BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020N16

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610469.1|  PREDICTED: nuclear envelope morphology prote...    194   2e-57   Nicotiana tomentosiformis
ref|XP_006338842.1|  PREDICTED: CTD small phosphatase-like protei...    194   8e-57   Solanum tuberosum [potatoes]
ref|XP_009610468.1|  PREDICTED: CTD nuclear envelope phosphatase ...    192   4e-56   Nicotiana tomentosiformis
ref|XP_009760937.1|  PREDICTED: nuclear envelope morphology prote...    190   5e-56   Nicotiana sylvestris
ref|XP_009760936.1|  PREDICTED: CTD nuclear envelope phosphatase ...    188   1e-54   Nicotiana sylvestris
ref|XP_004240939.1|  PREDICTED: CTD nuclear envelope phosphatase ...    183   6e-53   Solanum lycopersicum
emb|CDP14017.1|  unnamed protein product                                176   7e-50   Coffea canephora [robusta coffee]
ref|XP_004239942.1|  PREDICTED: carboxy-terminal domain RNA polym...    171   7e-48   Solanum lycopersicum
ref|XP_006355653.1|  PREDICTED: CTD small phosphatase-like protei...    169   4e-47   Solanum tuberosum [potatoes]
ref|XP_011084905.1|  PREDICTED: LOW QUALITY PROTEIN: CTD nuclear ...    162   6e-45   
ref|XP_011076695.1|  PREDICTED: CTD small phosphatase-like protein      160   3e-43   Sesamum indicum [beniseed]
ref|XP_002273682.1|  PREDICTED: carboxy-terminal domain RNA polym...    156   3e-42   Vitis vinifera
ref|XP_008442416.1|  PREDICTED: CTD small phosphatase-like protein 2    155   3e-42   Cucumis melo [Oriental melon]
gb|EYU20007.1|  hypothetical protein MIMGU_mgv1a010325mg                154   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_004137719.1|  PREDICTED: CTD small phosphatase-like protei...    151   2e-40   Cucumis sativus [cucumbers]
ref|XP_009805067.1|  PREDICTED: CTD small phosphatase-like protei...    146   1e-39   Nicotiana sylvestris
ref|XP_009805066.1|  PREDICTED: CTD small phosphatase-like protei...    145   3e-39   Nicotiana sylvestris
ref|XP_006843565.1|  hypothetical protein AMTR_s00007p00087260          141   2e-37   
ref|XP_004302575.1|  PREDICTED: carboxy-terminal domain RNA polym...    142   5e-37   Fragaria vesca subsp. vesca
ref|XP_010264631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    142   5e-37   Nelumbo nucifera [Indian lotus]
gb|EPS72976.1|  hypothetical protein M569_01780                         141   1e-36   Genlisea aurea
ref|XP_009622999.1|  PREDICTED: CTD small phosphatase-like protein 2    140   2e-36   Nicotiana tomentosiformis
ref|XP_008243657.1|  PREDICTED: carboxy-terminal domain RNA polym...    140   2e-36   Prunus mume [ume]
ref|XP_007205648.1|  hypothetical protein PRUPE_ppa009333mg             139   6e-36   Prunus persica
ref|XP_010689631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    137   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002265560.1|  PREDICTED: CTD small phosphatase-like protein      130   1e-32   Vitis vinifera
ref|XP_008370103.1|  PREDICTED: carboxy-terminal domain RNA polym...    129   2e-32   
ref|XP_009377758.1|  PREDICTED: carboxy-terminal domain RNA polym...    129   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_008370102.1|  PREDICTED: carboxy-terminal domain RNA polym...    129   4e-32   
ref|XP_010535319.1|  PREDICTED: carboxy-terminal domain RNA polym...    127   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_010504466.1|  PREDICTED: carboxy-terminal domain RNA polym...    126   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006403042.1|  hypothetical protein EUTSA_v10006119mg             126   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010516189.1|  PREDICTED: carboxy-terminal domain RNA polym...    126   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008345306.1|  PREDICTED: probable C-terminal domain small ...    125   7e-31   Malus domestica [apple tree]
ref|XP_007008963.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    123   9e-31   
ref|XP_002878054.1|  NLI interacting factor family protein              124   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_011035940.1|  PREDICTED: CTD nuclear envelope phosphatase 1      124   2e-30   Populus euphratica
gb|KDP44760.1|  hypothetical protein JCGZ_01260                         124   2e-30   Jatropha curcas
ref|XP_009369172.1|  PREDICTED: probable C-terminal domain small ...    124   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_007218742.1|  hypothetical protein PRUPE_ppa009189mg             124   2e-30   Prunus persica
ref|XP_002533382.1|  conserved hypothetical protein                     123   3e-30   
ref|NP_191155.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...    124   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009346338.1|  PREDICTED: uncharacterized protein LOC103938066    120   4e-30   
ref|XP_010427400.1|  PREDICTED: carboxy-terminal domain RNA polym...    123   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007008962.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    122   1e-29   
ref|XP_002312160.2|  NLI interacting factor family protein              122   1e-29   
ref|XP_002315157.2|  NLI interacting factor family protein              120   2e-29   
gb|KJB78769.1|  hypothetical protein B456_013G018000                    120   4e-29   Gossypium raimondii
ref|XP_006378658.1|  hypothetical protein POPTR_0010s19580g             120   6e-29   Populus trichocarpa [western balsam poplar]
emb|CDX67629.1|  BnaA07g16690D                                          120   8e-29   
gb|KFK34835.1|  hypothetical protein AALP_AA5G199300                    119   9e-29   Arabis alpina [alpine rockcress]
gb|KHG26951.1|  putative phosphatase PSR2                               120   1e-28   Gossypium arboreum [tree cotton]
gb|KHG26952.1|  ctdspl2                                                 119   1e-28   Gossypium arboreum [tree cotton]
ref|XP_009103976.1|  PREDICTED: CTD small phosphatase-like protein      117   7e-28   Brassica rapa
ref|XP_006435743.1|  hypothetical protein CICLE_v10031856mg             118   9e-28   Citrus clementina [clementine]
ref|XP_006291562.1|  hypothetical protein CARUB_v10017717mg             117   1e-27   Capsella rubella
ref|XP_011046823.1|  PREDICTED: CTD nuclear envelope phosphatase ...    116   1e-27   Populus euphratica
ref|XP_010517421.1|  PREDICTED: CTD nuclear envelope phosphatase ...    115   2e-27   Camelina sativa [gold-of-pleasure]
gb|KDO68955.1|  hypothetical protein CISIN_1g022258mg                   115   2e-27   Citrus sinensis [apfelsine]
gb|KJB74329.1|  hypothetical protein B456_011G288400                    114   4e-27   Gossypium raimondii
ref|XP_010505730.1|  PREDICTED: CTD small phosphatase-like protei...    115   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010517419.1|  PREDICTED: CTD nuclear envelope phosphatase ...    115   4e-27   
ref|XP_010505729.1|  PREDICTED: CTD small phosphatase-like protei...    115   5e-27   
ref|XP_010508910.1|  PREDICTED: probable C-terminal domain small ...    115   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010505722.1|  PREDICTED: CTD small phosphatase-like protei...    115   6e-27   
emb|CDY46516.1|  BnaC06g15690D                                          115   6e-27   Brassica napus [oilseed rape]
ref|XP_010505726.1|  PREDICTED: CTD small phosphatase-like protei...    115   6e-27   
ref|XP_010517420.1|  PREDICTED: CTD nuclear envelope phosphatase ...    115   7e-27   Camelina sativa [gold-of-pleasure]
gb|KDO68954.1|  hypothetical protein CISIN_1g022258mg                   114   7e-27   Citrus sinensis [apfelsine]
gb|KDO68952.1|  hypothetical protein CISIN_1g022258mg                   114   8e-27   Citrus sinensis [apfelsine]
ref|XP_010517418.1|  PREDICTED: CTD nuclear envelope phosphatase ...    115   9e-27   
ref|XP_010517411.1|  PREDICTED: CTD nuclear envelope phosphatase ...    115   1e-26   
gb|KJB74328.1|  hypothetical protein B456_011G288400                    114   1e-26   Gossypium raimondii
gb|KJB74327.1|  hypothetical protein B456_011G288400                    114   1e-26   Gossypium raimondii
ref|XP_010508909.1|  PREDICTED: CTD small phosphatase-like protei...    114   2e-26   
ref|XP_009141872.1|  PREDICTED: carboxy-terminal domain RNA polym...    113   2e-26   Brassica rapa
ref|XP_009116289.1|  PREDICTED: CTD small phosphatase-like protei...    113   3e-26   Brassica rapa
emb|CDX93216.1|  BnaC04g46800D                                          113   3e-26   
emb|CDY07060.1|  BnaA04g22550D                                          112   5e-26   
emb|CDX72186.1|  BnaC08g26880D                                          111   1e-25   
ref|XP_002309143.2|  hypothetical protein POPTR_0006s10170g             111   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009392189.1|  PREDICTED: CTD nuclear envelope phosphatase ...    110   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006294651.1|  hypothetical protein CARUB_v10023688mg             109   5e-25   
emb|CDY27252.1|  BnaA09g35500D                                          109   7e-25   Brassica napus [oilseed rape]
ref|XP_008805431.1|  PREDICTED: carboxy-terminal domain RNA polym...    109   8e-25   Phoenix dactylifera
ref|XP_008805436.1|  PREDICTED: carboxy-terminal domain RNA polym...    108   8e-25   Phoenix dactylifera
ref|XP_006294652.1|  hypothetical protein CARUB_v10023688mg             108   9e-25   
ref|XP_010922553.1|  PREDICTED: CTD small phosphatase-like protein 2    108   1e-24   Elaeis guineensis
ref|XP_004970462.1|  PREDICTED: CTD small phosphatase-like protei...    108   1e-24   Setaria italica
ref|NP_001148462.1|  LOC100282077                                       108   1e-24   Zea mays [maize]
ref|XP_009116288.1|  PREDICTED: CTD small phosphatase-like protei...    108   1e-24   Brassica rapa
ref|XP_006411263.1|  hypothetical protein EUTSA_v10016941mg             108   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_008388217.1|  PREDICTED: uncharacterized protein LOC103450630    105   3e-24   
ref|XP_002458718.1|  hypothetical protein SORBIDRAFT_03g038910          107   4e-24   Sorghum bicolor [broomcorn]
gb|EMT13698.1|  CTD small phosphatase-like protein 2                    106   9e-24   
ref|XP_003564541.1|  PREDICTED: CTD small phosphatase-like protein      105   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_011019110.1|  PREDICTED: carboxy-terminal domain RNA polym...    105   1e-23   Populus euphratica
emb|CDM84840.1|  unnamed protein product                                105   1e-23   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001044710.1|  Os01g0833100                                       105   2e-23   
gb|EEC71746.1|  hypothetical protein OsI_04315                          105   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_009416286.1|  PREDICTED: CTD nuclear envelope phosphatase ...    105   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010101420.1|  CTD small phosphatase-like protein                 105   2e-23   Morus notabilis
ref|NP_001136647.1|  uncharacterized protein LOC100216776               106   2e-23   Zea mays [maize]
ref|XP_008672265.1|  PREDICTED: uncharacterized protein LOC100216...    105   2e-23   Zea mays [maize]
gb|ACG32959.1|  CTD small phosphatase-like protein                      105   2e-23   Zea mays [maize]
dbj|BAJ91589.1|  predicted protein                                      105   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK23193.1|  hypothetical protein AALP_AAs48948U000100               105   2e-23   Arabis alpina [alpine rockcress]
ref|XP_003616639.1|  CTD small phosphatase-like protein                 103   7e-23   Medicago truncatula
gb|KCW86105.1|  hypothetical protein EUGRSUZ_B02803                     102   1e-22   Eucalyptus grandis [rose gum]
ref|XP_009344958.1|  PREDICTED: carboxy-terminal domain RNA polym...    102   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_008374036.1|  PREDICTED: CTD small phosphatase-like protein      102   2e-22   Malus domestica [apple tree]
gb|KDO56646.1|  hypothetical protein CISIN_1g020937mg                   101   2e-22   Citrus sinensis [apfelsine]
ref|XP_010044096.1|  PREDICTED: CTD small phosphatase-like protein      102   4e-22   Eucalyptus grandis [rose gum]
emb|CDP02804.1|  unnamed protein product                              95.9    9e-22   Coffea canephora [robusta coffee]
ref|XP_010095241.1|  CTD small phosphatase-like protein 2             99.8    9e-22   
gb|KDO56645.1|  hypothetical protein CISIN_1g020937mg                   100   1e-21   Citrus sinensis [apfelsine]
ref|XP_009616349.1|  PREDICTED: uncharacterized protein C2F7.02c-...  99.4    1e-21   
ref|XP_004307664.1|  PREDICTED: CTD nuclear envelope phosphatase ...  99.8    2e-21   Fragaria vesca subsp. vesca
ref|XP_006646453.1|  PREDICTED: CTD small phosphatase-like protei...  99.4    2e-21   
ref|XP_011019111.1|  PREDICTED: carboxy-terminal domain RNA polym...  99.4    3e-21   Populus euphratica
ref|XP_006429395.1|  hypothetical protein CICLE_v10012210mg           99.0    4e-21   Citrus clementina [clementine]
ref|XP_006481044.1|  PREDICTED: CTD small phosphatase-like protei...  99.0    4e-21   Citrus sinensis [apfelsine]
ref|XP_002439933.1|  hypothetical protein SORBIDRAFT_09g022940        97.1    2e-20   Sorghum bicolor [broomcorn]
gb|KDP24445.1|  hypothetical protein JCGZ_25009                       97.1    2e-20   Jatropha curcas
gb|KHN48568.1|  CTD small phosphatase-like protein 2                  96.7    2e-20   Glycine soja [wild soybean]
ref|NP_001242244.1|  uncharacterized protein LOC100783451             96.7    3e-20   Glycine max [soybeans]
ref|XP_009406928.1|  PREDICTED: CTD nuclear envelope phosphatase ...  96.7    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN64082.1|  hypothetical protein VITISV_006933                   93.2    1e-19   Vitis vinifera
ref|XP_008463241.1|  PREDICTED: carboxy-terminal domain RNA polym...  94.4    1e-19   Cucumis melo [Oriental melon]
ref|XP_004149232.1|  PREDICTED: CTD small phosphatase-like protei...  94.4    1e-19   Cucumis sativus [cucumbers]
ref|XP_010534600.1|  PREDICTED: CTD small phosphatase-like protein    94.4    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_004491033.1|  PREDICTED: CTD small phosphatase-like protei...  94.0    2e-19   Cicer arietinum [garbanzo]
ref|XP_007141763.1|  hypothetical protein PHAVU_008G223800g           91.7    5e-19   Phaseolus vulgaris [French bean]
gb|AFK34480.1|  unknown                                               91.7    1e-18   Lotus japonicus
emb|CAN74278.1|  hypothetical protein VITISV_004711                   92.4    1e-18   Vitis vinifera
ref|XP_007141764.1|  hypothetical protein PHAVU_008G223800g           91.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_006655392.1|  PREDICTED: CTD small phosphatase-like protei...  91.3    1e-18   Oryza brachyantha
ref|XP_003600913.1|  CTD small phosphatase-like protein               90.9    2e-18   Medicago truncatula
gb|KHN20843.1|  CTD small phosphatase-like protein 2                  90.1    5e-18   Glycine soja [wild soybean]
ref|XP_003545230.1|  PREDICTED: LOW QUALITY PROTEIN: carboxy-term...  90.5    7e-18   
ref|XP_009385548.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793248.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    8e-18   Phoenix dactylifera
ref|XP_002528087.1|  conserved hypothetical protein                   88.6    1e-17   
dbj|BAK00193.1|  predicted protein                                    88.2    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY98360.1|  hypothetical protein OsI_20271                        85.9    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004500494.1|  PREDICTED: probable C-terminal domain small ...  85.1    2e-16   Cicer arietinum [garbanzo]
ref|XP_004961795.1|  PREDICTED: CTD small phosphatase-like protei...  85.1    2e-16   Setaria italica
ref|XP_010231274.1|  PREDICTED: uncharacterized protein LOC100829084  84.7    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_002323581.2|  hypothetical protein POPTR_0016s12400g           82.0    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008656381.1|  PREDICTED: uncharacterized protein LOC103635...  80.1    3e-15   
ref|XP_008656380.1|  PREDICTED: probable phosphatase PSR2 isoform X1  80.1    5e-15   
gb|AFW82276.1|  hypothetical protein ZEAMMB73_719646                  79.7    7e-15   
ref|XP_008351210.1|  PREDICTED: uncharacterized protein LOC103414622  78.6    1e-14   
gb|KCW65681.1|  hypothetical protein EUGRSUZ_G03062                   79.0    2e-14   Eucalyptus grandis [rose gum]
gb|EMS66920.1|  CTD small phosphatase-like protein 2                  79.0    2e-14   Triticum urartu
ref|XP_010067527.1|  PREDICTED: CTD small phosphatase-like protein    79.0    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010920860.1|  PREDICTED: carboxy-terminal domain RNA polym...  76.6    2e-13   
gb|AAT58765.1|  unknown protein, contains NLI interacting factor-...  70.5    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64021.1|  hypothetical protein OsJ_18850                        70.1    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMT12311.1|  CTD small phosphatase-like protein 2                  70.1    8e-11   
ref|XP_002990146.1|  hypothetical protein SELMODRAFT_131171           62.0    1e-08   
ref|XP_010095242.1|  hypothetical protein L484_008252                 60.5    1e-08   
ref|XP_002992543.1|  hypothetical protein SELMODRAFT_135380           62.0    1e-08   
tpg|DAA56990.1|  TPA: hypothetical protein ZEAMMB73_478385            51.6    4e-05   
tpg|DAA56989.1|  TPA: hypothetical protein ZEAMMB73_478385            47.8    5e-04   



>ref|XP_009610469.1| PREDICTED: nuclear envelope morphology protein 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=264

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +3

Query  99   MADMAQAA-DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++AQAA DVYAPRS   W +LL+WL FF QI VQIVRGTPSL+QVLSY+G RNSS   
Sbjct  1    MAELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFL  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S  P+FKPL  VEL E   PEEAPP P  PSVAV  L I  GRV   +G+  L RLTVVL
Sbjct  61   SSTPQFKPLPVVELPESQLPEEAPPPPQQPSVAVSTLQIDAGRVRDGNGDQHLRRLTVVL  120

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+I+ T+ATEAGL WFELEC+SSDKECD KPKINYVTVFERPGLH
Sbjct  121  DLDETLVCAYETSSLPNIVRTQATEAGLKWFELECISSDKECDSKPKINYVTVFERPGLH  180



>ref|XP_006338842.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=313

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 135/179 (75%), Gaps = 11/179 (6%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++AQAADVYAPR+   W +LLNWL FFFQI VQIVRGTPSL+QVLSY+G RN+SFLSS
Sbjct  1    MAELAQAADVYAPRTLPAWRSLLNWLLFFFQIFVQIVRGTPSLSQVLSYVGLRNTSFLSS  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             P +FKPL                 PP   + V  L IA GRV   +GE    RLTVVLD
Sbjct  61   TP-QFKPL-------PIVELPESQEPPHQPLTVSTLQIAAGRVPDANGEQ---RLTVVLD  109

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+I+ T+ATEAGL WFELEC SSDKEC+GKPKINYVTVFERPGLH
Sbjct  110  LDETLVCAYETSSLPNIVRTQATEAGLKWFELECTSSDKECEGKPKINYVTVFERPGLH  168



>ref|XP_009610468.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=325

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +3

Query  99   MADMAQAA-DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++AQAA DVYAPRS   W +LL+WL FF QI VQIVRGTPSL+QVLSY+G RNSS   
Sbjct  1    MAELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFL  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S  P+FKPL  VEL E   PEEAPP P  PSVAV  L I  GRV   +G+  L RLTVVL
Sbjct  61   SSTPQFKPLPVVELPESQLPEEAPPPPQQPSVAVSTLQIDAGRVRDGNGDQHLRRLTVVL  120

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+I+ T+ATEAGL WFELEC+SSDKECD KPKINYVTVFERPGLH
Sbjct  121  DLDETLVCAYETSSLPNIVRTQATEAGLKWFELECISSDKECDSKPKINYVTVFERPGLH  180



>ref|XP_009760937.1| PREDICTED: nuclear envelope morphology protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=264

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = +3

Query  99   MADMAQAA-DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++AQAA DVYAPRS   W +LL+WL FF QI VQIVRGTPSL+QVLSY+G RNSS   
Sbjct  1    MAELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFL  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S  P+FKPL  VEL +   PEEAPP P  PSVAV  L I  GRV   +G+  L RLTVVL
Sbjct  61   SSTPQFKPLPVVELPDSQLPEEAPPPPQQPSVAVSTLQIDAGRVPDGNGDQHLRRLTVVL  120

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+I+ T+A EAGL WFELEC SSDKECD KPKINYVTVFERPGLH
Sbjct  121  DLDETLVCAYETSSLPNIVRTQAAEAGLKWFELECTSSDKECDSKPKINYVTVFERPGLH  180



>ref|XP_009760936.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=324

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = +3

Query  99   MADMAQAA-DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++AQAA DVYAPRS   W +LL+WL FF QI VQIVRGTPSL+QVLSY+G RNSS   
Sbjct  1    MAELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFL  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S  P+FKPL  VEL +   PEEAPP P  PSVAV  L I  GRV   +G+  L RLTVVL
Sbjct  61   SSTPQFKPLPVVELPDSQLPEEAPPPPQQPSVAVSTLQIDAGRVPDGNGDQHLRRLTVVL  120

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+I+ T+A EAGL WFELEC SSDKECD KPKINYVTVFERPGLH
Sbjct  121  DLDETLVCAYETSSLPNIVRTQAAEAGLKWFELECTSSDKECDSKPKINYVTVFERPGLH  180



>ref|XP_004240939.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Solanum 
lycopersicum]
Length=306

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 130/179 (73%), Gaps = 18/179 (10%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++AQAA VYAPR+   W +LLNWL FFFQI VQIVRGTPSLTQ+LSY+G RN+SFLSS
Sbjct  1    MAELAQAAGVYAPRTLPAWRSLLNWLLFFFQIFVQIVRGTPSLTQLLSYVGLRNTSFLSS  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             P  FKPL  VEL E  +                         AG +GE    RLTVVLD
Sbjct  61   TP-HFKPLPIVELPESHQTPLTVSTLQI--------------AAGTNGEQ---RLTVVLD  102

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+I+ T+ATEAGL WFELEC SSDKEC+GKPKINYVTVFERPGLH
Sbjct  103  LDETLVCAYETSSLPNIVRTQATEAGLKWFELECTSSDKECEGKPKINYVTVFERPGLH  161



>emb|CDP14017.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 133/179 (74%), Gaps = 12/179 (7%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++AQ+ADVYAP++  +W ALLNWL FFFQI VQI+RGTPSLTQVLSY+G R+SS LSS
Sbjct  1    MAELAQSADVYAPKTIQVWRALLNWLAFFFQIFVQIIRGTPSLTQVLSYVGLRHSSLLSS  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P+FKPL            E      PP      + I  G  A  DG   L +LTVVLD
Sbjct  61   SSPQFKPLPV---------VELQEPEHPPPPLSSAVQITSG--ATSDGGL-LDKLTVVLD  108

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LPS+I ++ATEAGLNWFELECVSSDKE +GKPKINYVTVFERPGLH
Sbjct  109  LDETLVCAYETSSLPSMIRSQATEAGLNWFELECVSSDKEIEGKPKINYVTVFERPGLH  167



>ref|XP_004239942.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Solanum lycopersicum]
Length=318

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 133/180 (74%), Gaps = 8/180 (4%)
 Frame = +3

Query  99   MADMAQAADVYAP-RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            M ++ QAA VYAP R+  +W +LLNWL FFFQI VQI++GTP +TQVLSY G RNSS LS
Sbjct  1    MPELVQAAQVYAPTRTLQIWKSLLNWLAFFFQIFVQILKGTPCVTQVLSYFGVRNSSLLS  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S P +FKPL         EP E    PPP SVA+  L I  G V     E  L +LTVVL
Sbjct  61   SSP-QFKPL------PDVEPPEEEEAPPPSSVALSTLQITTGSVPISVEEEHLQKLTVVL  113

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETL+CAYETS+LP+II T+ATEAGL WFELECVSS+KE DGKPKIN+VTVFERPGLH
Sbjct  114  DLDETLICAYETSSLPTIICTQATEAGLKWFELECVSSEKEYDGKPKINHVTVFERPGLH  173



>ref|XP_006355653.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=317

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 127/180 (71%), Gaps = 9/180 (5%)
 Frame = +3

Query  99   MADMAQAADVYAP-RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            M ++ QAA VYAP R+  +W +LLNWL FFFQI VQI++GTP +TQVLSY G RNSS LS
Sbjct  1    MPELVQAAQVYAPTRTLQIWKSLLNWLAFFFQIFVQILKGTPCVTQVLSYFGVRNSSLLS  60

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            S P +FK                   PP  SVA+  L I  G V     E  L +LTVVL
Sbjct  61   SSP-QFK-------PLPDVEPPEEEAPPTSSVALSTLQITTGSVPISVEEERLQKLTVVL  112

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETL+CAYETS+LP+II T+ATEAGL WFELECVSS+KE DGKPKINYVTVFERPGLH
Sbjct  113  DLDETLICAYETSSLPTIICTQATEAGLKWFELECVSSEKEYDGKPKINYVTVFERPGLH  172



>ref|XP_011084905.1| PREDICTED: LOW QUALITY PROTEIN: CTD nuclear envelope phosphatase 
1 homolog [Sesamum indicum]
Length=307

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 124/179 (69%), Gaps = 17/179 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+MA  A VYAPR+  +W  LLNW+ F FQI  QI+RGTPS TQVLSY+G R+ S LSS
Sbjct  1    MAEMA-PAQVYAPRTIQVWRTLLNWVAFVFQIFAQILRGTPSFTQVLSYVGLRHGSVLSS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             PP+FK L  VEL + P                       GRV G     PL +LTVVLD
Sbjct  60   GPPQFKSLPVVELHDXPAAAPVA--------------CGGGRVIG--DSPPLEKLTVVLD  103

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+++ T+ATEAGL WFELEC+SSDKE +GKPKINYVTVFERPG+ 
Sbjct  104  LDETLVCAYETSSLPALLRTQATEAGLKWFELECISSDKEFEGKPKINYVTVFERPGVR  162



>ref|XP_011076695.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum]
Length=382

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 133/180 (74%), Gaps = 11/180 (6%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++A AA+VYAPR+  +W  LLNW+ FFFQI  QI+RGTPS  QVLSY+G R  S LS+
Sbjct  69   MAELA-AAEVYAPRTIQVWRTLLNWMAFFFQIFAQILRGTPSFNQVLSYVGIRPGSLLST  127

Query  279  PP--PEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
             P  P+FKPL  VEL+EF    E  P P    V+V       G++       PL +LTVV
Sbjct  128  APHAPQFKPLSVVELTEFSAEPEEAPPPAAVPVSV-----GGGKMVDSP---PLEKLTVV  179

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDLDETLVCAYETS+LP+++ T+ATEAG+NWFELEC+SSDKE +GKPKINYVTVFERPGL
Sbjct  180  LDLDETLVCAYETSSLPAMLRTQATEAGINWFELECISSDKEFEGKPKINYVTVFERPGL  239



>ref|XP_002273682.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Vitis vinifera]
 emb|CBI25474.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 12/178 (7%)
 Frame = +3

Query  102  ADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSP  281
            A++ QA +VYAPRS  LW  LLNWL FFFQI +QI+RGTPS+TQVLSY+G R+ S L S 
Sbjct  10   AELTQA-EVYAPRSLQLWRTLLNWLAFFFQIFLQILRGTPSVTQVLSYVGLRHHSLLPSS  68

Query  282  PPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldl  461
            P  FKPL  VEL E   P ++  +                  A    + P  + TVVLDL
Sbjct  69   P-SFKPLPVVELPELEPPPDSVQINATDGTDS----------AAAAVDRPAEKFTVVLDL  117

Query  462  detlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DETLVCAYETS+LP+ I  +A E+GL WFELECVSSDKEC+GKPK+NYVTVFERPGL 
Sbjct  118  DETLVCAYETSSLPASIRNQAIESGLKWFELECVSSDKECEGKPKVNYVTVFERPGLR  175



>ref|XP_008442416.1| PREDICTED: CTD small phosphatase-like protein 2 [Cucumis melo]
 gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo]
Length=301

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 118/179 (66%), Gaps = 15/179 (8%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M  + Q  +V APRS  +W AL++WLCFFF ++VQIVRG PSL Q+LSY+GFR    L S
Sbjct  1    MEQIGQT-EVCAPRSLQVWQALMDWLCFFFHVIVQIVRGAPSLPQILSYIGFR-FPLLPS  58

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P FKPL   EL       +                       G   + PL ++TVVLD
Sbjct  59   SAPSFKPLPAAELPLHQFSTKKISSLNDLDD-------------GGGQDRPLEKITVVLD  105

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP++  T+ATEAGLNWFELECVSSDKE +GKPKI+YVTVFERPGLH
Sbjct  106  LDETLVCAYETSSLPAVFRTQATEAGLNWFELECVSSDKEVEGKPKISYVTVFERPGLH  164



>gb|EYU20007.1| hypothetical protein MIMGU_mgv1a010325mg [Erythranthe guttata]
Length=316

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 131/183 (72%), Gaps = 16/183 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++A AA++YAPR+  +W  LLNW+ FFFQI  QI+RGTPS  Q+ SY+G  + S LSS
Sbjct  1    MAELA-AAEMYAPRTIQVWRTLLNWMAFFFQIFAQILRGTPSFGQIFSYVGLGHGSLLSS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEH-----PLPRl  443
             P +FKPL  VELS+F E  E  P  P P         A   VAG  GE      P  +L
Sbjct  60   APTQFKPLAVVELSDFAEEHEEAPTGPNP---------ASVPVAG-GGERTINSPPFEKL  109

Query  444  tvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFER  623
            TVVLDLDETLVCAYETS+LP+++ ++ATEAG+ WFELEC+SSDKE +GKPKINYVTVFER
Sbjct  110  TVVLDLDETLVCAYETSSLPAMLRSQATEAGIKWFELECISSDKEFEGKPKINYVTVFER  169

Query  624  PGL  632
            PGL
Sbjct  170  PGL  172



>ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004168574.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN58757.1| hypothetical protein Csa_3G731190 [Cucumis sativus]
Length=301

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 116/179 (65%), Gaps = 15/179 (8%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M  + Q  +V APRS  +W A ++WL FFF ++VQIVRG PSL Q+LSY+GFR    L S
Sbjct  1    MEQIGQT-EVCAPRSLQVWQAFMDWLSFFFHVIVQIVRGAPSLPQILSYIGFR-FPLLPS  58

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P FKPL   EL       +                       G   + PL ++TVVLD
Sbjct  59   SAPSFKPLPAAELPLHQFSTKKISSLSDLDD-------------GGGQDRPLEKVTVVLD  105

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP++  T+ATEAGLNWFELECVSSDKE +GKPKI+YVTVFERPGLH
Sbjct  106  LDETLVCAYETSSLPAVFRTQATEAGLNWFELECVSSDKEIEGKPKISYVTVFERPGLH  164



>ref|XP_009805067.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X2 [Nicotiana 
sylvestris]
Length=212

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 117/179 (65%), Gaps = 19/179 (11%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M ++ QA  VY PR+  LW +LLNWL FFFQI +QI++G              NSS LSS
Sbjct  1    MPELFQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS  46

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            PP +FKPL           EE      P SVA+  L I  G V     E    RLTVVLD
Sbjct  47   PP-QFKPL----PDVELLEEEEEAEAAPSSVALSTLQITTGNVPTSLEEERSQRLTVVLD  101

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LD+TL+CAYETS++P+++ T+ATEAGL WFELEC+SSDKE DGKPKINYVTVFERPGLH
Sbjct  102  LDDTLICAYETSSMPTMMRTQATEAGLKWFELECISSDKEYDGKPKINYVTVFERPGLH  160



>ref|XP_009805066.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X1 [Nicotiana 
sylvestris]
Length=226

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 117/179 (65%), Gaps = 19/179 (11%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M ++ QA  VY PR+  LW +LLNWL FFFQI +QI++G              NSS LSS
Sbjct  1    MPELFQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS  46

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            PP +FKPL           EE      P SVA+  L I  G V     E    RLTVVLD
Sbjct  47   PP-QFKPL----PDVELLEEEEEAEAAPSSVALSTLQITTGNVPTSLEEERSQRLTVVLD  101

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LD+TL+CAYETS++P+++ T+ATEAGL WFELEC+SSDKE DGKPKINYVTVFERPGLH
Sbjct  102  LDDTLICAYETSSMPTMMRTQATEAGLKWFELECISSDKEYDGKPKINYVTVFERPGLH  160



>ref|XP_006843565.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
 gb|ERN05240.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
Length=254

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 111/179 (62%), Gaps = 26/179 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA +AQ  +V +PRS  +W   LNWL FFFQIL+Q+++GTP+L Q+  + G R +    S
Sbjct  1    MALVAQG-EVVSPRSLQIWRGFLNWLAFFFQILLQLLQGTPTLAQIFGFFGLRPALLCDS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            PPP FKPL                             + +     C  E    +LTVVLD
Sbjct  60   PPP-FKPLPVEPT------------------------LPEEEFPACAEEETFDKLTVVLD  94

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP ++  +AT+AGLNWFELECVS+D E DGK K+N+VTVFERPGLH
Sbjct  95   LDETLVCAYETSSLPIVVRNQATQAGLNWFELECVSTDTEGDGKQKVNHVTVFERPGLH  153



>ref|XP_004302575.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 117/180 (65%), Gaps = 26/180 (14%)
 Frame = +3

Query  99   MADMAQ-AADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA M Q AA+VY P+   LW AL+NWL FFFQIL    RG P L  +LSY+       L 
Sbjct  1    MATMGQTAAEVYEPKLIQLWRALVNWLSFFFQIL----RGAPCLAHLLSYVP------LL  50

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            + PP F+PL   E+        A               +  G V+    +HPLP+LTVVL
Sbjct  51   ASPPSFRPLPVAEIPLNDSSSSAHVN------------LENGVVSD---DHPLPKLTVVL  95

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS++P+I+ T+AT+AGL WFE+ECVSSDK+ DGKPKI+YVTVFERPGLH
Sbjct  96   DLDETLVCAYETSSVPAIVRTQATDAGLKWFEIECVSSDKDSDGKPKISYVTVFERPGLH  155



>ref|XP_010264631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Nelumbo 
nucifera]
Length=309

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 119/182 (65%), Gaps = 19/182 (10%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRN---SSF  269
            MA++AQA DVYAPR   +W  LLNWL FFFQI +QI+RGTPS+ QVLS++G R+   +S 
Sbjct  1    MAELAQA-DVYAPRPLQVWRTLLNWLAFFFQIFLQILRGTPSMAQVLSFIGLRHPLLASS  59

Query  270  LSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             SS    FKPL  VEL     P     +                     D +  + +LTV
Sbjct  60   SSSSSASFKPLPVVELPHQDLPSVPSHITSY---------------DDSDLDQRIEKLTV  104

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLVCAYET +LP+I+  +A EAGL WFELECVSSDKE DGKPK+N+VTVFERPG
Sbjct  105  VLDLDETLVCAYETFSLPAIVRNQAIEAGLKWFELECVSSDKESDGKPKVNHVTVFERPG  164

Query  630  LH  635
            L 
Sbjct  165  LR  166



>gb|EPS72976.1| hypothetical protein M569_01780, partial [Genlisea aurea]
Length=307

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 117/173 (68%), Gaps = 8/173 (5%)
 Frame = +3

Query  123  DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFL--SSPPPEFK  296
            +V APR+  LW  +L+WL F FQI  QIVR  PS+ QVLSY+G R  SF+  S+P  +FK
Sbjct  1    EVDAPRTIQLWTMMLDWLGFLFQIFAQIVRSAPSIGQVLSYVGVRPVSFIPPSTPQVQFK  60

Query  297  PLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlv  476
            P+  VE+ E  + E     P   SV        +G+  G     PL +L VVLDLDETLV
Sbjct  61   PIPVVEIEEIGDLEPRSAPPRLSSVPSAD----QGKGGGVGA--PLEKLMVVLDLDETLV  114

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP  +  +ATEAG+NWFELECVSSDKE +GKPKINYVTVFERPG+ 
Sbjct  115  CAYETSSLPDTLRNQATEAGINWFELECVSSDKEINGKPKINYVTVFERPGMK  167



>ref|XP_009622999.1| PREDICTED: CTD small phosphatase-like protein 2 [Nicotiana tomentosiformis]
Length=304

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 118/179 (66%), Gaps = 18/179 (10%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M ++ QA  VY PR+  LW +LLNWL FFFQI +QI++G              NSS LSS
Sbjct  1    MPELVQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS  46

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             P +FKPL      E  E EE     PP SVA+  L I    V     E    RLTVVLD
Sbjct  47   SP-QFKPL---PDVELLEEEEEEEALPPSSVALSTLQITTESVPISLQEERSQRLTVVLD  102

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LD+TLVCAYETS++P+I+ T+ATEAGL WFELECVSSDKE DGKPKINYVTVFERPGLH
Sbjct  103  LDDTLVCAYETSSMPTIMRTQATEAGLKWFELECVSSDKEYDGKPKINYVTVFERPGLH  161



>ref|XP_008243657.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Prunus mume]
Length=297

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 25/179 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA + QAA+VY PRS  LW A +NW+ F+FQIL+QI+R TP + Q+LS++G  + SF   
Sbjct  1    MAPIGQAAEVYVPRSIQLWRAFINWMGFYFQILLQILRDTPCVPQLLSFIGPSSPSFRPL  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            P  E  PL  +                           A+      +G   + +LTVVLD
Sbjct  61   PVVEL-PLNDLSSP------------------------AQVENGVINGHRHIEKLTVVLD  95

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYET TLP+I+ T+ATEAGL WFE+EC SSDKE DGKPK+N+VTVFERPGL 
Sbjct  96   LDETLVCAYETCTLPAIVRTQATEAGLKWFEIECASSDKEPDGKPKVNHVTVFERPGLR  154



>ref|XP_007205648.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
 gb|EMJ06847.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
Length=297

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 25/179 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA + QAA+VY PRS  LW A +NW+ F+FQIL+QI+R TP +  +LS++G  + SF   
Sbjct  1    MAPIGQAAEVYVPRSIQLWRAFINWMGFYFQILLQILRDTPCVPHLLSFIGPSSPSFRPL  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            P  E  PL  +                           A+      +G   + +LTVVLD
Sbjct  61   PVVEL-PLNDLSSP------------------------AQVENGVINGPRHIEKLTVVLD  95

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYET TLP+I+ T+ATEAGL WFE+ECVSSDKE DGKPK+N+VTVFERPGL 
Sbjct  96   LDETLVCAYETCTLPAIVRTQATEAGLKWFEIECVSSDKEPDGKPKVNHVTVFERPGLR  154



>ref|XP_010689631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 117/181 (65%), Gaps = 17/181 (9%)
 Frame = +3

Query  108  MAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRN---SSFLSS  278
            MAQ  +VYAP+S  L   +LNWL F FQI VQIV+GTPS+ QV + +GF +   +SFLS 
Sbjct  1    MAQT-EVYAPKSGQLLKTVLNWLAFLFQIFVQIVKGTPSMAQVFNSMGFSHGGQTSFLSP  59

Query  279  PPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
            P     FKPL  VE+        A  +            +      G     P  +LTVV
Sbjct  60   PSSSPGFKPLPVVEIPLHSSSATAVDIG-----------VDDDAEVGDSVVSPSDKLTVV  108

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDLDETLVCAYETS+LP  + T+ATEAGL WFELEC+SSDKEC+GKPKI+YVTVFERPGL
Sbjct  109  LDLDETLVCAYETSSLPPALCTQATEAGLKWFELECISSDKECEGKPKISYVTVFERPGL  168

Query  633  H  635
            H
Sbjct  169  H  169



>ref|XP_002265560.1| PREDICTED: CTD small phosphatase-like protein [Vitis vinifera]
 emb|CBI22795.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 111/176 (63%), Gaps = 6/176 (3%)
 Frame = +3

Query  123  DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPEFKPL  302
             VY PR   +W A++NWL FF QI +QI RGTPSL Q+LSY+G R+   L S    F+PL
Sbjct  5    QVYVPRPLQVWRAVVNWLGFFLQIFLQIFRGTPSLPQLLSYIGLRHP-LLPSSASSFRPL  63

Query  303  RTvelsefpep-----eeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldlde  467
              VELS                 P   V   P     G       + PL +LTVVLDLDE
Sbjct  64   PVVELSLHDSSPEPPSAPLSSPLPVRVVEHSPFGGGVGGDDDGGDDRPLEKLTVVLDLDE  123

Query  468  tlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            TLVCAYETS+LP+ + T+A EAGL WFELECVSSDKEC+GKP I+YVTVFERPGL 
Sbjct  124  TLVCAYETSSLPAHLRTQAIEAGLKWFELECVSSDKECEGKPNISYVTVFERPGLQ  179



>ref|XP_008370103.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Malus domestica]
Length=275

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 108/179 (60%), Gaps = 25/179 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M   A AA+VY P +  +W  L+NW+ FFFQI++QI+RG P L  +LS +        SS
Sbjct  4    MGQPAAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SS  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             PP F+PL   E+                         A       DG  P+ +LTVVLD
Sbjct  57   SPPAFRPLPVAEVPLNDLSSS-----------------AHVEXXVVDG-RPVEKLTVVLD  98

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYET ++P+I+  +ATEAGL WFE+EC+SS KE DGKPK+NYVTVFERPGL 
Sbjct  99   LDETLVCAYETCSVPAIVRAQATEAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLR  157



>ref|XP_009377758.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=297

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 110/179 (61%), Gaps = 25/179 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M   A AA+VY P +  +W  L+NW+ FFFQI++QI+RG P L  +LS +        SS
Sbjct  4    MGQPAAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SS  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             PP F+PL   E+        A               +  G V G     P+ +LTVVLD
Sbjct  57   SPPAFRPLPVAEVPLNDLTSSAH--------------VENGVVDG----RPVEKLTVVLD  98

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYET ++P+++  +ATEAGL WFE+EC+SS KE DGKPK+NYVTVFERPGL 
Sbjct  99   LDETLVCAYETCSVPAVVRAQATEAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLR  157



>ref|XP_008370102.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Malus domestica]
Length=297

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 108/179 (60%), Gaps = 25/179 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M   A AA+VY P +  +W  L+NW+ FFFQI++QI+RG P L  +LS +        SS
Sbjct  4    MGQPAAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SS  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
             PP F+PL   E+                         A       DG  P+ +LTVVLD
Sbjct  57   SPPAFRPLPVAEVPLNDLSSS-----------------AHVEXXVVDG-RPVEKLTVVLD  98

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYET ++P+I+  +ATEAGL WFE+EC+SS KE DGKPK+NYVTVFERPGL 
Sbjct  99   LDETLVCAYETCSVPAIVRAQATEAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLR  157



>ref|XP_010535319.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
 ref|XP_010535391.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
Length=307

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 109/183 (60%), Gaps = 20/183 (11%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+PRS  +W AL+NWL FF+QI +QI+R       + S     + +  + 
Sbjct  1    MAELTQAEVVYSPRSLQVWKALVNWLAFFYQIFLQILRAVGYHHLLSSSSSSSDKAVANG  60

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEH----PLPRlt  446
                FKPL  VEL E      A               IA GR  G    H       +LT
Sbjct  61   ----FKPLPVVELPELASESPATVE------------IASGRTYGERDGHGYGGRFAKLT  104

Query  447  vvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERP  626
            VVLDLDETL+CAYETS+LP  +  +A E GL WFELEC+SSDKECDGKPKINYVTVFERP
Sbjct  105  VVLDLDETLICAYETSSLPVSLRNQAIEGGLKWFELECISSDKECDGKPKINYVTVFERP  164

Query  627  GLH  635
            GLH
Sbjct  165  GLH  167



>ref|XP_010504466.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 112/180 (62%), Gaps = 24/180 (13%)
 Frame = +3

Query  99   MADMAQAADV-YAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++ QA+DV Y+PRS  +W  L++WL FF+QI +QI+R           L   +SS   
Sbjct  1    MAELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILRAV----GYHPLLSSSSSSSAK  56

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            +    FKPL ++EL +  +                        +A  DGE  L RL VVL
Sbjct  57   ATADGFKPLPSIELLDRADESPTTVD-----------------IASSDGE--LQRLKVVL  97

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGLH
Sbjct  98   DLDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKECDGKPKINYVTVFERPGLH  157



>ref|XP_006403042.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
 gb|ESQ44495.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
Length=305

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 107/180 (59%), Gaps = 19/180 (11%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+PRS  +W  L+NWL FF+QI +QI+R        + Y    +SS  +S
Sbjct  1    MAELTQADVVYSPRSLQVWKTLVNWLAFFYQIFLQILRA-------VGYHPLLSSSAKAS  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHP-LPRltvvl  455
                FKPL          P          S     L IA    +   GE     RL VVL
Sbjct  54   ADG-FKPL----------PAIELLDRAVESPTTVELEIASSTTSCAQGERSRFQRLKVVL  102

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+ +  +A +AGL WFELECVSSDKE DGKPKINYVTVFERPGLH
Sbjct  103  DLDETLVCAYETSSLPAALRNQAIDAGLKWFELECVSSDKEYDGKPKINYVTVFERPGLH  162



>ref|XP_010516189.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 112/180 (62%), Gaps = 24/180 (13%)
 Frame = +3

Query  99   MADMAQAADV-YAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++ QA+DV Y+PRS  +W  L++WL FF+QI +QI+R           L   +SS   
Sbjct  1    MAELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILRAV----GYHPLLSSSSSSSAK  56

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            +    FKPL ++EL +  +                        +A  DGE  L RL VVL
Sbjct  57   ATADGFKPLPSIELLDRADESPTTVD-----------------IASSDGE--LQRLKVVL  97

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGLH
Sbjct  98   DLDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKECDGKPKINYVTVFERPGLH  157



>ref|XP_008345306.1| PREDICTED: probable C-terminal domain small phosphatase [Malus 
domestica]
Length=298

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 109/184 (59%), Gaps = 33/184 (18%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVR--GTPSLTQVLSYLGFRNSSFL  272
            MA++ Q   VY+P++  +W ALLNWL FF QI +QI+R  G  SL    S     +++F 
Sbjct  1    MAELTQGEVVYSPKTLQVWRALLNWLAFFSQIFLQILRALGHHSLLSSSSSSSASSAAFK  60

Query  273  SSP--PPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC-DGEHPLPRl  443
            S P  PPE                                  +   +A   D + P  +L
Sbjct  61   SLPVEPPE----------------------------NDSPAASAVEIADTPDSDDPFEKL  92

Query  444  tvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFER  623
            TVVLDLDETLVCAYETS LP+++ T+ATE GL WFELECVSSDKECDGKPK+NYVTVFER
Sbjct  93   TVVLDLDETLVCAYETSGLPTVVRTQATEGGLKWFELECVSSDKECDGKPKVNYVTVFER  152

Query  624  PGLH  635
            PGLH
Sbjct  153  PGLH  156



>ref|XP_007008963.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY17773.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=213

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 100/181 (55%), Gaps = 16/181 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVR--GTPSLTQVLSYLGFRNSSFL  272
            MA++ QA +VY+PRS  +W ALLNWL FFFQI  QI+R  G   L    S     +SS  
Sbjct  1    MAELTQA-EVYSPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSSSSSSSSSTT  59

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
            SS P  FKPL   + +E   P          S  +      +      D +  L      
Sbjct  60   SSSPHRFKPLPVDDSTEIESPATVEIAAVLDSSVLADEDSVEKLTVVLDLDETL------  113

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
                   VCAYETS+LP  +  +AT+AGL WFELECVSSDKE +GKPKINYVTVFERPGL
Sbjct  114  -------VCAYETSSLPPALRNQATDAGLKWFELECVSSDKEFEGKPKINYVTVFERPGL  166

Query  633  H  635
             
Sbjct  167  Q  167



>ref|XP_002878054.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54313.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 105/179 (59%), Gaps = 18/179 (10%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+PRS  +W  L+NWL FF+QI +QI+R        + Y    +SS  +S
Sbjct  1    MAELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILRA-------VGYHPLLSSSAKAS  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL            E           V          + C+      RL VVLD
Sbjct  54   ADG-FKPL---------PAIELLDRASESPTTVDIASTTTSDSSDCERSR-FHRLKVVLD  102

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGLH
Sbjct  103  LDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKECDGKPKINYVTVFERPGLH  161



>ref|XP_011035940.1| PREDICTED: CTD nuclear envelope phosphatase 1 [Populus euphratica]
Length=294

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 106/178 (60%), Gaps = 27/178 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q   VY+PRS  LW  L +WL FFF IL+QI+R     T             LSS
Sbjct  1    MAELTQPEVVYSPRSIQLWRTLWDWLAFFFHILLQILRAVGPQT-------------LSS  47

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P FKPL                LP         + I+ G  A    + P+ +L VVLD
Sbjct  48   SHP-FKPL------------PLVELPDTTDPPPATVEISAG-TAAVSADEPIQKLKVVLD  93

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+ +  +ATEAGL WFEL+CVSSDKEC+GKPKINYVTVFERPGL
Sbjct  94   LDETLVCAYETSSLPAALRDQATEAGLKWFELDCVSSDKECEGKPKINYVTVFERPGL  151



>gb|KDP44760.1| hypothetical protein JCGZ_01260 [Jatropha curcas]
Length=297

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 108/178 (61%), Gaps = 25/178 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q+  VY+PRS  LW  L NWL FFFQI +QIVR           LG       SS
Sbjct  1    MAELTQSEVVYSPRSLQLWSTLWNWLAFFFQIFLQIVRA----------LGHLPLLSSSS  50

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  VEL E   P                  I  G  +    E P+ +LTVVLD
Sbjct  51   SSQSFKPLPVVELPETDSPATLE--------------ITAGPESSPVDE-PIKKLTVVLD  95

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+I+  +A EAGL WFELECVSSDKEC+GKPKINYVTVFERPGL
Sbjct  96   LDETLVCAYETSSLPAILRNQAIEAGLRWFELECVSSDKECEGKPKINYVTVFERPGL  153



>ref|XP_009369172.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
 ref|XP_009369173.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
Length=300

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 108/183 (59%), Gaps = 29/183 (16%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGT---PSLTQVLSYLGFRNSSF  269
            MA++ Q   VY+P++  +W ALLNWL FF QI +QI+R     P L+   S     +S+ 
Sbjct  1    MAELTQGEVVYSPKTLQVWRALLNWLAFFSQIFLQILRALGHHPLLSSSSSSSSSASSAA  60

Query  270  LSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC-DGEHPLPRlt  446
              S P E  PL     +                            +A   D + P  +LT
Sbjct  61   FKSLPVE--PLENDSPASSAV-----------------------EIADTPDSDGPFEKLT  95

Query  447  vvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERP  626
            VVLDLDETLVCAYETS+LP+++ T+ATE GL WFELECVSSDKECDGKPK+NYVTVFERP
Sbjct  96   VVLDLDETLVCAYETSSLPAVVRTQATEGGLKWFELECVSSDKECDGKPKVNYVTVFERP  155

Query  627  GLH  635
            GL 
Sbjct  156  GLQ  158



>ref|XP_007218742.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
 gb|EMJ19941.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
Length=303

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 106/181 (59%), Gaps = 22/181 (12%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVR--GTPSLTQVLSYLGFRNSSFL  272
            MA++ Q   VY+P++  +W AL+NW  FFFQI +QI+R  G   L    S     ++SF 
Sbjct  1    MAELTQGEVVYSPKTLQVWRALVNWFGFFFQIFLQILRALGHHPLLSSSSSASSSSASFK  60

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
            S P  E + L                       +     +        D +  + +LTVV
Sbjct  61   SLPVVELQELE--------------------HDSPAASAVEIADTPDADSDDRIHKLTVV  100

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDLDETLVCAYE+S+LP+++  +ATE GL WFELECVSSDKECDGKPK+NYVTVFERPGL
Sbjct  101  LDLDETLVCAYESSSLPAVVRDQATEGGLKWFELECVSSDKECDGKPKVNYVTVFERPGL  160

Query  633  H  635
             
Sbjct  161  Q  161



>ref|XP_002533382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29000.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 110/178 (62%), Gaps = 13/178 (7%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q   VY+PRS  +W  L NWL FFFQI +QI+R    L  + S     N+     
Sbjct  1    MAELTQQEIVYSPRSIQVWRTLWNWLAFFFQIFLQILRALGHLPLLSSSSSSSNT-----  55

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL    + E  E E          ++   L IA G V+    + P  +LTVVLD
Sbjct  56   ----FKPL---PVIELTETETETGTETETDLSAATLEIASGPVSS-PVDQPFRKLTVVLD  107

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+ +  +AT AG+ WFELECVSSDKEC+GKPKINYVTVFERPGL
Sbjct  108  LDETLVCAYETSSLPAALRNQATGAGVKWFELECVSSDKECEGKPKINYVTVFERPGL  165



>ref|NP_191155.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
 emb|CAB87850.1| putative protein [Arabidopsis thaliana]
 gb|AAM20657.1| putative protein [Arabidopsis thaliana]
 gb|AAM61626.1| unknown [Arabidopsis thaliana]
 gb|AAN15623.1| putative protein [Arabidopsis thaliana]
 gb|AEE79461.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
Length=305

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 108/179 (60%), Gaps = 17/179 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+PRS  +W  L+NWL FF+QI +QI+R        + Y    +SS  +S
Sbjct  1    MAELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILRA-------VGYHPLLSSSAKAS  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  +EL +              + +      A+ R           RL VVLD
Sbjct  54   ADG-FKPLPAIELLDRASESPTTVEIAATTTSDSCSDGARSR---------FQRLKVVLD  103

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKE DGKPKINYVTVFERPGLH
Sbjct  104  LDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKEYDGKPKINYVTVFERPGLH  162



>ref|XP_009346338.1| PREDICTED: uncharacterized protein LOC103938066 [Pyrus x bretschneideri]
Length=191

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 109/174 (63%), Gaps = 25/174 (14%)
 Frame = +3

Query  111  AQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPE  290
            A AA+VY P +  +W  L+NW+ FF+QI++QI+RG P L  +LS +   +S       P 
Sbjct  7    AAAAEVYVPMTLQVWRGLVNWVGFFYQIILQILRGAPCLRHLLSCISSSSS-------PA  59

Query  291  FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldet  470
            F+PL   E+        A               +  G + G     P+ +LTVVLDLDET
Sbjct  60   FRPLPVAEVPLNDLSSSAH--------------VENGVLDG----RPVEKLTVVLDLDET  101

Query  471  lvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LVCAYET ++P+I+  +ATEAG+ WFE+EC+SS+KE DGKPKINYVTVFERPGL
Sbjct  102  LVCAYETCSVPAIVRAQATEAGMKWFEIECLSSEKESDGKPKINYVTVFERPGL  155



>ref|XP_010427400.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=301

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 111/180 (62%), Gaps = 23/180 (13%)
 Frame = +3

Query  99   MADMAQAADV-YAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++ QA+DV Y+PRS  +W  L++WL FF+QI +QI+R           L   +SS   
Sbjct  1    MAELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILRAV----GYHPLLSSSSSSSAK  56

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            +    FKPL ++EL + P                         +A  DG   L RL VVL
Sbjct  57   ATADGFKPLPSIELLDRPAESPTTVD-----------------IASSDGGE-LQRLKVVL  98

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGLH
Sbjct  99   DLDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKECDGKPKINYVTVFERPGLH  158



>ref|XP_007008962.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY17772.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
Length=310

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 100/181 (55%), Gaps = 16/181 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVR--GTPSLTQVLSYLGFRNSSFL  272
            MA++ QA +VY+PRS  +W ALLNWL FFFQI  QI+R  G   L    S     +SS  
Sbjct  1    MAELTQA-EVYSPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSSSSSSSSSTT  59

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
            SS P  FKPL   + +E   P          S  +      +      D +  L      
Sbjct  60   SSSPHRFKPLPVDDSTEIESPATVEIAAVLDSSVLADEDSVEKLTVVLDLDETL------  113

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
                   VCAYETS+LP  +  +AT+AGL WFELECVSSDKE +GKPKINYVTVFERPGL
Sbjct  114  -------VCAYETSSLPPALRNQATDAGLKWFELECVSSDKEFEGKPKINYVTVFERPGL  166

Query  633  H  635
             
Sbjct  167  Q  167



>ref|XP_002312160.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEE89527.2| NLI interacting factor family protein [Populus trichocarpa]
Length=307

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 107/179 (60%), Gaps = 26/179 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++     VY+PRS  LW AL NWL FFFQI +QI+R           +G R+   LS+
Sbjct  1    MAELTHPEVVYSPRSIQLWRALWNWLAFFFQIFLQILRA----------VGPRS---LST  47

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            P   FKPL                LP         + I  G  A      P+ +LTVVLD
Sbjct  48   PSHTFKPL------------PLGELPETTDPPPATVEIPAGTDA-ISANEPIQKLTVVLD  94

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+++  +A EAGL WFELECVSSDKEC+GK KINYVTVFERPGL 
Sbjct  95   LDETLVCAYETSSLPALLCNQAMEAGLKWFELECVSSDKECEGKLKINYVTVFERPGLD  153



>ref|XP_002315157.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEF01328.2| NLI interacting factor family protein [Populus trichocarpa]
Length=258

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 105/178 (59%), Gaps = 27/178 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q   VY+PRS  LW  L +WL FFF I +QI+R     T             LSS
Sbjct  1    MAELTQPEVVYSPRSIQLWRTLWDWLAFFFHIFLQILRAVGPQT-------------LSS  47

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P FKPL                LP         + I+ G  A    E P+ +L VVLD
Sbjct  48   SHP-FKPL------------PLVELPDTTDPPPATVEISAGTDAVSANE-PIQKLKVVLD  93

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+ +  +ATEAGL WFEL+C+SSDKEC+GKPKINYVTVFERPGL
Sbjct  94   LDETLVCAYETSSLPAALRNQATEAGLKWFELDCISSDKECEGKPKINYVTVFERPGL  151



>gb|KJB78769.1| hypothetical protein B456_013G018000 [Gossypium raimondii]
Length=302

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 104/182 (57%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGT---PSLTQVLSYLGFRNSSF  269
            MA++ QA +VY+PRS  +W ALLNWL FF+QI  QI+R     P L+   S      S+ 
Sbjct  1    MAELTQA-EVYSPRSLQVWRALLNWLAFFYQIFAQIIRAVGQYPLLSSSSSSSITSTSTH  59

Query  270  LSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
               P P     RT   +                       +    V     E  + +LTV
Sbjct  60   RFKPLPVADSTRTESRAT----------------------VEIAAVLDSPDEDRIEKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLVCAYETS+LP  +  +A +AGL WFELECVSSDKEC+GKPKINYVTVFERPG
Sbjct  98   VLDLDETLVCAYETSSLPPSLRNQAMDAGLKWFELECVSSDKECEGKPKINYVTVFERPG  157

Query  630  LH  635
            L 
Sbjct  158  LQ  159



>ref|XP_006378658.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
 gb|ERP56455.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
Length=294

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 105/178 (59%), Gaps = 27/178 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q   VY+PRS  LW  L +WL FFF I +QI+R     T             LSS
Sbjct  1    MAELTQPEVVYSPRSIQLWRTLWDWLAFFFHIFLQILRAVGPQT-------------LSS  47

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
              P FKPL                LP         + I+ G  A    E P+ +L VVLD
Sbjct  48   SHP-FKPL------------PLVELPDTTDPPPATVEISAGTDAVSANE-PIQKLKVVLD  93

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+ +  +ATEAGL WFEL+C+SSDKEC+GKPKINYVTVFERPGL
Sbjct  94   LDETLVCAYETSSLPAALRNQATEAGLKWFELDCISSDKECEGKPKINYVTVFERPGL  151



>emb|CDX67629.1| BnaA07g16690D [Brassica napus]
Length=296

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 103/179 (58%), Gaps = 26/179 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+ RS  LW  L+N L FF+Q+ +QI+R           +G+     LSS
Sbjct  1    MAELTQADVVYSRRSLQLWKTLVNCLAFFYQLFLQILRA----------VGYH--PLLSS  48

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  +EL E    +    +    S+ VQ   + + +V   D +  L        
Sbjct  49   SADGFKPLPNIELLETAADDSPASVEIESSIEVQHSRLQRLKVV-LDLDETL--------  99

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
                 VCAYETS+LP+ +  +A EAGLNWFELEC+SSDKE +GKPKINYVTVFERPGLH
Sbjct  100  -----VCAYETSSLPAALRNQAIEAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLH  153



>gb|KFK34835.1| hypothetical protein AALP_AA5G199300 [Arabis alpina]
Length=301

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 109/180 (61%), Gaps = 23/180 (13%)
 Frame = +3

Query  99   MADMAQAADVYAP-RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            MA++ QA  VY+P RS  +W  L+NWL FF+QI +QI+R        + Y    +SS   
Sbjct  1    MAELTQADVVYSPPRSFQVWKTLVNWLAFFYQIFLQILRA-------VGYHPLLSSS-AK  52

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
            +    FKPL             A  L    + +   + IA  + +   G     RL VVL
Sbjct  53   ATADGFKPL------------PAIELLDTAAESPATVEIASSKNSCEQGRSQ--RLKVVL  98

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGLH
Sbjct  99   DLDETLVCAYETSSLPASLRNQAIEAGLKWFELECLSADKECDGKPKINYVTVFERPGLH  158



>gb|KHG26951.1| putative phosphatase PSR2 [Gossypium arboreum]
Length=307

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGT---PSLTQVLSYLGFRNSSF  269
            MA + QA +VY+PRS  +W ALLNWL FF+QI  QI+R     P L+   S      S+ 
Sbjct  1    MAQLTQA-EVYSPRSLQVWRALLNWLAFFYQIFAQIIRAVGQYPLLSSSSSSSITSTSTH  59

Query  270  LSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
               P P     RT   +                       +    V     E  + +LTV
Sbjct  60   RFKPLPVVDSTRTESPAT----------------------VEIAAVLDSPDEDRIEKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLVCAYETS+LP  +  +A +AGL WFELECVSSDKEC+GKPKINYVTVFERPG
Sbjct  98   VLDLDETLVCAYETSSLPPSLHNQAMDAGLKWFELECVSSDKECEGKPKINYVTVFERPG  157

Query  630  LH  635
            L 
Sbjct  158  LQ  159



>gb|KHG26952.1| ctdspl2 [Gossypium arboreum]
Length=302

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGT---PSLTQVLSYLGFRNSSF  269
            MA + QA +VY+PRS  +W ALLNWL FF+QI  QI+R     P L+   S      S+ 
Sbjct  1    MAQLTQA-EVYSPRSLQVWRALLNWLAFFYQIFAQIIRAVGQYPLLSSSSSSSITSTSTH  59

Query  270  LSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
               P P     RT   +                       +    V     E  + +LTV
Sbjct  60   RFKPLPVVDSTRTESPAT----------------------VEIAAVLDSPDEDRIEKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLVCAYETS+LP  +  +A +AGL WFELECVSSDKEC+GKPKINYVTVFERPG
Sbjct  98   VLDLDETLVCAYETSSLPPSLHNQAMDAGLKWFELECVSSDKECEGKPKINYVTVFERPG  157

Query  630  LH  635
            L 
Sbjct  158  LQ  159



>ref|XP_009103976.1| PREDICTED: CTD small phosphatase-like protein [Brassica rapa]
Length=296

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 102/179 (57%), Gaps = 26/179 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+ RS  LW  L+N L FF+Q+ +QI+R           +G+     LSS
Sbjct  1    MAELTQADVVYSRRSLQLWKTLVNCLAFFYQLFLQILRA----------VGYH--PLLSS  48

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  +EL E    +    +    S+ V+     + +V   D +  L        
Sbjct  49   SADGFKPLPNIELLETAADDSPASVEIESSIEVERSRFQRLKVV-LDLDETL--------  99

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
                 VCAYETS+LP+ +  +A +AGLNWFELEC+SSDKE +GKPKINYVTVFERPGLH
Sbjct  100  -----VCAYETSSLPAALRNQAIDAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLH  153



>ref|XP_006435743.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
 ref|XP_006486313.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
 gb|ESR48983.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
Length=375

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 110/188 (59%), Gaps = 28/188 (15%)
 Frame = +3

Query  81   ARFRRLMADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR-  257
            ++   LMA++ QA   Y+ RS  +W  LLNWL FFFQI  +I+R           LG   
Sbjct  70   SKLIHLMAELTQAEVAYSHRSIQVWRTLLNWLAFFFQIFAKILRA----------LGHHP  119

Query  258  -NSSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD--GEH  428
              SS  S+    FKPL+ VEL E                      I   R +G D   E 
Sbjct  120  LLSSSASASTHAFKPLQVVELPETDSSATVD--------------IGAVRDSGDDVVSEE  165

Query  429  PLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYV  608
             L +LTVVLDLDETLVCAYETS+LP  +  +AT AGL WFE+EC+SSDKEC+GKPKIN+V
Sbjct  166  RLQKLTVVLDLDETLVCAYETSSLPVTLRNQATGAGLKWFEMECLSSDKECEGKPKINHV  225

Query  609  TVFERPGL  632
            TVFERPGL
Sbjct  226  TVFERPGL  233



>ref|XP_006291562.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
 gb|EOA24460.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
Length=303

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 105/181 (58%), Gaps = 23/181 (13%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRN--SSFL  272
            MA++ QA  VY+PRS  +W  L+NWL FF+QI +Q          +L  +G+    SS  
Sbjct  1    MAELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQ----------ILRAVGYHPLLSSSA  50

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
             +    FKPL  +EL +              +        ++             RL VV
Sbjct  51   KANADGFKPLPAIELLDRAADSPTTVDIASSTSDSCDSDRSR-----------FHRLKVV  99

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDLDETLVCAYETS+LP+ +  +A EAGL WFELEC+S+DKECDGKPKINYVTVFERPGL
Sbjct  100  LDLDETLVCAYETSSLPAALRNQAIEAGLKWFELECLSTDKECDGKPKINYVTVFERPGL  159

Query  633  H  635
            H
Sbjct  160  H  160



>ref|XP_011046823.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Populus 
euphratica]
Length=295

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 108/178 (61%), Gaps = 26/178 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++     VY+PRS  LW AL N L FFF+I +QI+R           LG ++   LSS
Sbjct  1    MAELTHPEVVYSPRSIQLWRALWNCLAFFFRIFLQILRA----------LGPQS---LSS  47

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
            P   FKPL                LP      +  + I  G  A    E P+ +LTVVLD
Sbjct  48   PSHTFKPL------------PLVELPETTDPPLATVEIPAGTDAISANE-PIQKLTVVLD  94

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+++  +A EAGL WFELECVSSDKEC+GK KINYVTVFERPGL
Sbjct  95   LDETLVCAYETSSLPALLCNQAIEAGLKWFELECVSSDKECEGKLKINYVTVFERPGL  152



>ref|XP_010517421.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X5 [Camelina sativa]
Length=273

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R           +   + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLST  49

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L +                      IA  R +       + +LTV
Sbjct  50   SPSTKDGFKPLSVLDLPKSETESPVSIE------------IASERTSTDGQVSTIQKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS++P+ + T+A EAGL WFELECVSS KEC+GKPK ++VTVFERPG
Sbjct  98   VLDLDETLVSAYETSSIPTALRTQAIEAGLKWFELECVSSTKECNGKPKTSHVTVFERPG  157

Query  630  LH  635
            LH
Sbjct  158  LH  159



>gb|KDO68955.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=276

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 107/182 (59%), Gaps = 28/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR--NSSFL  272
            MA++ QA   Y+ RS  +W  LLNWL FFFQI  +I+R           LG     SS  
Sbjct  1    MAELTQAEVAYSHRSIQVWRTLLNWLAFFFQIFAKILRA----------LGHHPLLSSSA  50

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD--GEHPLPRlt  446
            S+    FKPL+ VEL E                      I   R +G D   E  L +LT
Sbjct  51   SASTHAFKPLQVVELPETDSSATVD--------------IGAVRDSGDDVVSEERLQKLT  96

Query  447  vvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERP  626
            VVLDLDETLVCAYETS+LP  +  +AT AGL WFE+EC+SSDKEC+GKPKIN+VTVFERP
Sbjct  97   VVLDLDETLVCAYETSSLPVTLRNQATGAGLKWFEMECLSSDKECEGKPKINHVTVFERP  156

Query  627  GL  632
            GL
Sbjct  157  GL  158



>gb|KJB74329.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=243

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 96/179 (54%), Gaps = 14/179 (8%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ +A +VY PRS  +W ALLNWL FFFQI  QI+R       + S       +  SS
Sbjct  1    MAELTRA-EVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  V+  E   P          S A       +      D +  L        
Sbjct  60   STHRFKPLPVVDSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETL--------  111

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
                 VCAYETS+LP  + ++AT+AGL WFELECVSSDKE +GKPKI+YVTVFERPGL 
Sbjct  112  -----VCAYETSSLPLALRSQATDAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQ  165



>ref|XP_010505730.1| PREDICTED: CTD small phosphatase-like protein isoform X4 [Camelina 
sativa]
Length=309

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++ +R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLD+TLVCAYETS++P+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDDTLVCAYETSSVPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_010517419.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X3 [Camelina sativa]
Length=325

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R           +   + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLST  49

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L +                      IA  R +       + +LTV
Sbjct  50   SPSTKDGFKPLSVLDLPKSETESPVSIE------------IASERTSTDGQVSTIQKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS++P+ + T+A EAGL WFELECVSS KEC+GKPK ++VTVFERPG
Sbjct  98   VLDLDETLVSAYETSSIPTALRTQAIEAGLKWFELECVSSTKECNGKPKTSHVTVFERPG  157

Query  630  LH  635
            LH
Sbjct  158  LH  159



>ref|XP_010505729.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Camelina 
sativa]
Length=319

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++ +R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLD+TLVCAYETS++P+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDDTLVCAYETSSVPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_010508910.1| PREDICTED: probable C-terminal domain small phosphatase isoform 
X2 [Camelina sativa]
Length=310

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILRFDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS+LP+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDETLVSAYETSSLPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_010505722.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505723.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505724.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505725.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
Length=325

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++ +R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLD+TLVCAYETS++P+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDDTLVCAYETSSVPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>emb|CDY46516.1| BnaC06g15690D [Brassica napus]
Length=303

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 102/179 (57%), Gaps = 19/179 (11%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+ RS  LW  L+N L FF+QI +QI+R           +G+     LSS
Sbjct  1    MAELTQADVVYSRRSLQLWKTLVNCLAFFYQIFLQILRA----------VGYH--PLLSS  48

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL         E  E     P        + + + R              VVLD
Sbjct  49   SADGFKPL------PNIELLETAADSPASVEIESSIEVERSRFERLKARFQF-FFFVVLD  101

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A +AGLNWFELEC+SSDKE +GKPKINYVTVFERPGLH
Sbjct  102  LDETLVCAYETSSLPAALRNQAIDAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLH  160



>ref|XP_010505726.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
 ref|XP_010505728.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
Length=324

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++ +R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLD+TLVCAYETS++P+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDDTLVCAYETSSVPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_010517420.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X4 [Camelina sativa]
Length=311

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R           +   + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLST  49

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L +                      IA  R +       + +LTV
Sbjct  50   SPSTKDGFKPLSVLDLPKSETESPVSIE------------IASERTSTDGQVSTIQKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS++P+ + T+A EAGL WFELECVSS KEC+GKPK ++VTVFERPG
Sbjct  98   VLDLDETLVSAYETSSIPTALRTQAIEAGLKWFELECVSSTKECNGKPKTSHVTVFERPG  157

Query  630  LH  635
            LH
Sbjct  158  LH  159



>gb|KDO68954.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=285

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 107/182 (59%), Gaps = 28/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR--NSSFL  272
            MA++ QA   Y+ RS  +W  LLNWL FFFQI  +I+R           LG     SS  
Sbjct  1    MAELTQAEVAYSHRSIQVWRTLLNWLAFFFQIFAKILRA----------LGHHPLLSSSA  50

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD--GEHPLPRlt  446
            S+    FKPL+ VEL E                      I   R +G D   E  L +LT
Sbjct  51   SASTHAFKPLQVVELPETDSSATVD--------------IGAVRDSGDDVVSEERLQKLT  96

Query  447  vvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERP  626
            VVLDLDETLVCAYETS+LP  +  +AT AGL WFE+EC+SSDKEC+GKPKIN+VTVFERP
Sbjct  97   VVLDLDETLVCAYETSSLPVTLRNQATGAGLKWFEMECLSSDKECEGKPKINHVTVFERP  156

Query  627  GL  632
            GL
Sbjct  157  GL  158



>gb|KDO68952.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
 gb|KDO68953.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=300

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 107/182 (59%), Gaps = 28/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR--NSSFL  272
            MA++ QA   Y+ RS  +W  LLNWL FFFQI  +I+R           LG     SS  
Sbjct  1    MAELTQAEVAYSHRSIQVWRTLLNWLAFFFQIFAKILRA----------LGHHPLLSSSA  50

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD--GEHPLPRlt  446
            S+    FKPL+ VEL E                      I   R +G D   E  L +LT
Sbjct  51   SASTHAFKPLQVVELPETDSSATVD--------------IGAVRDSGDDVVSEERLQKLT  96

Query  447  vvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERP  626
            VVLDLDETLVCAYETS+LP  +  +AT AGL WFE+EC+SSDKEC+GKPKIN+VTVFERP
Sbjct  97   VVLDLDETLVCAYETSSLPVTLRNQATGAGLKWFEMECLSSDKECEGKPKINHVTVFERP  156

Query  627  GL  632
            GL
Sbjct  157  GL  158



>ref|XP_010517418.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X2 [Camelina sativa]
Length=333

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R           +   + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLST  49

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L +                      IA  R +       + +LTV
Sbjct  50   SPSTKDGFKPLSVLDLPKSETESPVSIE------------IASERTSTDGQVSTIQKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS++P+ + T+A EAGL WFELECVSS KEC+GKPK ++VTVFERPG
Sbjct  98   VLDLDETLVSAYETSSIPTALRTQAIEAGLKWFELECVSSTKECNGKPKTSHVTVFERPG  157

Query  630  LH  635
            LH
Sbjct  158  LH  159



>ref|XP_010517411.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517412.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517413.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517414.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517415.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517417.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
Length=341

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 108/182 (59%), Gaps = 26/182 (14%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R           +   + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLST  49

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L +                      IA  R +       + +LTV
Sbjct  50   SPSTKDGFKPLSVLDLPKSETESPVSIE------------IASERTSTDGQVSTIQKLTV  97

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS++P+ + T+A EAGL WFELECVSS KEC+GKPK ++VTVFERPG
Sbjct  98   VLDLDETLVSAYETSSIPTALRTQAIEAGLKWFELECVSSTKECNGKPKTSHVTVFERPG  157

Query  630  LH  635
            LH
Sbjct  158  LH  159



>gb|KJB74328.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=294

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 96/179 (54%), Gaps = 14/179 (8%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ +A +VY PRS  +W ALLNWL FFFQI  QI+R       + S       +  SS
Sbjct  1    MAELTRA-EVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  V+  E   P          S A       +      D +  L        
Sbjct  60   STHRFKPLPVVDSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETL--------  111

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
                 VCAYETS+LP  + ++AT+AGL WFELECVSSDKE +GKPKI+YVTVFERPGL 
Sbjct  112  -----VCAYETSSLPLALRSQATDAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQ  165



>gb|KJB74327.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=308

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 96/179 (54%), Gaps = 14/179 (8%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ +A +VY PRS  +W ALLNWL FFFQI  QI+R       + S       +  SS
Sbjct  1    MAELTRA-EVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSS  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL  V+  E   P          S A       +      D +  L        
Sbjct  60   STHRFKPLPVVDSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETL--------  111

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
                 VCAYETS+LP  + ++AT+AGL WFELECVSSDKE +GKPKI+YVTVFERPGL 
Sbjct  112  -----VCAYETSSLPLALRSQATDAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQ  165



>ref|XP_010508909.1| PREDICTED: CTD small phosphatase-like protein 2-B isoform X1 
[Camelina sativa]
Length=385

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 108/182 (59%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++QA  VY+PRS  LW  L+NWL FF++  ++I+R               + S LS+
Sbjct  1    MAELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILRFDA------------HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  + +       + +LTV
Sbjct  49   SPSTKDGFKPLSVIDLPEIATESPVSIQ------------IASEKTSTEGQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS+LP+ + T+A EAGL WFELECVSS KEC+GKPKI++VTVFERPG
Sbjct  97   VLDLDETLVSAYETSSLPAALRTQAIEAGLKWFELECVSSTKECNGKPKISHVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_009141872.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Brassica rapa]
Length=304

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 109/180 (61%), Gaps = 22/180 (12%)
 Frame = +3

Query  99   MADMAQAADVYAPRSP-HLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            M+++ QA  VY+PRS   LW   +NWL FF+Q  ++I+R        L++  F +S  +S
Sbjct  1    MSELNQADLVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAIS  53

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
                 FKPL  +EL E         +            IA GR +       + RLTVVL
Sbjct  54   DG---FKPLPVIELPEMAAEPPVTTIQ-----------IASGRTSSEGEVGSIQRLTVVL  99

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLV AYETS+LP  + T+A EAGL WFELEC+SS KEC+G+PKINYVTVFERPGLH
Sbjct  100  DLDETLVSAYETSSLPHNLRTQAIEAGLKWFELECISSTKECNGEPKINYVTVFERPGLH  159



>ref|XP_009116289.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Brassica 
rapa]
Length=291

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 31/179 (17%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q+  VY+PRS  +W   +N L FF+QI +QI+R        + Y    +SS   +
Sbjct  1    MAELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKA  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL ++EL E P   E                IA G            RL VVLD
Sbjct  54   AADGFKPLPSIELPESPTTVE----------------IATG--------DRFQRLKVVLD  89

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGLNWFELEC+SSDKE DGK KINYVTVFERPGLH
Sbjct  90   LDETLVCAYETSSLPAALRNQAIEAGLNWFELECLSSDKESDGKSKINYVTVFERPGLH  148



>emb|CDX93216.1| BnaC04g46800D [Brassica napus]
Length=304

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 107/180 (59%), Gaps = 22/180 (12%)
 Frame = +3

Query  99   MADMAQAADVYAPRSP-HLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            M +++Q   VY+PRS   LW   +NWL FF+Q  ++I+R        L++  F +S  +S
Sbjct  1    MEELSQTDVVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAIS  53

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
                 FKPL  +EL E         +            IA GR +       + RL VVL
Sbjct  54   DG---FKPLPVIELPEMAAEPPVTTIE-----------IASGRTSSEGEVGSIQRLMVVL  99

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLV AYETS+LP  + T+A EAGL WFELEC+SS KEC+G+PKINYVTVFERPGLH
Sbjct  100  DLDETLVSAYETSSLPDNLRTQAIEAGLKWFELECISSTKECNGEPKINYVTVFERPGLH  159



>emb|CDY07060.1| BnaA04g22550D [Brassica napus]
Length=304

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 108/180 (60%), Gaps = 22/180 (12%)
 Frame = +3

Query  99   MADMAQAADVYAPRSP-HLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS  275
            M+++ QA  VY+PRS   LW   +NWL FF+Q  ++I+R        L++  F +S  +S
Sbjct  1    MSELNQADVVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAIS  53

Query  276  SPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
                 FKPL  +EL E         +            I  GR +       + RLTVVL
Sbjct  54   DG---FKPLPVIELPEMAAEPPVTTIQ-----------ITSGRTSSEGEVGSIQRLTVVL  99

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLV AYETS+LP  + T+A EAGL WFELEC+SS KEC+G+PKINYVTVFERPGLH
Sbjct  100  DLDETLVSAYETSSLPDNLRTQAIEAGLKWFELECISSTKECNGEPKINYVTVFERPGLH  159



>emb|CDX72186.1| BnaC08g26880D [Brassica napus]
Length=295

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 105/180 (58%), Gaps = 29/180 (16%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q+  VY+PRS  +W   +N L FF+QI +QI+R        + Y    +SS   +
Sbjct  1    MAELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKA  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL ++EL E P                         +A         RL VVLD
Sbjct  54   ASDGFKPLPSIELPESPTTV---------------------EIASSTTGDRFQRLKVVLD  92

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSD-KECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGLNWFELEC+SSD KE DGKPKINYVTVFERPGLH
Sbjct  93   LDETLVCAYETSSLPAALRNQAIEAGLNWFELECLSSDKKESDGKPKINYVTVFERPGLH  152



>ref|XP_002309143.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
 gb|EEE92666.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
Length=325

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  147  HLWGALLNWLCFFFQILVQIVRGTPSLTQ-VLSYLGFRNSSFLSSPPPEFKPLRTvelse  323
             +W  ++N L F  ++ +QI+RGTPS+ Q +LSY+GF     LSS PP FKPL  VE+  
Sbjct  24   EVWKGMMNGLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSPPSFKPLPVVEIPL  82

Query  324  fpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLP  503
                          S  +       G    C  E    +LTVVLDLDETL+CAYE S+LP
Sbjct  83   QETTSNKITDKAHDSSCLPGYVCDFGASDDCLIE----KLTVVLDLDETLICAYEASSLP  138

Query  504  SIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            +II T+A EAG+  FELEC SS+K+ +GKP+INYVTVFERPGL 
Sbjct  139  AIIRTQAVEAGVKCFELECFSSEKDVEGKPRINYVTVFERPGLK  182



>ref|XP_009392189.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 104/175 (59%), Gaps = 26/175 (15%)
 Frame = +3

Query  117  AADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS--SPPPE  290
            AA     +S  LW  L++W+   F +L+QI R TPS  Q++S++G R +   S  S  P+
Sbjct  15   AATTKTTKSVQLWRTLVSWVAVLFHVLLQIPRRTPSWAQLVSFVGLRQNLLFSPSSASPD  74

Query  291  FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldet  470
            +KPL     ++ P P +                          G  PL +LT+VLDLDET
Sbjct  75   YKPLAVDPPTDAPPPNQFA------------------------GPEPLKKLTIVLDLDET  110

Query  471  lvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LVCAYETS+LPS + T+A EAGL  F+LEC+SS+K+ DG+ K+N+VTVFERPGL 
Sbjct  111  LVCAYETSSLPSTVHTQAIEAGLKCFDLECISSEKDADGRQKVNHVTVFERPGLQ  165



>ref|XP_006294651.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27549.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=272

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 105/182 (58%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++Q   VY+PRS  LW   +NWL +F++  ++I          L  +G  + S LS+
Sbjct  1    MAELSQTDLVYSPRSIQLWNVFVNWLDYFYEFFLKI----------LGAVG--HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  R +       + +LTV
Sbjct  49   SPSNKDGFKPLSVIDLPEITAEPPLSVE------------IASARTSTERQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS+LP+ +  +A EAGL WFELECVSS KEC+GKPK +YVTVFERPG
Sbjct  97   VLDLDETLVSAYETSSLPAALRKQAIEAGLKWFELECVSSTKECNGKPKTSYVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>emb|CDY27252.1| BnaA09g35500D [Brassica napus]
Length=295

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 104/180 (58%), Gaps = 29/180 (16%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q+  VY+PRS  +W   +N L FF+QI +QI+R        + Y    +SS   +
Sbjct  1    MAELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKA  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL ++EL E P                         +A         RL VVLD
Sbjct  54   AADGFKPLPSIELPESPTTV---------------------EIASSATGDRFQRLKVVLD  92

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSD-KECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGLNWFELEC+SSD KE DGK KINYVTVFERPGLH
Sbjct  93   LDETLVCAYETSSLPAALRNQAIEAGLNWFELECLSSDKKESDGKSKINYVTVFERPGLH  152



>ref|XP_008805431.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Phoenix dactylifera]
Length=301

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 95/163 (58%), Gaps = 29/163 (18%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPP--PEFKPLRTvelsef  326
            W  +L WL F FQIL+QI+RGTPS  QVLS++G R+    SS    P FKPL        
Sbjct  23   WRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSPAFKPLPAE-----  77

Query  327  pepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPS  506
                                  A            L +LTVVLDLDETLVCAYETS+LP+
Sbjct  78   ----------------------APNDTPPPPPPEVLDKLTVVLDLDETLVCAYETSSLPA  115

Query  507  IITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            ++ ++A EAGL  FELEC+S DKE +GK K+N+VTVFERPGL 
Sbjct  116  VVRSQAVEAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQ  158



>ref|XP_008805436.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Phoenix dactylifera]
Length=291

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 95/163 (58%), Gaps = 29/163 (18%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPP--PEFKPLRTvelsef  326
            W  +L WL F FQIL+QI+RGTPS  QVLS++G R+    SS    P FKPL        
Sbjct  23   WRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSPAFKPLPAE-----  77

Query  327  pepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPS  506
                                  A            L +LTVVLDLDETLVCAYETS+LP+
Sbjct  78   ----------------------APNDTPPPPPPEVLDKLTVVLDLDETLVCAYETSSLPA  115

Query  507  IITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            ++ ++A EAGL  FELEC+S DKE +GK K+N+VTVFERPGL 
Sbjct  116  VVRSQAVEAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQ  158



>ref|XP_006294652.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27550.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=309

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 105/182 (58%), Gaps = 27/182 (15%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA+++Q   VY+PRS  LW   +NWL +F++  ++I          L  +G  + S LS+
Sbjct  1    MAELSQTDLVYSPRSIQLWNVFVNWLDYFYEFFLKI----------LGAVG--HHSLLST  48

Query  279  PPPE---FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltv  449
             P     FKPL  ++L E                      IA  R +       + +LTV
Sbjct  49   SPSNKDGFKPLSVIDLPEITAEPPLSVE------------IASARTSTERQVSTIQKLTV  96

Query  450  vldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPG  629
            VLDLDETLV AYETS+LP+ +  +A EAGL WFELECVSS KEC+GKPK +YVTVFERPG
Sbjct  97   VLDLDETLVSAYETSSLPAALRKQAIEAGLKWFELECVSSTKECNGKPKTSYVTVFERPG  156

Query  630  LH  635
            LH
Sbjct  157  LH  158



>ref|XP_010922553.1| PREDICTED: CTD small phosphatase-like protein 2 [Elaeis guineensis]
Length=302

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 99/169 (59%), Gaps = 30/169 (18%)
 Frame = +3

Query  138  RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRN---SSFLSSPPPEFKPLRT  308
            ++   W  +L WL F FQIL+QI+RGTPS  QVLS++G R+   SS  SS  P FKPL  
Sbjct  18   KTGQAWRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSSPAFKPLPA  77

Query  309  velsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYE  488
                                        A            L +LT+VLDLDETLVCAYE
Sbjct  78   E---------------------------APTDTPPPPPPEVLDKLTIVLDLDETLVCAYE  110

Query  489  TSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            TS+LP+I+ ++A EAGL  FELEC+S DKE +GK K+N+VTVFERPGL 
Sbjct  111  TSSLPAIVRSQAIEAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQ  159



>ref|XP_004970462.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=312

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 111/192 (58%), Gaps = 44/192 (23%)
 Frame = +3

Query  117  AADVYAPR-------------SPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVASQAWRTVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  ----NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD  419
                +    S P PE  F PLR+   ++      APP P                     
Sbjct  63   YPLLSGPAASEPSPEVAFMPLRSEIPADVAPAPAAPPEP---------------------  101

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
                L RLTVVLDLDETLV AYE+S+LP I+ T+A EAGL+ F++EC+SSDK+ DGK K+
Sbjct  102  ----LGRLTVVLDLDETLVSAYESSSLPVIVRTQAVEAGLHCFDMECISSDKDVDGKQKV  157

Query  600  NYVTVFERPGLH  635
            N+VTVFERPGLH
Sbjct  158  NHVTVFERPGLH  169



>ref|NP_001148462.1| LOC100282077 [Zea mays]
 gb|ACG31578.1| CTD small phosphatase-like protein [Zea mays]
 gb|AFW84679.1| CTD small phosphatase-like protein isoform 1 [Zea mays]
 gb|AFW84680.1| CTD small phosphatase-like protein isoform 2 [Zea mays]
Length=311

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 103/167 (62%), Gaps = 31/167 (19%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR----NSSFLSSPPPE--FKPLRTve  314
            W A++ W+ FF Q+L+QI+RGTPS  Q+LS++GFR    +    S P PE  F PL +  
Sbjct  27   WRAVVGWIGFFLQVLLQILRGTPSCAQLLSFVGFRYPLLSGPAASEPLPEVAFMPLHSEI  86

Query  315  lsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETS  494
             ++     +    P                         L RLTVVLDLDETLV AYE+S
Sbjct  87   PADAAPAPKPASEP-------------------------LGRLTVVLDLDETLVSAYESS  121

Query  495  TLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            +LP+I+ T+A EAGL+ F++EC+SSDK+ +GK K+N+VTVFERPGLH
Sbjct  122  SLPAIVRTQAVEAGLHCFDMECISSDKDVEGKQKVNHVTVFERPGLH  168



>ref|XP_009116288.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Brassica 
rapa]
Length=292

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 106/180 (59%), Gaps = 32/180 (18%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q+  VY+PRS  +W   +N L FF+QI +QI+R        + Y    +SS   +
Sbjct  1    MAELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKA  53

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL ++EL E P   E                IA G            RL VVLD
Sbjct  54   AADGFKPLPSIELPESPTTVE----------------IATG--------DRFQRLKVVLD  89

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSD-KECDGKPKINYVTVFERPGLH  635
            LDETLVCAYETS+LP+ +  +A EAGLNWFELEC+SSD KE DGK KINYVTVFERPGLH
Sbjct  90   LDETLVCAYETSSLPAALRNQAIEAGLNWFELECLSSDKKESDGKSKINYVTVFERPGLH  149



>ref|XP_006411263.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
 gb|ESQ52716.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
Length=320

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 108/179 (60%), Gaps = 16/179 (9%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ QA  VY+PRS  LW  L+NWL FF+Q  ++I+R   S   +LS     ++  ++ 
Sbjct  1    MAELTQADLVYSPRSLQLWTVLVNWLDFFYQSFLKILRAI-SRHPLLSTSSSSSAKSIAD  59

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL                LP     +   + IA  R +       + RLTVVLD
Sbjct  60   ---GFKPL------------PVIELPEVAPESPVTVGIASTRTSSEVKFGSIQRLTVVLD  104

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            LDETLV AYETS+LP+ + T+A EAGL  FELEC+SS KEC+G+PKINYVTVFERPGLH
Sbjct  105  LDETLVSAYETSSLPATLRTQAIEAGLKSFELECISSTKECNGEPKINYVTVFERPGLH  163



>ref|XP_008388217.1| PREDICTED: uncharacterized protein LOC103450630 [Malus domestica]
Length=216

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 93/174 (53%), Gaps = 45/174 (26%)
 Frame = +3

Query  111  AQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPE  290
            A AA+VY P +   W  ++NW+ FF+QI++QI+RG P L  +LS +   +S       P 
Sbjct  7    AAAAEVYVPMTLQAW-RVVNWVGFFYQIILQILRGAPCLPHLLSCISSSSS-------PA  58

Query  291  FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldet  470
            F+PL   EL +F                              D +  L            
Sbjct  59   FRPLPVAELMDFVMEVVL------------------------DLDETL------------  82

Query  471  lvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
             VCAYET ++P+I+   ATEAG+ WFE+EC+SS+KE DGKPKINYVTVFERPGL
Sbjct  83   -VCAYETCSVPAIVRARATEAGMKWFEMECLSSEKESDGKPKINYVTVFERPGL  135



>ref|XP_002458718.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
 gb|EES03838.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
Length=314

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 111/192 (58%), Gaps = 42/192 (22%)
 Frame = +3

Query  117  AADVYAP-------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKAASQAWRAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  ----NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD  419
                +    S P PE  F PL +   ++        P P P                   
Sbjct  63   YPLLSGPAASEPSPEVAFMPLHSEIPADADAAPAPIPAPEP-------------------  103

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
                L RLTVVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+SSDK+ +GK K+
Sbjct  104  ----LGRLTVVLDLDETLVSAYESSSLPAIVRTQAVEAGLHCFDMECISSDKDVEGKQKV  159

Query  600  NYVTVFERPGLH  635
            N+VTVFERPGLH
Sbjct  160  NHVTVFERPGLH  171



>gb|EMT13698.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=314

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 109/194 (56%), Gaps = 46/194 (24%)
 Frame = +3

Query  117  AADVYAP-------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  ------NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAG  413
                   S+    P PE  F PLR+   +        PP P                   
Sbjct  63   YPLLSSASAAPDQPSPEVAFMPLRSEIPAAAAPVPAPPPEP-------------------  103

Query  414  CDGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKP  593
                  L RLTVVLDLDETLV AYE+S LP I+ T+A EAGL+ F++EC+S+DK+ +GK 
Sbjct  104  ------LQRLTVVLDLDETLVSAYESSGLPPIVRTQAVEAGLHCFDMECISTDKDVEGKQ  157

Query  594  KINYVTVFERPGLH  635
            K+N+VTVFERPGLH
Sbjct  158  KVNHVTVFERPGLH  171



>ref|XP_003564541.1| PREDICTED: CTD small phosphatase-like protein [Brachypodium distachyon]
Length=312

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 111/192 (58%), Gaps = 44/192 (23%)
 Frame = +3

Query  117  AADVYAPR-------------SPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +  +W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKAATQVWRTVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  ----NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD  419
                +++  S P PE  F PL +   ++       PP P                     
Sbjct  63   YPLLSATAASDPSPEVAFMPLHSEIPADAAPVPAPPPAP---------------------  101

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
                L RLTVVLDLDETLV AYE+S LP I+ T+A EAGL+ F++EC+S+DK+ +GK K+
Sbjct  102  ----LERLTVVLDLDETLVSAYESSGLPPIVRTQAVEAGLHCFDMECISTDKDVEGKQKV  157

Query  600  NYVTVFERPGLH  635
            N+VTVFERPGLH
Sbjct  158  NHVTVFERPGLH  169



>ref|XP_011019110.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Populus euphratica]
Length=324

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  147  HLWGALLNWLCFFFQILVQIVRGTPSLTQ-VLSYLGFRNSSFLSSPPPEFKPLRTvelse  323
             +W  ++NWL F  ++ +QI+RGTPS+ Q +LSY+GF     LSS    FKPL  VE+  
Sbjct  23   EVWKGMMNWLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSSSSFKPLPVVEIPL  81

Query  324  fpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLP  503
                          S  +       G    C  E    +LTVVLDLDETL+CAYE S+LP
Sbjct  82   QETTSNKITDTAHDSSCLPGYVCDLGASDDCLIE----KLTVVLDLDETLICAYEASSLP  137

Query  504  SIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            +II T+A EAG+  FELEC SS+K+ +GKP+INYVTVFERPGL 
Sbjct  138  AIIRTQAVEAGVKCFELECFSSEKDVEGKPRINYVTVFERPGLK  181



>emb|CDM84840.1| unnamed protein product [Triticum aestivum]
Length=313

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 110/193 (57%), Gaps = 45/193 (23%)
 Frame = +3

Query  117  AADVYAP-------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  -----NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC  416
                  ++    P PE  F PLR+   ++       PP P                    
Sbjct  63   YPLLSATAAPDQPSPEVAFMPLRSEIPADAAPVPAPPPEP--------------------  102

Query  417  DGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPK  596
                 L RLTVVLDLDETLV AYE+S LP I+ T+A EAGL+ F++EC+S+DK+ +GK K
Sbjct  103  -----LERLTVVLDLDETLVSAYESSGLPPIVRTQAVEAGLHCFDMECISTDKDVEGKQK  157

Query  597  INYVTVFERPGLH  635
            +N+VTVFERPGLH
Sbjct  158  VNHVTVFERPGLH  170



>ref|NP_001044710.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAD73773.1| NLI interacting factor (NIF) family protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF06624.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAG91176.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55630.1| hypothetical protein OsJ_03971 [Oryza sativa Japonica Group]
Length=312

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 107/192 (56%), Gaps = 44/192 (23%)
 Frame = +3

Query  117  AADVYAPR-------------SPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVAAQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  N------SSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD  419
                   +    SP   F PLR+                            A    A   
Sbjct  63   YPLLSGPADSEQSPSVAFMPLRSEIP-------------------------ADTAPAPTP  97

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
                L RLTVVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+S++K+ +G+ K+
Sbjct  98   PPESLQRLTVVLDLDETLVSAYESSSLPAIVRTQAVEAGLHCFDMECISTEKDVEGRNKV  157

Query  600  NYVTVFERPGLH  635
            N+VTVFERPGLH
Sbjct  158  NHVTVFERPGLH  169



>gb|EEC71746.1| hypothetical protein OsI_04315 [Oryza sativa Indica Group]
Length=312

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 107/192 (56%), Gaps = 44/192 (23%)
 Frame = +3

Query  117  AADVYAPR-------------SPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVAAQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  N------SSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCD  419
                   +    SP   F PLR+                            A    A   
Sbjct  63   YPLLSGPADSEQSPSVAFMPLRSEIP-------------------------ADTAPAPTP  97

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
                L RLTVVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+S++K+ +G+ K+
Sbjct  98   PPESLQRLTVVLDLDETLVSAYESSSLPAIVRTQAVEAGLHCFDMECISTEKDVEGRNKV  157

Query  600  NYVTVFERPGLH  635
            N+VTVFERPGLH
Sbjct  158  NHVTVFERPGLH  169



>ref|XP_009416286.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 98/168 (58%), Gaps = 26/168 (15%)
 Frame = +3

Query  138  RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLS--SPPPEFKPLRTv  311
            +S   W AL+NW+   F++L+QI RGTPS  Q+LS++G R++   S  +  P +KPL   
Sbjct  24   KSVQAWRALVNWVAILFRLLLQIPRGTPSWAQILSFVGLRHTLLFSPSTASPAYKPL---  80

Query  312  elsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYET  491
                                     PI            PL +LTVVLDLDETLVCAYET
Sbjct  81   ---------------------AIDPPIDGPTPDTAPAPEPLGKLTVVLDLDETLVCAYET  119

Query  492  STLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            S+LPS + ++A EAG+  F+LECVSS+ + DG+ K N+VTVFERPGL 
Sbjct  120  SSLPSTVHSQAIEAGVKCFDLECVSSENDADGRQKANHVTVFERPGLR  167



>ref|XP_010101420.1| CTD small phosphatase-like protein [Morus notabilis]
 gb|EXB88392.1| CTD small phosphatase-like protein [Morus notabilis]
Length=307

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 104/181 (57%), Gaps = 21/181 (12%)
 Frame = +3

Query  96   LMADMAQAADV-YAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFL  272
            + A++ Q  DV Y+PR+  +W ALLNWL FFFQI +          Q+L  LG       
Sbjct  1    MAAELTQGGDVVYSPRTLQVWRALLNWLGFFFQIFL----------QILRALGHLPLLSS  50

Query  273  SSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvv  452
            S          +   S   +P     LP     A   + IA    +  D      +LTVV
Sbjct  51   S----------SSSSSPSFKPLPNIELPEHDLPADSAVHIAALHDSDSDDVSEEKKLTVV  100

Query  453  ldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDLDETLVCAYETS+LP  +  +ATEAGL WFELECVSSDKE +G+PKIN+VTVFERPGL
Sbjct  101  LDLDETLVCAYETSSLPPGVRNQATEAGLKWFELECVSSDKEFEGRPKINHVTVFERPGL  160

Query  633  H  635
            H
Sbjct  161  H  161



>ref|NP_001136647.1| uncharacterized protein LOC100216776 [Zea mays]
 gb|ACF82332.1| unknown [Zea mays]
 tpg|DAA56987.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=364

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 109/191 (57%), Gaps = 43/191 (23%)
 Frame = +3

Query  117  AADVYAP------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR-  257
            AA+VY+P             +   W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++G R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  258  ---NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDG  422
               +    S+P PE  F PLR+   ++        P P                      
Sbjct  63   PLLSGPTASNPSPEVAFMPLRSEIPADAAPAPTPAPEP----------------------  100

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
               L RL VVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+SSDK+ +GK K+N
Sbjct  101  ---LGRLKVVLDLDETLVSAYESSSLPTIVRTQAVEAGLHCFDMECISSDKDAEGKQKVN  157

Query  603  YVTVFERPGLH  635
            +VTVFERPGLH
Sbjct  158  HVTVFERPGLH  168



>ref|XP_008672265.1| PREDICTED: uncharacterized protein LOC100216776 isoform X1 [Zea 
mays]
Length=360

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 109/191 (57%), Gaps = 43/191 (23%)
 Frame = +3

Query  117  AADVYAP------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR-  257
            AA+VY+P             +   W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++G R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  258  ---NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDG  422
               +    S+P PE  F PLR+   ++        P P                      
Sbjct  63   PLLSGPTASNPSPEVAFMPLRSEIPADAAPAPTPAPEP----------------------  100

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
               L RL VVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+SSDK+ +GK K+N
Sbjct  101  ---LGRLKVVLDLDETLVSAYESSSLPTIVRTQAVEAGLHCFDMECISSDKDAEGKQKVN  157

Query  603  YVTVFERPGLH  635
            +VTVFERPGLH
Sbjct  158  HVTVFERPGLH  168



>gb|ACG32959.1| CTD small phosphatase-like protein [Zea mays]
 tpg|DAA56988.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=311

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 109/191 (57%), Gaps = 43/191 (23%)
 Frame = +3

Query  117  AADVYAP------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR-  257
            AA+VY+P             +   W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++G R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  258  ---NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDG  422
               +    S+P PE  F PLR+   ++        P P                      
Sbjct  63   PLLSGPTASNPSPEVAFMPLRSEIPADAAPAPTPAPEP----------------------  100

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
               L RL VVLDLDETLV AYE+S+LP+I+ T+A EAGL+ F++EC+SSDK+ +GK K+N
Sbjct  101  ---LGRLKVVLDLDETLVSAYESSSLPTIVRTQAVEAGLHCFDMECISSDKDAEGKQKVN  157

Query  603  YVTVFERPGLH  635
            +VTVFERPGLH
Sbjct  158  HVTVFERPGLH  168



>dbj|BAJ91589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 110/193 (57%), Gaps = 45/193 (23%)
 Frame = +3

Query  117  AADVYAP-------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            AA+VY+P              +   W A++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  258  -----NSSFLSSPPPE--FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC  416
                  ++    P PE  F PLR+   ++       PP P                    
Sbjct  63   YPLLSATAGPDQPSPEVAFMPLRSEIPADAAPVPAPPPEP--------------------  102

Query  417  DGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPK  596
                 L RLTVVLDLDETLV AYE+S LP I+ T+A EAGL+ F++EC+S+DK+ +GK K
Sbjct  103  -----LERLTVVLDLDETLVSAYESSGLPPIVRTQAVEAGLHCFDMECISTDKDVEGKQK  157

Query  597  INYVTVFERPGLH  635
            +N+VTVFERPGLH
Sbjct  158  VNHVTVFERPGLH  170



>gb|KFK23193.1| hypothetical protein AALP_AAs48948U000100 [Arabis alpina]
Length=303

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 100/180 (56%), Gaps = 28/180 (16%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++ Q   VY+PR    W  L+NWL FF+Q  ++I+R        L Y  +   +    
Sbjct  1    MAELTQTDLVYSPR----WNVLVNWLDFFYQFFLKILRAFAH--NPLLYASYSTKAIADG  54

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGE-HPLPRltvvl  455
                FKPL  +EL E                           +A   GE   + RLTVVL
Sbjct  55   ----FKPLSVIELPEITAESPIAV-----------------EIASEVGEVSSIQRLTVVL  93

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLV AYETS+L + + T+A EAGL WFELEC+SS KEC GKPKINYVTVFERPGLH
Sbjct  94   DLDETLVSAYETSSLSAALRTQAIEAGLKWFELECISSTKECKGKPKINYVTVFERPGLH  153



>ref|XP_003616639.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES99597.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=305

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M ++ Q      PR+  +W +LL+W  FFFQI  QI+R        L      +SS  SS
Sbjct  1    MGELTQTEVYSPPRTQQVWKSLLSWFAFFFQIFSQIIRTLGHYP--LLSSSSSSSSSSSS  58

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvld  458
                FKPL +VEL +F     A               I     A    + P  +LTVVLD
Sbjct  59   TSSSFKPLPSVELQDFDSSSSALE-------------ITADYPAA--DQRPFQKLTVVLD  103

Query  459  ldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            LDETLVCAYETS+LP+ + ++A EAGLNWF++ECVSSDKE +G+PKINYVTVFERPGL
Sbjct  104  LDETLVCAYETSSLPAALRSQAIEAGLNWFDMECVSSDKEGEGRPKINYVTVFERPGL  161



>gb|KCW86105.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=238

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP +I ++A EAGL WFELECVSSDKECDGKPK+NYVTVFERPGLH
Sbjct  138  CAYETSSLPEVIRSQAIEAGLKWFELECVSSDKECDGKPKVNYVTVFERPGLH  190


 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  117  AADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNS  263
            ++++Y PRS  +W  L+NWL FF Q+ +QI+RGTPSL Q LSY+G R S
Sbjct  13   SSEMYVPRSMQVWRGLMNWLAFFLQVFLQILRGTPSLAQFLSYIGLRQS  61



>ref|XP_009344958.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=301

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+++ T+ATE G+ WFELECVSSDKECDGKPK+NYVTVFERPGLH
Sbjct  107  CAYETSSLPAVVRTQATEGGMKWFELECVSSDKECDGKPKVNYVTVFERPGLH  159



>ref|XP_008374036.1| PREDICTED: CTD small phosphatase-like protein [Malus domestica]
Length=301

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+++ T+ATE G+ WFELECVSSDKECDGKPK+NYVTVFERPGLH
Sbjct  107  CAYETSSLPAVVRTQATEGGMKWFELECVSSDKECDGKPKVNYVTVFERPGLH  159


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRG  215
            MA++ Q   VY+P++  +W ALLNWL FFFQI ++I+R 
Sbjct  1    MAELTQGEVVYSPKTLQVWRALLNWLGFFFQIFLRILRA  39



>gb|KDO56646.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=224

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+II T+A EAGL  FELECVSSDKECDGKPKINYVTVFERPGLH
Sbjct  124  CAYETSSLPAIIRTQAAEAGLKLFELECVSSDKECDGKPKINYVTVFERPGLH  176



>ref|XP_010044096.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW86104.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=333

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP +I ++A EAGL WFELECVSSDKECDGKPK+NYVTVFERPGLH
Sbjct  138  CAYETSSLPEVIRSQAIEAGLKWFELECVSSDKECDGKPKVNYVTVFERPGLH  190


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  117  AADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNS  263
            ++++Y PRS  +W  L+NWL FF Q+ +QI+RGTPSL Q LSY+G R S
Sbjct  13   SSEMYVPRSMQVWRGLMNWLAFFLQVFLQILRGTPSLAQFLSYIGLRQS  61



>emb|CDP02804.1| unnamed protein product [Coffea canephora]
 emb|CDP01667.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            MA++AQ+ADVYAP++  +W ALLNWL FFFQI VQI+RGT SLTQVLSY+G R+SS LSS
Sbjct  1    MAELAQSADVYAPKTIQVWRALLNWLAFFFQIFVQIIRGTSSLTQVLSYVGLRHSSLLSS  60

Query  279  PPPEFKPL  302
              P+FKPL
Sbjct  61   SSPQFKPL  68



>ref|XP_010095241.1| CTD small phosphatase-like protein 2 [Morus notabilis]
 gb|EXB59009.1| CTD small phosphatase-like protein 2 [Morus notabilis]
Length=234

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+I+  +ATEAGL WFELECVSSDKECDGKPKI+YVTVFERPGL 
Sbjct  39   CAYETSSLPAIVKIQATEAGLKWFELECVSSDKECDGKPKISYVTVFERPGLQ  91



>gb|KDO56645.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=319

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+II T+A EAGL  FELECVSSDKECDGKPKINYVTVFERPGLH
Sbjct  124  CAYETSSLPAIIRTQAAEAGLKLFELECVSSDKECDGKPKINYVTVFERPGLH  176



>ref|XP_009616349.1| PREDICTED: uncharacterized protein C2F7.02c-like [Nicotiana tomentosiformis]
Length=251

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS++P+I+ T+ATEAGL WFELECVSSDKE DGKPKINY TVFERPGLH
Sbjct  56   CAYETSSMPTIMRTQATEAGLKWFELECVSSDKEYDGKPKINYFTVFERPGLH  108



>ref|XP_004307664.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=297

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYE+++LP+++ T+ATE G+ WFELEC+SSDKECDGKPK+NYVTVFERPGLH
Sbjct  103  CAYESASLPAMVRTQATEGGMKWFELECISSDKECDGKPKVNYVTVFERPGLH  155



>ref|XP_006646453.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=282

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 95/164 (58%), Gaps = 31/164 (19%)
 Frame = +3

Query  162  LLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRN------SSFLSSPPPEFKPLRTvelse  323
            ++ W+ F  Q+L+QI+RGTPS  Q+LS++GFR       +    SP   F PLR+     
Sbjct  1    VVGWIGFLLQVLLQILRGTPSCAQLLSFVGFRYPLLSGPADSEQSPSVAFMPLRSEIP--  58

Query  324  fpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLP  503
                                        A       L RL VVLDLDETLV AYE+S+LP
Sbjct  59   -----------------------VDAAPAPTPPPESLQRLMVVLDLDETLVSAYESSSLP  95

Query  504  SIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            +I+ T+A EAGL+ F++EC+S++K+ +G+ K+N+VTVFERPGLH
Sbjct  96   AIVRTQAVEAGLHCFDMECISTEKDVEGRQKVNHVTVFERPGLH  139



>ref|XP_011019111.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Populus euphratica]
Length=323

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 100/164 (61%), Gaps = 7/164 (4%)
 Frame = +3

Query  147  HLWGALLNWLCFFFQILVQIVRGTPSLTQ-VLSYLGFRNSSFLSSPPPEFKPLRTvelse  323
             +W  ++NWL F  ++ +QI+RGTPS+ Q +LSY+GF     LSS    FKPL  VE+  
Sbjct  23   EVWKGMMNWLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSSSSFKPLPVVEIPL  81

Query  324  fpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLP  503
                          S  +       G    C  E    +LTVVLDLDETL+CAYE S+LP
Sbjct  82   QETTSNKITDTAHDSSCLPGYVCDLGASDDCLIE----KLTVVLDLDETLICAYEASSLP  137

Query  504  SIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            +II T+A EAG+  FELEC SS+ + +GKP+INYVTVFERPGL 
Sbjct  138  AIIRTQAVEAGVKCFELECFSSE-DVEGKPRINYVTVFERPGLK  180



>ref|XP_006429395.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
 gb|ESR42635.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
Length=321

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+II  +A EAGL  FELECVSSDKECDGKPKINYVTVFERPGLH
Sbjct  126  CAYETSSLPAIIRAQAAEAGLKLFELECVSSDKECDGKPKINYVTVFERPGLH  178



>ref|XP_006481044.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
Length=321

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+II  +A EAGL  FELECVSSDKECDGKPKINYVTVFERPGLH
Sbjct  126  CAYETSSLPAIIRAQAAEAGLKLFELECVSSDKECDGKPKINYVTVFERPGLH  178



>ref|XP_002439933.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
 gb|EES18363.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
Length=295

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 97/163 (60%), Gaps = 30/163 (18%)
 Frame = +3

Query  150  LWGALLNWLCFFFQILVQIVRGTPSL-TQVLSYLGFRNSSFLSSPPPEFKPLRTvelsef  326
            +W A+  WL   FQIL++I+R TPS   Q+LS++G R+     +  PE   ++       
Sbjct  19   VWRAVAGWLGLLFQILLRIIRSTPSSWAQLLSFVGLRHPLLPVASSPEVAFVQLPSE---  75

Query  327  pepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPS  506
                                  A   V+      PL RLTVVLDLDETLVCAYE+S+LP+
Sbjct  76   ----------------------APADVSPP----PLRRLTVVLDLDETLVCAYESSSLPA  109

Query  507  IITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
             + T+A EAGL+ F++ECVSS+K+ DG+ +IN+VTVFERPGLH
Sbjct  110  TVRTQAVEAGLHCFDMECVSSEKDPDGRQRINHVTVFERPGLH  152



>gb|KDP24445.1| hypothetical protein JCGZ_25009 [Jatropha curcas]
Length=316

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 113/191 (59%), Gaps = 30/191 (16%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQV-LSYLGF-------  254
            MA + Q  +V+  RS  +W  ++NWL F  Q+ +QI+R TPS+ Q+ LSY+GF       
Sbjct  1    MALIEQQGEVHMTRSVQIWRGIVNWLGFLLQLFLQILRITPSMAQMALSYVGFTYPLLSS  60

Query  255  ----RNSSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDG  422
                 +SSF S P  E  PL+   L+   +                   +++G    C+ 
Sbjct  61   SCCSSSSSFKSLPVVEI-PLQESSLTLPAQISVPAD-------------VSEG--DACN-  103

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
             H + +LTVVLDLDETLVCAYETS+LPS I   A  AGL WFELECVS DKEC+GK K+N
Sbjct  104  -HRMEKLTVVLDLDETLVCAYETSSLPSSICALAIGAGLKWFELECVSPDKECEGKTKVN  162

Query  603  YVTVFERPGLH  635
            YVTVFERPGL 
Sbjct  163  YVTVFERPGLR  173



>gb|KHN48568.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=304

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
            +HP+P+LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GKPKIN
Sbjct  91   DHPIPKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGKPKIN  150

Query  603  YVTVFERPGL  632
            YVTVFERPGL
Sbjct  151  YVTVFERPGL  160



>ref|NP_001242244.1| uncharacterized protein LOC100783451 [Glycine max]
 gb|ACU20842.1| unknown [Glycine max]
Length=304

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  423  EHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKIN  602
            +HP+P+LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GKPKIN
Sbjct  91   DHPIPKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGKPKIN  150

Query  603  YVTVFERPGL  632
            YVTVFERPGL
Sbjct  151  YVTVFERPGL  160



>ref|XP_009406928.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 105/189 (56%), Gaps = 37/189 (20%)
 Frame = +3

Query  99   MADMAQAADVYAP-----------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSY  245
            MA++AQ    Y+P           +S   W AL+  +   F++L+QI+RGTPS  Q+LS 
Sbjct  1    MAELAQEGS-YSPGAATAAADATTKSVQAWRALVCRVAILFRLLLQILRGTPSWAQLLSS  59

Query  246  LGFRNSSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGE  425
            +G R+  F SSP   +K L     ++      AP                          
Sbjct  60   VGLRHP-FFSSPSAGYKLLSVAPPADALPNHTAP------------------------AS  94

Query  426  HPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINY  605
             PL +LTVVLDLDETL+CAYETS+L S +  +A EAGL  F+LECVSS+++ DG  K+N+
Sbjct  95   EPLGKLTVVLDLDETLICAYETSSLSSTVRAQAVEAGLECFDLECVSSEQDADGSQKVNH  154

Query  606  VTVFERPGL  632
            VTVFERPGL
Sbjct  155  VTVFERPGL  163



>emb|CAN64082.1| hypothetical protein VITISV_006933 [Vitis vinifera]
Length=208

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+ I  +A E+GL WFELECVSSDKEC+GKPK+NYVTVFERPGL 
Sbjct  13   CAYETSSLPASIRNQAIESGLKWFELECVSSDKECEGKPKVNYVTVFERPGLR  65



>ref|XP_008463241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Cucumis melo]
Length=297

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETSTLP+II ++A EAGL  FELEC SSDK+C+GKPK+NYVTVFERPGLH
Sbjct  104  CAYETSTLPAIIRSQAIEAGLKSFELECYSSDKDCEGKPKVNYVTVFERPGLH  156



>ref|XP_004149232.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004172125.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN50658.1| hypothetical protein Csa_5G203410 [Cucumis sativus]
Length=297

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETSTLP+II ++A EAGL  FELEC SSDK+C+GKPK+NYVTVFERPGLH
Sbjct  104  CAYETSTLPAIIRSQAIEAGLKSFELECFSSDKDCEGKPKVNYVTVFERPGLH  156



>ref|XP_010534600.1| PREDICTED: CTD small phosphatase-like protein [Tarenaya hassleriana]
Length=311

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP  +  +A EAGL WFELECVSS+KEC+GKPKINYVTVFERPGLH
Sbjct  116  CAYETSSLPVSLRNQAIEAGLKWFELECVSSEKECEGKPKINYVTVFERPGLH  168


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGT  218
            MA++ QA  VY+PRS  +W AL+NWL FF+QI +Q +R  
Sbjct  1    MAELTQAEVVYSPRSLEVWKALVNWLAFFYQIFLQFLRAV  40



>ref|XP_004491033.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cicer arietinum]
Length=311

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            CAYETS+LP+ + ++A EAGLNWFELECVSSDKE +GKPKINYVTVFERPGL
Sbjct  116  CAYETSSLPAALRSQAIEAGLNWFELECVSSDKEGEGKPKINYVTVFERPGL  167



>ref|XP_007141763.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
 gb|ESW13757.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
Length=212

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
             + P+ +LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GKPKI
Sbjct  89   ADRPIQKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGKPKI  148

Query  600  NYVTVFERPGL  632
            NYVTVFERPGL
Sbjct  149  NYVTVFERPGL  159



>gb|AFK34480.1| unknown [Lotus japonicus]
Length=292

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 100/179 (56%), Gaps = 37/179 (21%)
 Frame = +3

Query  108  MAQAADVYA-PRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPP  284
            + Q   VY+ PR+   W ALL+W  FFFQI  QI+ G  +   +LS+    +SS     P
Sbjct  6    LTQCDVVYSVPRTQQAWRALLSWFGFFFQIFYQII-GVFAHYPLLSFSSSSDSSSFEPVP  64

Query  285  P---EFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvl  455
                +  PLR+                                 AG DG  PL +LTVVL
Sbjct  65   AVDQDLPPLRS------------------------------SSAAGDDG--PLQKLTVVL  92

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            DL+ETLVCAYETS++P+ + T+A +AGLNWFE+EC+ SDK+ +G  K +YVTVFERPGL
Sbjct  93   DLNETLVCAYETSSVPATLRTQAIQAGLNWFEMECLCSDKDAEGITKTSYVTVFERPGL  151



>emb|CAN74278.1| hypothetical protein VITISV_004711 [Vitis vinifera]
Length=388

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYETS+LP+ + T+A EAGL WFELECVSSDKEC+GKP I+YVTVFERPGL 
Sbjct  259  CAYETSSLPAHLRTQAIEAGLKWFELECVSSDKECEGKPNISYVTVFERPGLQ  311


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +3

Query  123  DVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPEFKPL  302
             VY PR   +W A++NWL FF QI +QI RGTPSL Q+LSY+G R+   L S    F+PL
Sbjct  5    QVYVPRPLQVWRAVVNWLGFFLQIFLQIFRGTPSLPQLLSYIGLRH-PLLPSSASSFRPL  63



>ref|XP_007141764.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
 gb|ESW13758.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
Length=303

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
             + P+ +LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GKPKI
Sbjct  89   ADRPIQKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGKPKI  148

Query  600  NYVTVFERPGL  632
            NYVTVFERPGL
Sbjct  149  NYVTVFERPGL  159



>ref|XP_006655392.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=279

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 96/164 (59%), Gaps = 34/164 (21%)
 Frame = +3

Query  162  LLNWLCFFFQILVQIVRGTPSL-TQVLSYLGFRN-----SSFLSSPPPEFKPLRTvelse  323
            ++ WL F  QIL+QIVRGTPS   Q+LS+LG R+     S    SP   F  L +   ++
Sbjct  1    VVGWLAFLLQILLQIVRGTPSSWAQLLSFLGIRHPLLSTSQAQPSPSGAFVQLPSEAPAD  60

Query  324  fpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLP  503
               P   P                            L RLTVVLDLDETLVCAYE+S+LP
Sbjct  61   ASAPPPPP----------------------------LKRLTVVLDLDETLVCAYESSSLP  92

Query  504  SIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            + +  EA EAGL+ F++EC+S++K+ +G+ ++N+VTVFERPGLH
Sbjct  93   AALRAEAIEAGLHCFDMECISAEKDAEGRQRVNHVTVFERPGLH  136



>ref|XP_003600913.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES71164.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=276

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 92/176 (52%), Gaps = 48/176 (27%)
 Frame = +3

Query  126  VYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPE-----  290
            +Y+P +   W A+L+W  FF+QI  QI+                  SF  + P       
Sbjct  1    MYSPITQQAWKAVLSWFGFFYQIFSQII-----------------GSFADNYPLLSLSSN  43

Query  291  --FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldld  464
              FKPL +++                          A   +   D + P  +LTVVLDLD
Sbjct  44   SSFKPLSSLDHES-----------------------AVQIIEDADHQQP-QKLTVVLDLD  79

Query  465  etlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            ETL+CAYETS++   + T+AT+AGLNWFELECV  +KE DG+P INYVTVFERPGL
Sbjct  80   ETLICAYETSSVSDELKTQATQAGLNWFELECVFDNKEADGEPIINYVTVFERPGL  135



>gb|KHN20843.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=306

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +3

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
             +HP+P+LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GK KI
Sbjct  93   ADHPVPKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGK-KI  151

Query  600  NYVTVFERPGL  632
            NYVTVFERPGL
Sbjct  152  NYVTVFERPGL  162



>ref|XP_003545230.1| PREDICTED: LOW QUALITY PROTEIN: carboxy-terminal domain RNA polymerase 
II polypeptide A small phosphatase 2-like [Glycine 
max]
Length=393

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +3

Query  420  GEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKI  599
             +HP+P+LTVVLDLDETLVCAYETS+LP+ + T+A E GLNWFELECVS DKE +GK KI
Sbjct  180  ADHPVPKLTVVLDLDETLVCAYETSSLPAALRTQAIEGGLNWFELECVSIDKEGEGK-KI  238

Query  600  NYVTVFERPGL  632
            NYVTVFERPGL
Sbjct  239  NYVTVFERPGL  249



>ref|XP_009385548.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=313

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 95/168 (57%), Gaps = 29/168 (17%)
 Frame = +3

Query  138  RSPHLWGALLNWLCFFFQILVQIVR-GTPSLTQVLSYLGFRNSSF-LSSPPPEFKPLRTv  311
            R+   W  +L WL F F++L+QI++ GTPS  Q+LS++G R+     SS  P F PL T 
Sbjct  19   RTAQAWRTVLGWLGFLFRVLLQILQSGTPSWAQLLSFVGVRHRLLPASSSDPAFHPLPTD  78

Query  312  elsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYET  491
                 P      P                           L +LTVVLDLDETLV AYE 
Sbjct  79   APPPPPPQLRQDP---------------------------LDKLTVVLDLDETLVSAYEA  111

Query  492  STLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            S++P ++ ++A EAG+  FELEC+S DKE +GK K+N+VTVFERPGL 
Sbjct  112  SSVPIVVRSQAIEAGVKCFELECISMDKEVEGKQKVNHVTVFERPGLQ  159



>ref|XP_008793248.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Phoenix dactylifera]
Length=303

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 108/185 (58%), Gaps = 33/185 (18%)
 Frame = +3

Query  99   MADMAQAA--DVYAP-----RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR  257
            M ++A++A   +Y+P      S  +W  +++W  F   IL+QI+RGTPS  Q LS++ F 
Sbjct  1    MEELARSAPAAMYSPGGGAASSLPVWRTVVSWAGFLLHILLQILRGTPSWAQFLSFVPFL  60

Query  258  NSSFLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLP  437
            +SS  SSP   F+PL     ++ P P                             + P  
Sbjct  61   SSSSSSSP--AFRPLPVEAPADTPLPPPTV------------------------SDIPSD  94

Query  438  RltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVF  617
            +LTVVLDLDETLVCAYE+S LPS++  +A EAGL  FELEC+S +K+ +GK K+N+VTVF
Sbjct  95   KLTVVLDLDETLVCAYESSCLPSLVRDQAIEAGLKCFELECISVEKDAEGKQKVNHVTVF  154

Query  618  ERPGL  632
            ERPGL
Sbjct  155  ERPGL  159



>ref|XP_002528087.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34266.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYET +LP+ I T A +AGL WFELEC++SDKEC+GK KINYVTVFERPGL 
Sbjct  84   CAYETCSLPASIHTRAIQAGLKWFELECITSDKECEGKTKINYVTVFERPGLR  136



>dbj|BAK00193.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 96/184 (52%), Gaps = 35/184 (19%)
 Frame = +3

Query  108  MAQAADVYAP------RSPHLWGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSS  266
            MA A +VY+P      R    W A++ WL    Q+L++ +RGTPS L ++L  LG R+  
Sbjct  1    MAAATEVYSPMPAAQHRGQAAWRAVVGWLGLLLQVLLRAIRGTPSSLAKLLRSLGLRHPL  60

Query  267  FLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC-DGEHPLPRl  443
              ++P   F  L +   S+  +                      GR+    D +  L   
Sbjct  61   LSAAPAVAFVQLPSKAPSDSDDLPPLS--------------PPPGRLTVVLDLDETL---  103

Query  444  tvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFER  623
                      VCAYE+S+LP+ + T+A EAGL+ F++EC+SSDK+  G+ ++N+VTVFER
Sbjct  104  ----------VCAYESSSLPATVRTQAVEAGLHCFDMECISSDKDAKGRQRVNHVTVFER  153

Query  624  PGLH  635
            PGLH
Sbjct  154  PGLH  157



>gb|EAY98360.1| hypothetical protein OsI_20271 [Oryza sativa Indica Group]
Length=326

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 92/171 (54%), Gaps = 28/171 (16%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSSFLSSPPPEFKPLRTvelsefp  329
            W A++ WL F  QIL+QIVRGTPS    +LS+LG R+            PL +    +  
Sbjct  31   WRAVVGWLGFLLQILLQIVRGTPSSWAHLLSFLGLRH------------PLLSAAPPQPS  78

Query  330  epeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPSI  509
                                 A    +      PL RLTVVLDLDETLVCAYE+S+LP+ 
Sbjct  79   PSPSPSVAFVRLPSE------APADASSTGPPPPLRRLTVVLDLDETLVCAYESSSLPAA  132

Query  510  ITTEATEAGLNWFELECVSSD---------KECDGKPKINYVTVFERPGLH  635
            +  EA EAGL+ FE+EC+S++         K+ +G  ++N VTVFERPGLH
Sbjct  133  LRAEAVEAGLHCFEMECISAEKASCIFLDIKDAEGSQRVNRVTVFERPGLH  183



>ref|XP_004500494.1| PREDICTED: probable C-terminal domain small phosphatase-like 
[Cicer arietinum]
Length=275

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  402  RVAGCDGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKEC  581
            ++       PL +LTVVLDLDETLVCAYET  LP  + T+AT+AGLNWFELECV SDK  
Sbjct  58   QITSHADHRPLQKLTVVLDLDETLVCAYETPGLPETLRTQATQAGLNWFELECVCSDKLV  117

Query  582  DGKPKINYVTVFERPGL  632
            +GKP INYVTVFERPGL
Sbjct  118  EGKPIINYVTVFERPGL  134



>ref|XP_004961795.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=300

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 91/161 (57%), Gaps = 36/161 (22%)
 Frame = +3

Query  171  WLCFFFQILVQIVRGTPSL-TQVLSYLGFRN----SSFLSSPPPEFKPLRTvelsefpep  335
            WL   FQIL++IVRGTPS   Q+LS++G R+     +  + P PE   ++          
Sbjct  27   WLGLLFQILLRIVRGTPSSWAQLLSFVGLRHPLLPVAAQAQPSPEVAFVQLPSE------  80

Query  336  eeapplppppsvavqplpIAKGRVAGCDGEHP-LPRltvvldldetlvCAYETSTLPSII  512
                                    A  D   P L RLTVVLDLDETLV AYE+S+LP+ +
Sbjct  81   ------------------------APADASPPPLRRLTVVLDLDETLVSAYESSSLPATL  116

Query  513  TTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
             T+A EAGL  F++EC S++K+ +G+ ++N VTVFERPGLH
Sbjct  117  RTQAVEAGLRCFDMECTSAEKDAEGRQRVNRVTVFERPGLH  157



>ref|XP_010231274.1| PREDICTED: uncharacterized protein LOC100829084 [Brachypodium 
distachyon]
Length=268

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 90/166 (54%), Gaps = 30/166 (18%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVR-GTPSLTQVLSYLGFRNSSFLSSPPPEFKPLRTvelsefp  329
            W  +  WL F  QIL+Q  R  + S+ ++LS+LG R     ++P   F  L +       
Sbjct  13   WQVMAVWLGFLLQILLQAFRRSSSSVARLLSFLGLRRPLLSAAPAVTFVQLPSEAP----  68

Query  330  epeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPSI  509
                                 A           PL RLTVVLDLDETLVCAYE+S+LP+ 
Sbjct  69   ---------------------ADELPPPPPPYPPLGRLTVVLDLDETLVCAYESSSLPAT  107

Query  510  ITTEATEAGLNWFELECVSSDK----ECDGKPKINYVTVFERPGLH  635
            +  +A EAGL+ F++EC+SSDK    + DG+ ++N+VTVFERPGLH
Sbjct  108  VHAQAIEAGLHCFDMECISSDKASRRDADGRRRVNHVTVFERPGLH  153



>ref|XP_002323581.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
 gb|EEF05342.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
Length=292

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 18/161 (11%)
 Frame = +3

Query  165  LNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPEFK-----PLRTvelsefp  329
            +NWL F  ++ +Q++ GTP     LSY+ F      SS   +       PLR     +  
Sbjct  1    MNWLRFITKLFLQVLIGTPQF--FLSYICFAFPLLSSSSSFKPLPIVEIPLRETTSKKIT  58

Query  330  epeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPSI  509
            +        P                +G   + P  +LTVVLDLDETLVCAYETS+LP I
Sbjct  59   DTAHDSTCVPDDVSN-----------SGASDDSPTEKLTVVLDLDETLVCAYETSSLPPI  107

Query  510  ITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGL  632
            I T A EAG+  FELEC SS+K+ +GKP+IN+VTVFERPGL
Sbjct  108  IRTRAVEAGVKCFELECFSSEKDVEGKPEINHVTVFERPGL  148



>ref|XP_008656381.1| PREDICTED: uncharacterized protein LOC103635784 isoform X2 [Zea 
mays]
Length=172

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 35/180 (19%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M+   + A V  P  P   G L   L   FQIL++I+R   S  Q+LS++  R+     +
Sbjct  1    MSAATEVAPVQQPSHPAAAGWL--GLGLLFQILLRIIRS--SWAQLLSFVRLRHRLLPVT  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHP-LPRltvvl  455
              PE   ++                                  A  D   P L RL VVL
Sbjct  57   ASPELAFVQLPPE------------------------------APADASPPPLRRLMVVL  86

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYE+S+LPS + T A EAGL+ F++ECV S+K+ +G+ +IN VTVFERPGLH
Sbjct  87   DLDETLVCAYESSSLPSTMRTHAVEAGLHRFDMECVLSEKDTEGRQRINRVTVFERPGLH  146



>ref|XP_008656380.1| PREDICTED: probable phosphatase PSR2 isoform X1 [Zea mays]
Length=194

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 35/180 (19%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M+   + A V  P  P   G L   L   FQIL++I+R   S  Q+LS++  R+     +
Sbjct  1    MSAATEVAPVQQPSHPAAAGWL--GLGLLFQILLRIIRS--SWAQLLSFVRLRHRLLPVT  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHP-LPRltvvl  455
              PE   ++                                  A  D   P L RL VVL
Sbjct  57   ASPELAFVQLPPE------------------------------APADASPPPLRRLMVVL  86

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYE+S+LPS + T A EAGL+ F++ECV S+K+ +G+ +IN VTVFERPGLH
Sbjct  87   DLDETLVCAYESSSLPSTMRTHAVEAGLHRFDMECVLSEKDTEGRQRINRVTVFERPGLH  146



>gb|AFW82276.1| hypothetical protein ZEAMMB73_719646 [Zea mays]
Length=190

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 93/180 (52%), Gaps = 35/180 (19%)
 Frame = +3

Query  99   MADMAQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSS  278
            M+   + A V  P  P   G L   L   FQIL++I+R   S  Q+LS++  R+     +
Sbjct  1    MSAATEVAPVQQPSHPAAAGWL--GLGLLFQILLRIIRS--SWAQLLSFVRLRHRLLPVT  56

Query  279  PPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHP-LPRltvvl  455
              PE   ++                                  A  D   P L RL VVL
Sbjct  57   ASPELAFVQLPPE------------------------------APADASPPPLRRLMVVL  86

Query  456  dldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            DLDETLVCAYE+S+LPS + T A EAGL+ F++ECV S+K+ +G+ +IN VTVFERPGLH
Sbjct  87   DLDETLVCAYESSSLPSTMRTHAVEAGLHRFDMECVLSEKDTEGRQRINRVTVFERPGLH  146



>ref|XP_008351210.1| PREDICTED: uncharacterized protein LOC103414622 [Malus domestica]
Length=161

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 90/158 (57%), Gaps = 26/158 (16%)
 Frame = +3

Query  111  AQAADVYAPRSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFRNSSFLSSPPPE  290
            A AA+VY P +   W  ++NW+ FF+QI++QI+RG P L  +LS +   +S       P 
Sbjct  7    AAAAEVYVPMTLQAWR-VVNWVGFFYQIILQILRGAPCLPHLLSCISSSSS-------PA  58

Query  291  FKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldet  470
            F+PL   E+        A               +  G + G     P+ +LTVVLDLDET
Sbjct  59   FRPLPVAEVPLNDLSSSAH--------------VENGVLDG----RPVEKLTVVLDLDET  100

Query  471  lvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECD  584
            LVCAYET ++P+I+   ATEAG+ WFE+EC+SS+K  D
Sbjct  101  LVCAYETCSVPAIVRARATEAGMKWFEMECLSSEKVVD  138



>gb|KCW65681.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=252

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  411  GCDGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGK  590
            G +    L RLTVVLDLDETLVCAYE ++LP+     A E+GL WF+LEC+SS+K+ +GK
Sbjct  72   GVESPEDLERLTVVLDLDETLVCAYEMASLPAATRDRAVESGLEWFDLECISSEKDSEGK  131

Query  591  PKINYVTVFERPGLH  635
            PK+N VTVFERPGL 
Sbjct  132  PKVNLVTVFERPGLQ  146



>gb|EMS66920.1| CTD small phosphatase-like protein 2 [Triticum urartu]
Length=232

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  480  AYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            AYE+S LP I+ T+A EAGL+ F++EC+S+DK+ +GK K+N+VTVFERPGLH
Sbjct  38   AYESSGLPPIVRTQAVEAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLH  89



>ref|XP_010067527.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW65680.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=289

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  411  GCDGEHPLPRltvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGK  590
            G +    L RLTVVLDLDETLVCAYE ++LP+     A E+GL WF+LEC+SS+K+ +GK
Sbjct  72   GVESPEDLERLTVVLDLDETLVCAYEMASLPAATRDRAVESGLEWFDLECISSEKDSEGK  131

Query  591  PKINYVTVFERPGLH  635
            PK+N VTVFERPGL 
Sbjct  132  PKVNLVTVFERPGLQ  146



>ref|XP_010920860.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Elaeis guineensis]
Length=303

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAYE+S+LPS++  +A EAGL  FELEC+S +K+ +GK K+N+VTVFERPGL 
Sbjct  108  CAYESSSLPSLVRDQAIEAGLECFELECISVEKDAEGKQKVNHVTVFERPGLR  160



>gb|AAT58765.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
 gb|AAT58787.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
Length=278

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 82/158 (52%), Gaps = 19/158 (12%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSSFLSSPPPEFKPLRTvelsefp  329
            W A++ WL F  QIL+QIVRGTPS    +LS+LG R+            PL +    +  
Sbjct  31   WRAVVGWLGFLLQILLQIVRGTPSSWAHLLSFLGLRH------------PLLSAAPPQPS  78

Query  330  epeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPSI  509
                                 A    +      PL RLTVVLDLDETLVCAYE+S+LP+ 
Sbjct  79   PSPSPSVAFVRLPSE------APADASSTGPPPPLRRLTVVLDLDETLVCAYESSSLPAA  132

Query  510  ITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFER  623
            +  EA EAGL+ F++EC+S++K    KP ++ +    R
Sbjct  133  LRAEAVEAGLHCFDMECISAEKARYAKPLVDRIDAHNR  170



>gb|EEE64021.1| hypothetical protein OsJ_18850 [Oryza sativa Japonica Group]
Length=326

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 94/171 (55%), Gaps = 28/171 (16%)
 Frame = +3

Query  153  WGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSSFLSSPPPEFKPLRTvelsefp  329
            W A++ WL F  +   +IVRG PS     LS+LG R+  FLS+                 
Sbjct  31   WRAVVGWLGFLSRSCSRIVRGKPSSWGDFLSFLGLRHP-FLSA-----------------  72

Query  330  epeeapplppppsvavqplpIAKGRVAGCDGEHPLPRltvvldldetlvCAYETSTLPSI  509
             P +  P P P    V+    A    +      PL RLTVVLDLDETLVCAYE+S+LP+ 
Sbjct  73   APPQPSPSPSPSVAFVRLPSEAPADASSTGPPPPLRRLTVVLDLDETLVCAYESSSLPAA  132

Query  510  ITTEATEAGLNWFELECVSSD---------KECDGKPKINYVTVFERPGLH  635
            +  EA EAGL+ F++EC+S++         K+ +G  ++N VTVFERPGLH
Sbjct  133  LRAEAVEAGLHCFDMECISAEKAICIFLDIKDAEGSQRVNRVTVFERPGLH  183



>gb|EMT12311.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=350

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 97/207 (47%), Gaps = 60/207 (29%)
 Frame = +3

Query  108  MAQAADVYAP--RSPH----LWGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSS  266
            MA A +VY+P   +PH     W A++ WL    Q+L++++RG PS L ++L  LG R+  
Sbjct  1    MAAATEVYSPTPAAPHREQAAWWAVVGWLGLLLQVLLRVIRGAPSSLAKLLRSLGLRHPL  60

Query  267  FLSSPPPEFKPLRTvelsefpepeeapplppppsvavqplpIAKGRVAGC-DGEHPLPRl  443
              ++P   F  L +   ++   P                     GR+    D +  L   
Sbjct  61   LSAAPAVAFVQLPSKAPADDLPPLS----------------PPPGRLTVVLDLDETL---  101

Query  444  tvvldldetlvCAYETSTLPSIITTEATEAGLNWFELECVSSD-----------------  572
                      VCAYE+S+LP+ + T+A EAGL+ F++E +SSD                 
Sbjct  102  ----------VCAYESSSLPATVRTQAVEAGLHCFDMEGISSDKASMWPSFPPFPMILLL  151

Query  573  ------KECDGKPKINYVTVFERPGLH  635
                  K+  G+ ++N+VTVFERPGLH
Sbjct  152  SSHFLKKDAKGRQRVNHVTVFERPGLH  178



>ref|XP_002990146.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
 gb|EFJ08706.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
Length=206

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAY+++ LP  + + A   G+ WF+LEC+++DK+ +G  KIN V V+ERPGL 
Sbjct  11   CAYDSAGLPPGLHSRAVNTGMTWFQLECLAADKDKEGNVKINCVMVYERPGLR  63



>ref|XP_010095242.1| hypothetical protein L484_008252 [Morus notabilis]
 gb|EXB59010.1| hypothetical protein L484_008252 [Morus notabilis]
Length=127

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = +3

Query  99   MADMAQAADVYAPRSP--HLWGALLNWLCFFFQILVQIVRGTPS-LTQVLSYLGFRNSS  266
            MA+ A A+DVYAPRS    LW A+ NW  FFF+IL+QI+RGTPS L  +LS+LG  + +
Sbjct  1    MAEQA-ASDVYAPRSSVQQLWRAVANWFGFFFEILLQILRGTPSCLPHLLSFLGLTHQN  58



>ref|XP_002992543.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
 gb|EFJ06481.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
Length=206

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  477  CAYETSTLPSIITTEATEAGLNWFELECVSSDKECDGKPKINYVTVFERPGLH  635
            CAY+++ LP  + + A   G+ WF+LEC+++DK+ +G  KIN V V+ERPGL 
Sbjct  11   CAYDSAGLPPGLHSRAVNTGMTWFQLECLAADKDKEGNVKINCVMVYERPGLR  63



>tpg|DAA56990.1| TPA: hypothetical protein ZEAMMB73_478385 [Zea mays]
Length=171

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  552  LECVSSDKECDGKPKINYVTVFERPGLH  635
            +EC+SSDK+ +GK K+N+VTVFERPGLH
Sbjct  1    MECISSDKDAEGKQKVNHVTVFERPGLH  28



>tpg|DAA56989.1| TPA: hypothetical protein ZEAMMB73_478385 [Zea mays]
Length=119

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 18/82 (22%)
 Frame = +3

Query  117  AADVYAP------------RSPHLWGALLNWLCFFFQILVQIVRGTPSLTQVLSYLGFR-  257
            AA+VY+P             +   W  ++ W+ F  Q+L+QI+RGTPS  Q+LS++G R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  258  ---NSSFLSSPPPE--FKPLRT  308
               +    S+P PE  F PLR+
Sbjct  63   PLLSGPTASNPSPEVAFMPLRS  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500