [Medicago truncatula]
 gb|ABE93045.1| Proteinase inhibitor I4, serpin; emp24/gp25L/p24 [Medicago truncatula]
 gb|AET01103.1| serpin, putative [Medicago truncatula]
Length=428

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 101/144 (70%), Gaps = 11/144 (8%)
 Frame = +2

Query  296  ASTEGLVPITRAFLASYYDKHQF-PPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            ASTEGLVPITRAFL+SYYDKH F PPLS +VS L   +R+MA DL       + E+L   
Sbjct  3    ASTEGLVPITRAFLSSYYDKHPFTPPLSSDVSHLTSLLRTMATDLG-----IDDEALTF-  56

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTML-QQQSTAQDAELGAVLLRLKEKF  649
               + PPHKIDENMWKNRE IEE +FLL++SNWP  L QQQST  + +   +L +LK+K 
Sbjct  57   ---TQPPHKIDENMWKNREYIEETIFLLQQSNWPDPLKQQQSTPDNIQFSIILGKLKDKL  113

Query  650  ESALEVLVTFQARNSEHVFNTVMT  721
               L  L +FQ +N++HVFNTVMT
Sbjct  114  HRTLTTLESFQIKNADHVFNTVMT  137



>ref|XP_010921251.1| PREDICTED: uncharacterized protein LOC105044884 isoform X2 [Elaeis 
guineensis]
Length=438

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L +   L+ GE L+V+
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSLLREFPLTSGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            E +  PP KIDEN+WKNRE IEEILFLL+ S  P +LQQ ++ +  ++ AV   ++ K +
Sbjct  61   EVDREPPRKIDENLWKNREHIEEILFLLEDSYQPRLLQQNASPEYVDIAAVFGDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L  FQ +N+++VFNTVMT
Sbjct  121  TTLKTLEMFQLKNADNVFNTVMT  143



>ref|XP_010921250.1| PREDICTED: uncharacterized protein LOC105044884 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L +   L+ GE L+V+
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSLLREFPLTSGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            E +  PP KIDEN+WKNRE IEEILFLL+ S  P +LQQ ++ +  ++ AV   ++ K +
Sbjct  61   EVDREPPRKIDENLWKNREHIEEILFLLEDSYQPRLLQQNASPEYVDIAAVFGDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L  FQ +N+++VFNTVMT
Sbjct  121  TTLKTLEMFQLKNADNVFNTVMT  143



>ref|XP_002440877.1| hypothetical protein SORBIDRAFT_09g012090 [Sorghum bicolor]
 gb|EES19307.1| hypothetical protein SORBIDRAFT_09g012090 [Sorghum bicolor]
Length=152

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA+TEGLVPITR +LA YYD +  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRTYLARYYDNYPLPPLPDATTDLAARLRALSADLAAVAPITPDEELLEQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDEN+WKNREQ+EEILFL+  S  P  LQQ+ST +DA++   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSRRPVALQQKSTPEDAQIVCTLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ  N++ VFNTVMT
Sbjct  121  DMLKKLEQFQLENADSVFNTVMT  143



>gb|AFW77522.1| hypothetical protein ZEAMMB73_436424, partial [Zea mays]
Length=248

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 97/143 (68%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MAMTEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  121  DMLKNLEQFQLKNADNVFNTVMT  143



>ref|XP_004962481.1| PREDICTED: uncharacterized protein LOC101772803 isoform X1 [Setaria 
italica]
Length=439

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVALQQKSTPEDTEIVSKLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMT  143



>ref|XP_004962482.1| PREDICTED: uncharacterized protein LOC101772803 isoform X2 [Setaria 
italica]
Length=437

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVALQQKSTPEDTEIVSKLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMT  143



>ref|XP_004962483.1| PREDICTED: uncharacterized protein LOC101772803 isoform X3 [Setaria 
italica]
Length=437

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA+TEGLVPITRA+LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MATTEGLVPITRAYLARYYDKYPLPPLPDAATDLAARLRALSADLAAVAPITPDEELLKQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDENMWKNREQ+EEILFLL  S  P  LQQ+ST +D E+ + L  ++ K +
Sbjct  61   EAAGIPAHKIDENMWKNREQMEEILFLLNTSRRPVQLQQKSTPEDTEIVSKLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  121  DMLKKLEQFQLKNADNVFNTVMT  143



>ref|XP_009391656.1| PREDICTED: uncharacterized protein LOC103977773 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  296  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  475
            +S EGLVPITRAFLA YYD    PPLS++VSRL  E+R ++  L +   L+ GE LLVHE
Sbjct  3    SSAEGLVPITRAFLARYYDTCPLPPLSEDVSRLTAELRELSDGLARESPLTSGEELLVHE  62

Query  476  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  655
             +  P HKIDEN+WKNRE IEEIL LL+ S+ P +LQ+++  +  ++ A L  L+ K  S
Sbjct  63   VDHQPAHKIDENLWKNRENIEEILVLLEESHRPRLLQEKAIPEYVDIAATLGELEVKLRS  122

Query  656  ALEVLVTFQARNSEHVFNTVMT  721
             L+ L  FQ  N+++VFNTVMT
Sbjct  123  TLKTLEAFQQTNADNVFNTVMT  144



>ref|XP_006654248.1| PREDICTED: uncharacterized protein LOC102707586 [Oryza brachyantha]
Length=437

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 98/141 (70%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITRA+LA YYDK+  PPL D V+ L D +R+++  L     ++  E LL  EA
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAVTDLADRLRALSAGLAAVAPITPDEELLEKEA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDEN+WKNREQ+EEILFLL +S  P  LQQ STA+D +  ++L  ++ K +  
Sbjct  62   SGIPAHKIDENLWKNREQMEEILFLLSKSCRPVALQQNSTAEDTQTFSILDDVETKLKDM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ +N+++VFNTVMT
Sbjct  122  LKKLEQFQIKNADNVFNTVMT  142



>gb|AFW77521.1| hypothetical protein ZEAMMB73_436424 [Zea mays]
Length=412

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 97/143 (68%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  
Sbjct  1    MAMTEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQ  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +
Sbjct  61   EAAGIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  121  DMLKNLEQFQLKNADNVFNTVMT  143



>ref|XP_010231534.1| PREDICTED: uncharacterized protein LOC100826543 isoform X3 [Brachypodium 
distachyon]
Length=339

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ  N+++VFNTVMT
Sbjct  122  LKKLEQFQLTNADNVFNTVMT  142



>dbj|BAJ93195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ DL      S  E  L  EA
Sbjct  2    TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSTDLAAAFPFSPDEEHLEQEA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  62   SGVPAHKIDENMWKNREQMEEILFLLNKSRRPIALQQKSTQEDAEIVSTLDNCETKLKEM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ +N+++VFNTVMT
Sbjct  122  LKKLEQFQLKNADNVFNTVMT  142



>ref|XP_003568677.1| PREDICTED: uncharacterized protein LOC100826543 isoform X1 [Brachypodium 
distachyon]
Length=437

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ  N+++VFNTVMT
Sbjct  122  LKKLEQFQLTNADNVFNTVMT  142



>ref|XP_010231533.1| PREDICTED: uncharacterized protein LOC100826543 isoform X2 [Brachypodium 
distachyon]
Length=423

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PPL D V+ L   +R M+ DL     +S  E LL  EA
Sbjct  2    ATEGLVPITRDYLARYYDKYPLPPLPDGVTTLAARLRDMSADLAAVAPMSPDEELLGREA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +D E+   L  ++ K +  
Sbjct  62   GGIPAHKIDENMWKNREQMEEILFLLNKSRRPNPLQQKSTPEDDEIACKLDVVETKIKDM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ  N+++VFNTVMT
Sbjct  122  LKKLEQFQLTNADNVFNTVMT  142



>ref|XP_008649464.1| PREDICTED: uncharacterized protein LOC103630158 isoform X2 [Zea 
mays]
Length=499

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +2

Query  302  TEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEAE  481
            TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  EA 
Sbjct  66   TEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQEAA  125

Query  482  STPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESAL  661
              P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +  L
Sbjct  126  GIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLKDML  185

Query  662  EVLVTFQARNSEHVFNTVMT  721
            + L  FQ +N+++VFNTVMT
Sbjct  186  KNLEQFQLKNADNVFNTVMT  205



>ref|XP_008649463.1| PREDICTED: uncharacterized protein LOC103630158 isoform X1 [Zea 
mays]
Length=501

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +2

Query  302  TEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEAE  481
            TEGLVPITR +LA YYDK+  PPL D  + L   +R+++ DL     ++  E LL  EA 
Sbjct  66   TEGLVPITRTYLARYYDKYPLPPLPDATTDLAARLRALSADLAAVAPIAPDEELLEQEAA  125

Query  482  STPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESAL  661
              P HKIDEN+WKNREQ+EEILFL+  S+ P  LQQ+ST +DAE+   L  ++ K +  L
Sbjct  126  GIPAHKIDENLWKNREQMEEILFLINTSHRPVALQQKSTPEDAEIVCTLDDIEAKLKDML  185

Query  662  EVLVTFQARNSEHVFNTVMT  721
            + L  FQ +N+++VFNTVMT
Sbjct  186  KNLEQFQLKNADNVFNTVMT  205



>ref|XP_008782731.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782732.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782733.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITRAFLA YYDK+  PPL D+V RL  E+R  +  L +   L+ GE L V+
Sbjct  1    MASTEGLVPITRAFLARYYDKYPLPPLPDDVPRLTAELRGFSDSLLREFPLTSGEELEVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   PP KIDEN+WKNRE IEEILFLL+ S+ P +LQ+++T +  ++ AV   ++ K +
Sbjct  61   EAGREPPQKIDENLWKNREHIEEILFLLEESHQPRLLQEKATPEYIDIAAVFGDIEAKLK  120

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            + L+ L TFQ +N+++VFNTVMT
Sbjct  121  TTLKTLETFQLKNADNVFNTVMT  143



>ref|NP_001055152.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAF17066.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAG92466.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78947.1| hypothetical protein OsI_19396 [Oryza sativa Indica Group]
Length=439

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRT--LSEGESLLVH  472
            +TEGLVPITRA+LA YYDK+  PPL D  + L D +R+++  L       ++  E LL  
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAATALADRLRAISAALALAAAAPITPDEELLEK  61

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDEN+WKNREQ+EEIL LL +S  P  LQQ+STA+D E   +L  ++ K +
Sbjct  62   EANGIPAHKIDENLWKNREQMEEILLLLNKSRRPVALQQRSTAEDTETFIILDDVETKLK  121

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  122  DMLKKLEQFQIKNADNVFNTVMT  144



>gb|EEE63181.1| hypothetical protein OsJ_17990 [Oryza sativa Japonica Group]
Length=431

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRT--LSEGESLLVH  472
            +TEGLVPITRA+LA YYDK+  PPL D  + L D +R+++  L       ++  E LL  
Sbjct  2    ATEGLVPITRAYLARYYDKYPLPPLPDAATALADRLRAISAALALAAAAPITPDEELLEK  61

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            EA   P HKIDEN+WKNREQ+EEIL LL +S  P  LQQ+STA+D E   +L  ++ K +
Sbjct  62   EANGIPAHKIDENLWKNREQMEEILLLLNKSRRPVALQQRSTAEDTETFIILDDVETKLK  121

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ L  FQ +N+++VFNTVMT
Sbjct  122  DMLKKLEQFQIKNADNVFNTVMT  144



>gb|EMS49914.1| hypothetical protein TRIUR3_19770 [Triticum urartu]
Length=402

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ +L      S  E  L  EA
Sbjct  2    TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSAELAAASPFSPEEEHLEQEA  61

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  62   SGVPAHKIDENMWKNREQMEEILFLLNKSRRPVALQQKSTLEDAEIVSTLDDCETKLKEM  121

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ +N+++VFNTVMT
Sbjct  122  LKKLEQFQLKNADNVFNTVMT  142



>gb|EMT26757.1| hypothetical protein F775_30139 [Aegilops tauschii]
Length=451

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  299  STEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHEA  478
            +TEGLVPITR +LA YYDK+  PP+ D V+ L   +R+++ +L      S  E  L  EA
Sbjct  135  TTEGLVPITRDYLARYYDKYPLPPIPDGVTALAARLRALSAELAAASPFSPEEEHLEQEA  194

Query  479  ESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESA  658
               P HKIDENMWKNREQ+EEILFLL +S  P  LQQ+ST +DAE+ + L   + K +  
Sbjct  195  SVVPAHKIDENMWKNREQMEEILFLLNKSRRPVALQQKSTPEDAEIVSTLDDCETKLKEM  254

Query  659  LEVLVTFQARNSEHVFNTVMT  721
            L+ L  FQ +N+++VFNTVMT
Sbjct  255  LKKLEQFQLKNADNVFNTVMT  275



>gb|KJB27585.1| hypothetical protein B456_005G0011002, partial [Gossypium raimondii]
Length=99

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  452  GESLLVHEAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLL  631
            GESLL+ EA+S PPHK+DENMWKNRE IEEILFLL+R +WP++LQQ STA+ AE    L 
Sbjct  13   GESLLIQEADSEPPHKMDENMWKNREHIEEILFLLERPHWPSVLQQSSTAEVAEFATTLG  72

Query  632  RLKEKFESALEVLVTFQARNSEHVFNT  712
            +LK+KF++ L +L +FQ++NSE VFNT
Sbjct  73   QLKDKFQATLRILESFQSKNSERVFNT  99



>ref|XP_008793390.1| PREDICTED: uncharacterized protein LOC103709697 isoform X2 [Phoenix 
dactylifera]
Length=419

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MA  EGLVPITRAFLA YYDK   PPLSD+V RL  E+R     L +    + GE L+V+
Sbjct  1    MALAEGLVPITRAFLARYYDKCPLPPLSDDVPRLTAELRGFVDGLLRELAPTFGEELVVN  60

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWP  574
            EA   PPHKIDEN+WKNRE IEEILFLL+ S+ P
Sbjct  61   EANREPPHKIDENLWKNREHIEEILFLLEDSHRP  94



>ref|XP_001765571.1| predicted protein [Physcomitrella patens]
 gb|EDQ69621.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (58%), Gaps = 0/142 (0%)
 Frame = +2

Query  296  ASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVHE  475
            AST GLVPI RAFLA +YDK+ F PL+ EV  L   +R      Q     S     L+ +
Sbjct  3    ASTAGLVPINRAFLAKFYDKYPFAPLAPEVETLLALLREHVHKAQTVSPGSRDNGALIGQ  62

Query  476  AESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFES  655
              +  PHK+DEN+WKNRE IEE+L LL +  WP+ L+   +++   +   + +++   + 
Sbjct  63   FNNPAPHKLDENLWKNREMIEEMLHLLSKRKWPSSLKGNVSSELEPVAERIKKMEVGLQQ  122

Query  656  ALEVLVTFQARNSEHVFNTVMT  721
             L+ LV FQ   SE +F+ V+T
Sbjct  123  LLDKLVAFQKVQSERIFSMVLT  144



>ref|XP_002991009.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
 gb|EFJ07817.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
Length=429

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FL+ +YD++ F  L+  ++    ++R     + +      G  L++ 
Sbjct  1    MASTEGLVPITRDFLSRFYDRYPFEALAPGIAAADSQLREENERMSKHCAEESGNDLIL-  59

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            +     PHKIDEN+WKNREQ+EEIL+LL++ +WP      ST    ++   L +L  + +
Sbjct  60   DLSFDSPHKIDENLWKNREQVEEILYLLEKRHWP------STLNGPQMPDKLYKLALELQ  113

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
              L+ +  +Q+ +SE +F+ ++T
Sbjct  114  GLLKFIEDYQSFSSEKIFSMILT  136



>ref|XP_002980642.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
 gb|EFJ18293.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
Length=429

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTLSEGESLLVH  472
            MASTEGLVPITR FL+ +YD++ F  L+  ++    ++R     + +      G  L++ 
Sbjct  1    MASTEGLVPITRDFLSRFYDRYPFEALAPGIAAADSQLREENERMSKHYAEESGNDLIL-  59

Query  473  EAESTPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFE  652
            +     PHKIDEN+WKNREQ+EEIL+LL++ +WP      S+    ++   L +L  + +
Sbjct  60   DLSFDSPHKIDENLWKNREQVEEILYLLEKRHWP------SSLNGPQMPDKLYKLALELQ  113

Query  653  SALEVLVTFQARNSEHVFNTVMT  721
            S L+ +  +Q  +SE +F+ ++T
Sbjct  114  SLLKFIEDYQYFSSEKIFSMILT  136



>gb|KDO64225.1| hypothetical protein CISIN_1g025201mg [Citrus sinensis]
Length=180

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  512  MWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARN  691
            MWKNRE +EEI+FLLKRS+WP  LQQ S  +D EL  VL +L EKFE  L  L +FQA N
Sbjct  1    MWKNREHMEEIIFLLKRSHWPATLQQSSAPEDVELANVLGKLSEKFEKTLNTLKSFQAVN  60

Query  692  SEHVFNTVMT  721
            S+ +FNTVMT
Sbjct  61   SDRIFNTVMT  70



>dbj|BAD43927.1| unnamed protein product [Arabidopsis thaliana]
Length=358

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  533  IEEILFLLKRSNWPTMLQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARNSEHVFNT  712
            +EEILFLL  S WP  L++ ST++DAE  ++L  LK+ F++A   +++FQ +NSE +F+T
Sbjct  1    MEEILFLLSPSRWPVQLREPSTSEDAEFASILRTLKDSFDNAFTAMISFQTKNSERIFST  60

Query  713  VMT  721
            VMT
Sbjct  61   VMT  63



>ref|XP_006381292.1| hypothetical protein POPTR_0006s11480g [Populus trichocarpa]
 gb|ERP59089.1| hypothetical protein POPTR_0006s11480g [Populus trichocarpa]
Length=71

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  427
            MASTEGLVPITR FLASY DK+ F PL D+VSRL  EIRS+  DL
Sbjct  1    MASTEGLVPITRKFLASYDDKYPFAPLPDDVSRLSSEIRSIITDL  45



>ref|XP_004353064.1| serpin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23536.1| serpin, putative [Acanthamoeba castellanii str. Neff]
Length=490

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 77/163 (47%), Gaps = 33/163 (20%)
 Frame = +2

Query  311  LVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDLQQGRTL-----SEGESLLVHE  475
            LVPITR  L  YY+ +   P SD +  L  E+++ A  L  G  L      EGES    +
Sbjct  11   LVPITREILRQYYETYPADPPSDNLKALRAEVQTAAHKL--GLKLPEKWNHEGESGAEVQ  68

Query  476  AES------------TPPHKIDENMWKNREQIEEILFLLKRSNWPTMLQQQSTAQDAELG  619
            A+             T PHK+DEN+W++R+Q+EEIL LL+    P  L    TA     G
Sbjct  69   ADDELNREVLGQNLLTVPHKMDENIWRSRQQLEEILHLLE----PAQLDDVETAAKGASG  124

Query  620  -------AVLLRLKEKFESALEVLVTFQA---RNSEHVFNTVM  718
                   A +  ++ K  +A E L  FQ    +  +H+ +T +
Sbjct  125  VSFDEWKAAVDGIRTKANAAFERLQEFQKGGMKKVQHIISTFL  167



>ref|XP_010921254.1| PREDICTED: uncharacterized protein LOC105044884 isoform X4 [Elaeis 
guineensis]
Length=362

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  427
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSL  45



>ref|XP_010921253.1| PREDICTED: uncharacterized protein LOC105044884 isoform X3 [Elaeis 
guineensis]
Length=396

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  293  MASTEGLVPITRAFLASYYDKHQFPPLSDEVSRLCDEIRSMARDL  427
            MASTEGLVPITR FLA YYDK+  PPL+D+V R   E+R  +  L
Sbjct  1    MASTEGLVPITRDFLARYYDKYPLPPLADDVPRFTAELRGFSDSL  45



>ref|XP_010496718.1| PREDICTED: uncharacterized protein LOC104773766, partial [Camelina 
sativa]
Length=303

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  581  LQQQSTAQDAELGAVLLRLKEKFESALEVLVTFQARNSEHVFNTVMT  721
            L++ ST++DA+  ++L  LK+ F+ A   +++FQ +NSE +F+TVMT
Sbjct  4    LREPSTSEDADFASILRNLKDNFDIAFTAMISFQTKNSERIFSTVMT  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425