BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020N13

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03970.1|  unnamed protein product                                338   1e-110   Coffea canephora [robusta coffee]
ref|XP_002321240.1|  serine carboxypeptidase S10 family protein         338   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_011009329.1|  PREDICTED: serine carboxypeptidase-like 20         338   2e-110   Populus euphratica
gb|KDP45241.1|  hypothetical protein JCGZ_15106                         336   8e-110   Jatropha curcas
gb|KDO58564.1|  hypothetical protein CISIN_1g010880mg                   332   2e-109   Citrus sinensis [apfelsine]
gb|KDO58563.1|  hypothetical protein CISIN_1g010880mg                   333   8e-109   Citrus sinensis [apfelsine]
ref|XP_006447984.1|  hypothetical protein CICLE_v10014996mg             333   1e-108   
gb|KDO58562.1|  hypothetical protein CISIN_1g010880mg                   333   3e-108   Citrus sinensis [apfelsine]
ref|XP_006447985.1|  hypothetical protein CICLE_v10014996mg             333   3e-108   Citrus clementina [clementine]
ref|XP_007199794.1|  hypothetical protein PRUPE_ppa004538mg             332   5e-108   Prunus persica
ref|XP_002527263.1|  serine carboxypeptidase, putative                  332   7e-108   Ricinus communis
ref|XP_006352654.1|  PREDICTED: serine carboxypeptidase-like 20-like    330   2e-107   Solanum tuberosum [potatoes]
ref|XP_004510209.1|  PREDICTED: serine carboxypeptidase-like 20-like    330   3e-107   Cicer arietinum [garbanzo]
gb|EYU40664.1|  hypothetical protein MIMGU_mgv1a004824mg                330   5e-107   Erythranthe guttata [common monkey flower]
gb|KEH18097.1|  serine carboxypeptidase-like protein                    328   7e-107   Medicago truncatula
ref|XP_009358971.1|  PREDICTED: serine carboxypeptidase-like 20 i...    328   8e-107   Pyrus x bretschneideri [bai li]
ref|XP_003626861.1|  Serine carboxypeptidase-like protein               328   1e-106   Medicago truncatula
ref|XP_004290128.1|  PREDICTED: serine carboxypeptidase-like 20         328   1e-106   Fragaria vesca subsp. vesca
ref|XP_004242437.1|  PREDICTED: serine carboxypeptidase-like 20         327   3e-106   Solanum lycopersicum
ref|XP_008235895.1|  PREDICTED: serine carboxypeptidase-like 20         327   4e-106   Prunus mume [ume]
ref|XP_006366825.1|  PREDICTED: serine carboxypeptidase-like 20-like    324   7e-105   Solanum tuberosum [potatoes]
ref|XP_011089617.1|  PREDICTED: serine carboxypeptidase 1               323   9e-105   Sesamum indicum [beniseed]
ref|XP_008365929.1|  PREDICTED: serine carboxypeptidase-like 20         323   9e-105   
ref|XP_009785823.1|  PREDICTED: serine carboxypeptidase-like 20         323   2e-104   Nicotiana sylvestris
ref|XP_010678976.1|  PREDICTED: serine carboxypeptidase-like 20         323   2e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003547759.1|  PREDICTED: serine carboxypeptidase-like 20-l...    322   2e-104   
ref|XP_010095610.1|  Serine carboxypeptidase-like 20                    322   4e-104   Morus notabilis
ref|XP_010245947.1|  PREDICTED: serine carboxypeptidase 1               322   4e-104   Nelumbo nucifera [Indian lotus]
ref|XP_002264454.2|  PREDICTED: serine carboxypeptidase 1               321   8e-104   Vitis vinifera
ref|XP_009334243.1|  PREDICTED: serine carboxypeptidase-like 20         320   1e-103   Pyrus x bretschneideri [bai li]
ref|XP_007049588.1|  Serine carboxypeptidase-like 20 isoform 2          318   3e-103   
ref|XP_006366827.1|  PREDICTED: serine carboxypeptidase-like 20-like    319   5e-103   Solanum tuberosum [potatoes]
gb|KCW57984.1|  hypothetical protein EUGRSUZ_H00716                     319   5e-103   Eucalyptus grandis [rose gum]
gb|KCW57985.1|  hypothetical protein EUGRSUZ_H00716                     319   6e-103   Eucalyptus grandis [rose gum]
ref|XP_010069589.1|  PREDICTED: serine carboxypeptidase-like 20         319   6e-103   Eucalyptus grandis [rose gum]
gb|KCW57986.1|  hypothetical protein EUGRSUZ_H00716                     319   6e-103   Eucalyptus grandis [rose gum]
gb|KCW57982.1|  hypothetical protein EUGRSUZ_H00716                     319   6e-103   Eucalyptus grandis [rose gum]
ref|XP_007049587.1|  Serine carboxypeptidase-like 20 isoform 1          318   1e-102   
emb|CAN64572.1|  hypothetical protein VITISV_010382                     317   1e-102   Vitis vinifera
ref|NP_001234691.1|  wound-inducible carboxypeptidase precursor         317   2e-102   
ref|XP_010323102.1|  PREDICTED: serine carboxypeptidase-like 20         317   3e-102   Solanum lycopersicum
gb|KCW57981.1|  hypothetical protein EUGRSUZ_H00716                     317   4e-102   Eucalyptus grandis [rose gum]
gb|KJB42611.1|  hypothetical protein B456_007G160000                    313   4e-102   Gossypium raimondii
ref|XP_009626166.1|  PREDICTED: serine carboxypeptidase-like 20         317   4e-102   Nicotiana tomentosiformis
ref|XP_007134260.1|  hypothetical protein PHAVU_010G032200g             317   4e-102   Phaseolus vulgaris [French bean]
gb|KCW57980.1|  hypothetical protein EUGRSUZ_H00716                     317   5e-102   Eucalyptus grandis [rose gum]
emb|CBI35583.3|  unnamed protein product                                315   9e-102   Vitis vinifera
ref|XP_004242440.1|  PREDICTED: serine carboxypeptidase-like 20         315   1e-101   Solanum lycopersicum
ref|XP_010069585.1|  PREDICTED: serine carboxypeptidase-like 20         313   8e-101   Eucalyptus grandis [rose gum]
gb|KJB42610.1|  hypothetical protein B456_007G160000                    313   9e-101   Gossypium raimondii
gb|KHG18698.1|  Serine carboxypeptidase-like 20                         313   1e-100   Gossypium arboreum [tree cotton]
ref|XP_006366830.1|  PREDICTED: serine carboxypeptidase-like 20-like    311   4e-100   Solanum tuberosum [potatoes]
ref|XP_004960778.1|  PREDICTED: serine carboxypeptidase 1-like          311   4e-100   Setaria italica
ref|XP_006366826.1|  PREDICTED: serine carboxypeptidase-like 20-like    311   6e-100   Solanum tuberosum [potatoes]
ref|XP_006366824.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    311   6e-100   
ref|XP_010026006.1|  PREDICTED: serine carboxypeptidase-like 20         311   7e-100   Eucalyptus grandis [rose gum]
tpg|DAA55431.1|  TPA: hypothetical protein ZEAMMB73_969275              301   1e-99    
ref|NP_001167902.1|  hypothetical protein precursor                     310   1e-99    Zea mays [maize]
ref|XP_006847478.1|  hypothetical protein AMTR_s00163p00053930          310   3e-99    
ref|XP_003578731.1|  PREDICTED: serine carboxypeptidase 1               308   5e-99    Brachypodium distachyon [annual false brome]
ref|XP_010450258.1|  PREDICTED: serine carboxypeptidase-like 20         301   5e-99    
ref|XP_010907920.1|  PREDICTED: serine carboxypeptidase 1-like          303   2e-98    
ref|XP_002863203.1|  hypothetical protein ARALYDRAFT_333040             305   5e-98    
ref|XP_009416609.1|  PREDICTED: serine carboxypeptidase 1-like          306   5e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC69080.1|  hypothetical protein OsI_37959                          306   9e-98    Oryza sativa Indica Group [Indian rice]
emb|CAB53091.1|  SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein       304   9e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251666.1|  PREDICTED: serine carboxypeptidase-like 20         306   2e-97    Nelumbo nucifera [Indian lotus]
gb|KCW57988.1|  hypothetical protein EUGRSUZ_H00717                     304   2e-97    Eucalyptus grandis [rose gum]
emb|CDY33713.1|  BnaC04g29380D                                          305   2e-97    Brassica napus [oilseed rape]
ref|NP_193027.5|  serine carboxypeptidase-like 20                       305   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAM97031.1|  serine carboxypeptidase 1 precursor-like protein        304   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066510.1|  Os12g0257000                                       305   3e-97    
emb|CDY39716.1|  BnaA04g07190D                                          304   3e-97    Brassica napus [oilseed rape]
ref|XP_009139654.1|  PREDICTED: serine carboxypeptidase-like 20         304   3e-97    Brassica rapa
tpg|DAA55432.1|  TPA: hypothetical protein ZEAMMB73_969275              303   5e-97    
gb|EMT03686.1|  Serine carboxypeptidase 1                               302   6e-97    
gb|KCW58760.1|  hypothetical protein EUGRSUZ_H01397                     294   8e-97    Eucalyptus grandis [rose gum]
ref|XP_008794935.1|  PREDICTED: serine carboxypeptidase 1-like          303   1e-96    Phoenix dactylifera
ref|XP_010435332.1|  PREDICTED: serine carboxypeptidase-like 20         302   1e-96    Camelina sativa [gold-of-pleasure]
ref|NP_001149341.1|  serine carboxypeptidase 1 precursor                303   2e-96    
gb|ACN29329.1|  unknown                                                 303   2e-96    Zea mays [maize]
emb|CDM85928.1|  unnamed protein product                                301   2e-96    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002443027.1|  hypothetical protein SORBIDRAFT_08g006540          300   8e-96    Sorghum bicolor [broomcorn]
ref|XP_004492215.1|  PREDICTED: serine carboxypeptidase-like 20-like    299   2e-95    Cicer arietinum [garbanzo]
gb|KDP26877.1|  hypothetical protein JCGZ_18035                         299   2e-95    Jatropha curcas
prf||1314177A  CPase I A                                                291   2e-95 
ref|XP_010026201.1|  PREDICTED: serine carboxypeptidase-like 20         299   3e-95    
gb|KFK23486.1|  hypothetical protein AALP_AAs46213U000900               298   7e-95    Arabis alpina [alpine rockcress]
ref|XP_008451218.1|  PREDICTED: serine carboxypeptidase-like 20         297   1e-94    Cucumis melo [Oriental melon]
sp|P07519.4|CBP1_HORVU  RecName: Full=Serine carboxypeptidase 1; ...    297   2e-94    Hordeum vulgare [barley]
dbj|BAJ95123.1|  predicted protein                                      297   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010070327.1|  PREDICTED: serine carboxypeptidase-like 20         296   3e-94    Eucalyptus grandis [rose gum]
ref|XP_006283616.1|  hypothetical protein CARUB_v10004672mg             296   3e-94    Capsella rubella
gb|KEH22522.1|  serine carboxypeptidase-like protein                    293   5e-94    Medicago truncatula
ref|XP_004139101.1|  PREDICTED: serine carboxypeptidase 1-like          295   8e-94    Cucumis sativus [cucumbers]
ref|XP_007029292.1|  Serine carboxypeptidase-like 20 isoform 4          291   9e-94    
ref|XP_002443030.1|  hypothetical protein SORBIDRAFT_08g006590          295   1e-93    
gb|KDP26878.1|  hypothetical protein JCGZ_18036                         295   1e-93    Jatropha curcas
gb|ACN40340.1|  unknown                                                 288   2e-93    Picea sitchensis
ref|XP_007029291.1|  Serine carboxypeptidase-like 20 isoform 3          293   2e-93    
ref|XP_004148941.1|  PREDICTED: serine carboxypeptidase-like 20-like    294   2e-93    Cucumis sativus [cucumbers]
ref|XP_010527287.1|  PREDICTED: serine carboxypeptidase-like 20 i...    294   2e-93    Tarenaya hassleriana [spider flower]
gb|KCW58763.1|  hypothetical protein EUGRSUZ_H01399                     293   3e-93    Eucalyptus grandis [rose gum]
ref|XP_010068275.1|  PREDICTED: serine carboxypeptidase-like 20         299   3e-93    
gb|EPS74136.1|  hypothetical protein M569_00619                         293   4e-93    Genlisea aurea
ref|XP_010070157.1|  PREDICTED: serine carboxypeptidase 1-like          293   7e-93    Eucalyptus grandis [rose gum]
ref|XP_007029290.1|  Serine carboxypeptidase-like 20 isoform 2          292   9e-93    
ref|XP_004492244.1|  PREDICTED: serine carboxypeptidase-like 20-like    292   1e-92    
gb|AES78951.2|  serine carboxypeptidase-like protein                    292   1e-92    Medicago truncatula
ref|XP_003622733.1|  Serine carboxypeptidase-like protein               292   1e-92    
ref|XP_010527288.1|  PREDICTED: serine carboxypeptidase-like 20         292   1e-92    Tarenaya hassleriana [spider flower]
gb|KCW58765.1|  hypothetical protein EUGRSUZ_H01401                     282   2e-92    Eucalyptus grandis [rose gum]
gb|KHG03245.1|  Serine carboxypeptidase 1                               291   2e-92    Gossypium arboreum [tree cotton]
ref|XP_010520851.1|  PREDICTED: serine carboxypeptidase-like 20 i...    293   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_011013064.1|  PREDICTED: serine carboxypeptidase-like 20 i...    291   2e-92    Populus euphratica
ref|XP_010649231.1|  PREDICTED: serine carboxypeptidase-like 20 i...    291   2e-92    Vitis vinifera
ref|XP_007029289.1|  Serine carboxypeptidase-like 20 isoform 1          291   2e-92    
ref|XP_004515043.1|  PREDICTED: serine carboxypeptidase-like 20-like    291   4e-92    Cicer arietinum [garbanzo]
emb|CBI17614.3|  unnamed protein product                                292   4e-92    Vitis vinifera
gb|KHN29264.1|  Serine carboxypeptidase-like 20                         290   8e-92    Glycine soja [wild soybean]
ref|XP_010527284.1|  PREDICTED: serine carboxypeptidase-like 20 i...    290   1e-91    Tarenaya hassleriana [spider flower]
gb|KJB26857.1|  hypothetical protein B456_004G263400                    290   1e-91    Gossypium raimondii
ref|XP_010026283.1|  PREDICTED: serine carboxypeptidase-like 20         293   2e-91    
ref|XP_010520852.1|  PREDICTED: serine carboxypeptidase-like 20 i...    289   3e-91    Tarenaya hassleriana [spider flower]
ref|XP_003622732.1|  Serine carboxypeptidase-like protein               291   4e-91    
ref|XP_010649230.1|  PREDICTED: serine carboxypeptidase-like 20         288   4e-91    Vitis vinifera
gb|KHN40479.1|  Serine carboxypeptidase-like 20                         288   5e-91    Glycine soja [wild soybean]
gb|EEE53029.1|  hypothetical protein OsJ_35748                          288   6e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003534508.1|  PREDICTED: serine carboxypeptidase-like 20-like    288   6e-91    Glycine max [soybeans]
ref|XP_003552449.1|  PREDICTED: serine carboxypeptidase-like 20-l...    288   6e-91    Glycine max [soybeans]
gb|KEH23401.1|  serine carboxypeptidase-like protein                    286   8e-91    Medicago truncatula
ref|XP_002514835.1|  serine carboxypeptidase, putative                  287   1e-90    Ricinus communis
ref|XP_008388814.1|  PREDICTED: serine carboxypeptidase-like 20         287   2e-90    
ref|XP_003624187.1|  Serine carboxypeptidase-like protein               286   2e-90    Medicago truncatula
ref|XP_010026202.1|  PREDICTED: serine carboxypeptidase 1-like          277   3e-90    
gb|AGV54426.1|  serine carboxypeptidase-like protein                    286   3e-90    Phaseolus vulgaris [French bean]
ref|XP_008443685.1|  PREDICTED: serine carboxypeptidase 1-like is...    286   4e-90    Cucumis melo [Oriental melon]
ref|XP_007139719.1|  hypothetical protein PHAVU_008G053600g             286   4e-90    Phaseolus vulgaris [French bean]
ref|XP_010527286.1|  PREDICTED: serine carboxypeptidase-like 20 i...    286   4e-90    Tarenaya hassleriana [spider flower]
ref|XP_001770944.1|  predicted protein                                  285   6e-90    
ref|XP_004302166.1|  PREDICTED: serine carboxypeptidase-like 20         286   6e-90    Fragaria vesca subsp. vesca
ref|XP_004492844.1|  PREDICTED: serine carboxypeptidase-like 20-like    285   6e-90    Cicer arietinum [garbanzo]
ref|XP_011077160.1|  PREDICTED: serine carboxypeptidase-like 20         285   7e-90    Sesamum indicum [beniseed]
ref|XP_008370931.1|  PREDICTED: serine carboxypeptidase-like 20         285   1e-89    
ref|XP_008218456.1|  PREDICTED: serine carboxypeptidase-like 20         285   1e-89    Prunus mume [ume]
gb|EYU39461.1|  hypothetical protein MIMGU_mgv1a005253mg                284   2e-89    Erythranthe guttata [common monkey flower]
emb|CBI17613.3|  unnamed protein product                                283   2e-89    Vitis vinifera
ref|XP_006428612.1|  hypothetical protein CICLE_v10013875mg             284   3e-89    
gb|KCW63276.1|  hypothetical protein EUGRSUZ_G00904                     283   4e-89    Eucalyptus grandis [rose gum]
ref|XP_007205172.1|  hypothetical protein PRUPE_ppa005545mg             282   4e-89    
gb|AFW58028.1|  hypothetical protein ZEAMMB73_889629                    280   4e-89    
ref|XP_006480515.1|  PREDICTED: serine carboxypeptidase-like 20-like    284   5e-89    Citrus sinensis [apfelsine]
ref|XP_010070328.1|  PREDICTED: serine carboxypeptidase-like 21         283   5e-89    
ref|XP_009340398.1|  PREDICTED: serine carboxypeptidase-like 20         283   6e-89    Pyrus x bretschneideri [bai li]
ref|XP_002447646.1|  hypothetical protein SORBIDRAFT_06g011100          282   8e-89    Sorghum bicolor [broomcorn]
emb|CDP04191.1|  unnamed protein product                                274   1e-88    Coffea canephora [robusta coffee]
sp|Q9LSV8.2|SCP21_ARATH  RecName: Full=Serine carboxypeptidase-li...    282   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189169.1|  serine carboxypeptidase-like 21                       282   2e-88    
ref|XP_010673905.1|  PREDICTED: serine carboxypeptidase-like 20         281   3e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006296649.1|  hypothetical protein CARUB_v10015503mg             271   4e-88    
gb|KCW58999.1|  hypothetical protein EUGRSUZ_H01627                     280   4e-88    Eucalyptus grandis [rose gum]
ref|XP_009340341.1|  PREDICTED: serine carboxypeptidase-like 20         280   4e-88    
ref|XP_004975273.1|  PREDICTED: serine carboxypeptidase 1-like is...    280   6e-88    Setaria italica
ref|NP_001052464.1|  Os04g0321700                                       280   9e-88    
ref|XP_010042090.1|  PREDICTED: serine carboxypeptidase 1-like          279   1e-87    Eucalyptus grandis [rose gum]
ref|XP_008663135.1|  PREDICTED: serine carboxypeptidase 1-like          279   2e-87    Zea mays [maize]
ref|XP_002514833.1|  serine carboxypeptidase, putative                  278   6e-87    
ref|XP_010111090.1|  Serine carboxypeptidase-like 20                    276   2e-86    Morus notabilis
dbj|BAB01313.1|  serine carboxypeptidase I                              276   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557747.1|  PREDICTED: serine carboxypeptidase-like 20         276   3e-86    Tarenaya hassleriana [spider flower]
ref|XP_004975271.1|  PREDICTED: serine carboxypeptidase 1-like          275   9e-86    Setaria italica
emb|CDY27895.1|  BnaA07g04850D                                          273   2e-85    Brassica napus [oilseed rape]
emb|CDY00837.1|  BnaCnng00370D                                          273   4e-85    
gb|ABR17809.1|  unknown                                                 272   8e-85    Picea sitchensis
ref|XP_010649232.1|  PREDICTED: serine carboxypeptidase-like 20 i...    271   1e-84    
ref|XP_010466953.1|  PREDICTED: serine carboxypeptidase-like 21 i...    272   1e-84    
ref|XP_002883604.1|  hypothetical protein ARALYDRAFT_480041             272   2e-84    
ref|XP_002325905.2|  hypothetical protein POPTR_0019s08160g             271   2e-84    
ref|XP_009102414.1|  PREDICTED: serine carboxypeptidase-like 21         271   2e-84    Brassica rapa
ref|XP_010466955.1|  PREDICTED: serine carboxypeptidase-like 21 i...    270   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010466954.1|  PREDICTED: serine carboxypeptidase-like 21 i...    270   4e-84    Camelina sativa [gold-of-pleasure]
emb|CDP04193.1|  unnamed protein product                                268   2e-83    Coffea canephora [robusta coffee]
ref|XP_010514125.1|  PREDICTED: serine carboxypeptidase-like 21         267   9e-83    
gb|KFK39840.1|  hypothetical protein AALP_AA3G294800                    265   3e-82    Arabis alpina [alpine rockcress]
gb|KFK39839.1|  hypothetical protein AALP_AA3G294800                    264   5e-82    Arabis alpina [alpine rockcress]
ref|XP_004975272.1|  PREDICTED: serine carboxypeptidase 1-like is...    264   2e-81    
gb|EMS48673.1|  Serine carboxypeptidase 1                               262   1e-80    Triticum urartu
gb|KFK36172.1|  hypothetical protein AALP_AA4G087600                    264   5e-79    Arabis alpina [alpine rockcress]
ref|XP_006418631.1|  hypothetical protein EUTSA_v10002940mg             254   7e-78    
gb|KCW63274.1|  hypothetical protein EUGRSUZ_G00901                     248   1e-75    Eucalyptus grandis [rose gum]
ref|XP_006414997.1|  hypothetical protein EUTSA_v10027269mg             235   2e-74    
gb|ABR16352.1|  unknown                                                 241   1e-72    Picea sitchensis
ref|XP_002514836.1|  serine carboxypeptidase, putative                  238   5e-72    
ref|XP_008366890.1|  PREDICTED: serine carboxypeptidase-like 20         227   2e-71    
ref|XP_010520849.1|  PREDICTED: serine carboxypeptidase-like 20         225   1e-70    Tarenaya hassleriana [spider flower]
ref|XP_002514834.1|  serine carboxypeptidase, putative                  226   2e-67    
ref|XP_006840207.1|  hypothetical protein AMTR_s00089p00129670          221   6e-67    
gb|KFK23485.1|  hypothetical protein AALP_AAs46213U000800               224   9e-67    Arabis alpina [alpine rockcress]
ref|XP_002958371.1|  hypothetical protein VOLCADRAFT_108101             226   2e-66    Volvox carteri f. nagariensis
ref|XP_001703566.1|  predicted protein                                  223   6e-66    Chlamydomonas reinhardtii
gb|AAA32940.1|  carboxypeptidase I precursor                            213   5e-63    Hordeum vulgare [barley]
ref|XP_010943621.1|  PREDICTED: serine carboxypeptidase 1               208   1e-61    
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          212   1e-61    
ref|XP_006840227.1|  hypothetical protein AMTR_s00089p00168750          208   3e-60    Amborella trichopoda
gb|KCW58761.1|  hypothetical protein EUGRSUZ_H01398                     206   5e-60    Eucalyptus grandis [rose gum]
gb|AFW71417.1|  hypothetical protein ZEAMMB73_152983                    199   8e-59    
gb|KDD76124.1|  serine carboxypeptidase                                 199   5e-58    Helicosporidium sp. ATCC 50920
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         202   7e-58    Vitis vinifera
emb|CBI22424.3|  unnamed protein product                                202   8e-58    Vitis vinifera
emb|CAN74923.1|  hypothetical protein VITISV_038590                     202   9e-58    Vitis vinifera
ref|XP_008777952.1|  PREDICTED: serine carboxypeptidase-like 18 i...    194   1e-57    
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         205   3e-57    
gb|AFW71416.1|  hypothetical protein ZEAMMB73_152983                    199   5e-57    
ref|NP_001132320.1|  uncharacterized protein LOC100193762 precursor     199   6e-57    Zea mays [maize]
ref|XP_008443686.1|  PREDICTED: serine carboxypeptidase 1-like is...    197   1e-56    
ref|XP_010936153.1|  PREDICTED: serine carboxypeptidase-like 18 i...    197   2e-56    
ref|XP_008777951.1|  PREDICTED: serine carboxypeptidase-like 18 i...    191   2e-56    Phoenix dactylifera
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    197   2e-56    
emb|CCW28854.1|  putative serine carboxypeptidase                       197   3e-56    Arachis duranensis
ref|XP_004952450.1|  PREDICTED: serine carboxypeptidase 1-like          197   3e-56    Setaria italica
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    197   4e-56    
gb|ACG26067.1|  hypothetical protein                                    197   4e-56    Zea mays [maize]
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         196   5e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939018.1|  PREDICTED: serine carboxypeptidase-like 18 i...    194   8e-56    
ref|XP_002604286.1|  hypothetical protein BRAFLDRAFT_88575              195   1e-55    Branchiostoma floridae
ref|XP_008799202.1|  PREDICTED: serine carboxypeptidase 1               194   3e-55    Phoenix dactylifera
tpg|DAA39922.1|  TPA: hypothetical protein ZEAMMB73_827985              190   3e-55    
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          194   4e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006648620.1|  PREDICTED: serine carboxypeptidase 1-like          189   4e-55    
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         194   6e-55    Elaeis guineensis
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           193   7e-55    
ref|XP_011457835.1|  PREDICTED: serine carboxypeptidase-like 7          193   8e-55    Fragaria vesca subsp. vesca
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    194   9e-55    Elaeis guineensis
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    193   1e-54    Setaria italica
ref|XP_005646632.1|  peptidase S10, serine carboxypeptidase             192   2e-54    Coccomyxa subellipsoidea C-169
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         192   2e-54    Jatropha curcas
ref|XP_010939014.1|  PREDICTED: serine carboxypeptidase-like 17 i...    191   3e-54    Elaeis guineensis
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    191   4e-54    Elaeis guineensis
ref|XP_010040883.1|  PREDICTED: serine carboxypeptidase-like 18         190   4e-54    
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    191   5e-54    Elaeis guineensis
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             191   5e-54    
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             191   6e-54    Citrus clementina [clementine]
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    191   8e-54    Elaeis guineensis
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    196   1e-53    
gb|KJB58678.1|  hypothetical protein B456_009G221000                    188   1e-53    Gossypium raimondii
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         190   1e-53    Eucalyptus grandis [rose gum]
dbj|BAD19824.1|  putative carboxypeptidase C precursor                  186   2e-53    Oryza sativa Japonica Group [Japonica rice]
gb|AAX92980.1|  Serine carboxypeptidase                                 183   2e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011399295.1|  Serine carboxypeptidase 1                          189   2e-53    Auxenochlorella protothecoides
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                189   2e-53    Zea mays [maize]
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    189   3e-53    
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          189   3e-53    
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         190   3e-53    
ref|XP_002453781.1|  hypothetical protein SORBIDRAFT_04g017170          189   3e-53    
gb|KJB58677.1|  hypothetical protein B456_009G221000                    188   4e-53    Gossypium raimondii
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    189   4e-53    Citrus sinensis [apfelsine]
dbj|BAJ85895.1|  predicted protein                                      188   4e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         188   4e-53    Prunus mume [ume]
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    188   5e-53    Citrus sinensis [apfelsine]
ref|XP_002534183.1|  serine carboxypeptidase, putative                  185   5e-53    
gb|KJB48748.1|  hypothetical protein B456_008G084200                    188   5e-53    Gossypium raimondii
ref|XP_002525293.1|  serine carboxypeptidase, putative                  191   6e-53    
gb|KJB48749.1|  hypothetical protein B456_008G084200                    188   6e-53    Gossypium raimondii
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          188   7e-53    Vitis vinifera
ref|XP_006651780.1|  PREDICTED: serine carboxypeptidase-like 18-like    187   8e-53    Oryza brachyantha
emb|CBI22419.3|  unnamed protein product                                187   9e-53    Vitis vinifera
gb|KCW63576.1|  hypothetical protein EUGRSUZ_G01200                     187   1e-52    Eucalyptus grandis [rose gum]
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     187   1e-52    Eucalyptus grandis [rose gum]
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    188   1e-52    Setaria italica
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    192   1e-52    
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          187   1e-52    Sesamum indicum [beniseed]
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         187   2e-52    Vitis vinifera
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          187   2e-52    
emb|CDP20368.1|  unnamed protein product                                186   2e-52    Coffea canephora [robusta coffee]
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         187   2e-52    Eucalyptus grandis [rose gum]
gb|EEC73124.1|  hypothetical protein OsI_07134                          187   2e-52    Oryza sativa Indica Group [Indian rice]
gb|KCW63574.1|  hypothetical protein EUGRSUZ_G01198                     186   2e-52    Eucalyptus grandis [rose gum]
gb|KCW55082.1|  hypothetical protein EUGRSUZ_I01044                     185   2e-52    Eucalyptus grandis [rose gum]
ref|XP_010065864.1|  PREDICTED: serine carboxypeptidase-like 2 is...    187   3e-52    Eucalyptus grandis [rose gum]
gb|KCW63573.1|  hypothetical protein EUGRSUZ_G01198                     186   3e-52    
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         186   3e-52    
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     186   3e-52    
gb|EMT22602.1|  Serine carboxypeptidase-like 18                         186   3e-52    
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    186   3e-52    
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    186   3e-52    
dbj|BAJ86585.1|  predicted protein                                      186   4e-52    
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    186   4e-52    
dbj|BAJ96525.1|  predicted protein                                      186   4e-52    
gb|AFW58396.1|  hypothetical protein ZEAMMB73_738600                    184   4e-52    
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     186   5e-52    
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    186   5e-52    
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         185   5e-52    
emb|CBI22421.3|  unnamed protein product                                188   6e-52    
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    184   6e-52    
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         186   7e-52    
gb|EMT11231.1|  Serine carboxypeptidase 1                               176   7e-52    
ref|XP_003604934.1|  Serine carboxypeptidase-like protein               181   8e-52    
gb|EEE52039.1|  hypothetical protein OsJ_33766                          182   8e-52    
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             185   8e-52    
ref|NP_001136845.1|  uncharacterized protein LOC100216996 precursor     184   9e-52    
ref|XP_011458874.1|  PREDICTED: serine carboxypeptidase-like 18 i...    185   9e-52    
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             185   1e-51    
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    185   1e-51    
ref|XP_002522137.1|  serine carboxypeptidase, putative                  185   1e-51    
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         185   1e-51    
gb|EEE56946.1|  hypothetical protein OsJ_06651                          185   1e-51    
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    184   1e-51    
ref|XP_011006039.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    181   1e-51    
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         184   1e-51    
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         184   1e-51    
ref|XP_006664470.1|  PREDICTED: serine carboxypeptidase 1-like          183   2e-51    
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    184   2e-51    
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    184   2e-51    
emb|CBI22420.3|  unnamed protein product                                185   2e-51    
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    183   2e-51    
ref|XP_011030311.1|  PREDICTED: serine carboxypeptidase-like 18 i...    184   2e-51    
gb|ABG22466.1|  Serine carboxypeptidase family protein, expressed       182   2e-51    
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         184   2e-51    
gb|ACG36102.1|  serine carboxypeptidase 1 precursor                     183   3e-51    
ref|XP_011030309.1|  PREDICTED: serine carboxypeptidase-like 18 i...    183   3e-51    
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    184   3e-51    
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         184   3e-51    
gb|KDO81469.1|  hypothetical protein CISIN_1g012276mg                   181   3e-51    
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         184   3e-51    
gb|KDP35358.1|  hypothetical protein JCGZ_10342                         184   3e-51    
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         182   4e-51    
ref|XP_006350186.1|  PREDICTED: serine carboxypeptidase-like 18-l...    181   4e-51    
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     183   5e-51    
emb|CDM81579.1|  unnamed protein product                                187   5e-51    
ref|XP_008661498.1|  PREDICTED: uncharacterized protein LOC100216...    183   5e-51    
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     186   5e-51    
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    183   5e-51    
ref|XP_010028343.1|  PREDICTED: serine carboxypeptidase-like 18 i...    182   5e-51    
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    183   6e-51    
gb|ABG22468.1|  Serine carboxypeptidase family protein, expressed       182   6e-51    
ref|XP_003604930.1|  Serine carboxypeptidase family protein             188   6e-51    
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          183   6e-51    
ref|XP_010030617.1|  PREDICTED: serine carboxypeptidase-like 18         182   6e-51    
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    183   7e-51    
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    182   7e-51    
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                182   7e-51    
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                182   8e-51    
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    183   8e-51    
gb|KDO81473.1|  hypothetical protein CISIN_1g012205mg                   181   8e-51    
ref|XP_002131445.1|  PREDICTED: serine carboxypeptidase 24              182   9e-51    
ref|XP_008644915.1|  PREDICTED: serine carboxypeptidase-like 2 is...    183   9e-51    
ref|NP_001067796.1|  Os11g0432900                                       182   9e-51    
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         182   1e-50    
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          182   1e-50    
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    182   1e-50    
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   182   1e-50    
gb|EEE52047.1|  hypothetical protein OsJ_33777                          182   1e-50    
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         181   1e-50    
ref|XP_004342336.1|  carboxypeptidase                                   182   1e-50    
gb|KCW63578.1|  hypothetical protein EUGRSUZ_G01202                     181   1e-50    
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    182   1e-50    
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       182   1e-50    
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    182   1e-50    
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     181   1e-50    
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    182   2e-50    
ref|XP_010498752.1|  PREDICTED: serine carboxypeptidase-like 16         181   2e-50    
gb|EEC68083.1|  hypothetical protein OsI_35951                          179   2e-50    
gb|EEC68090.1|  hypothetical protein OsI_35963                          183   2e-50    
gb|EPS73196.1|  hypothetical protein M569_01551                         181   2e-50    
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          182   2e-50    
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    181   2e-50    
ref|XP_002510077.1|  serine carboxypeptidase, putative                  181   3e-50    
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    181   3e-50    
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             180   3e-50    
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         181   3e-50    
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   180   3e-50    
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         180   4e-50    
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    181   4e-50    
ref|XP_006299292.1|  hypothetical protein CARUB_v10015451mg             180   4e-50    
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             180   4e-50    
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    181   4e-50    
ref|XP_010234607.1|  PREDICTED: serine carboxypeptidase-like 3 is...    180   4e-50    
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             180   4e-50    
emb|CBI19380.3|  unnamed protein product                                181   5e-50    
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             180   5e-50    
ref|XP_004334720.1|  serine carboxypeptidase                            180   5e-50    
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   180   5e-50    
ref|XP_004342339.1|  serine carboxypeptidase                            180   6e-50    
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         180   6e-50    
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             180   6e-50    
ref|XP_004979111.1|  PREDICTED: serine carboxypeptidase 1-like is...    171   6e-50    
gb|KCW63567.1|  hypothetical protein EUGRSUZ_G01195                     179   6e-50    
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             180   6e-50    
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    180   7e-50    
ref|XP_003573745.1|  PREDICTED: serine carboxypeptidase-like 17 i...    180   7e-50    
gb|EMS55666.1|  Serine carboxypeptidase-like 19                         181   7e-50    
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         180   7e-50    
gb|ACN30985.1|  unknown                                                 180   8e-50    
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   180   8e-50    
ref|XP_002522135.1|  serine carboxypeptidase, putative                  180   1e-49    
gb|ABF98689.1|  Serine carboxypeptidase family protein, expressed       178   1e-49    
ref|XP_004965775.1|  PREDICTED: serine carboxypeptidase 1-like is...    171   1e-49    
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             179   1e-49    
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             179   1e-49    
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    180   1e-49    
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    179   1e-49    
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          179   1e-49    
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         179   1e-49    
gb|KJB73513.1|  hypothetical protein B456_011G236800                    176   2e-49    
gb|EEE52038.1|  hypothetical protein OsJ_33764                          176   2e-49    
emb|CDY68040.1|  BnaAnng25990D                                          178   2e-49    
ref|XP_009771130.1|  PREDICTED: serine carboxypeptidase-like 13 i...    177   2e-49    
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    179   2e-49    
gb|KCW55074.1|  hypothetical protein EUGRSUZ_I01040                     178   2e-49    
ref|XP_010464978.1|  PREDICTED: serine carboxypeptidase-like 14         178   2e-49    
emb|CDX77573.1|  BnaA07g07110D                                          177   3e-49    
gb|AAD01264.1|  glucose acyltransferase                                 178   3e-49    
ref|XP_007018464.1|  Serine carboxypeptidase-like 2, putative           177   3e-49    
gb|AAM64902.1|  serine carboxypeptidase, putative                       172   4e-49    
ref|XP_006369726.1|  hypothetical protein POPTR_0001s29910g             175   4e-49    
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         178   4e-49    
ref|XP_004955871.1|  PREDICTED: serine carboxypeptidase 1-like is...    169   5e-49    
ref|XP_010028344.1|  PREDICTED: serine carboxypeptidase-like 7          178   5e-49    
gb|EAY80766.1|  hypothetical protein OsI_35944                          174   5e-49    
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18         178   5e-49    
ref|XP_007201024.1|  hypothetical protein PRUPE_ppa006101mg             177   5e-49    
gb|KDP35359.1|  hypothetical protein JCGZ_10343                         171   5e-49    
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    177   6e-49    
gb|EMS49740.1|  Serine carboxypeptidase-like 19                         178   6e-49    
gb|KCW55073.1|  hypothetical protein EUGRSUZ_I01040                     177   7e-49    
gb|EEC68084.1|  hypothetical protein OsI_35952                          177   7e-49    
ref|XP_006663394.1|  PREDICTED: serine carboxypeptidase-like 18-like    177   7e-49    
ref|XP_006297707.1|  hypothetical protein CARUB_v10013735mg             177   7e-49    
gb|EMS58697.1|  Serine carboxypeptidase-like 18                         181   7e-49    
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             177   9e-49    
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    177   9e-49    
ref|XP_011466208.1|  PREDICTED: serine carboxypeptidase-like 18 i...    177   9e-49    
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             176   9e-49    
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    176   9e-49    
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         177   1e-48    
gb|KJB73514.1|  hypothetical protein B456_011G236800                    176   1e-48    
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             176   1e-48    
ref|XP_011016537.1|  PREDICTED: serine carboxypeptidase 1-like is...    175   1e-48    
ref|XP_011016540.1|  PREDICTED: serine carboxypeptidase 1-like is...    175   1e-48    
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          177   1e-48    
gb|AAX96497.1|  At2g22990/T20K9.20                                      172   1e-48    
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    177   1e-48    
gb|ABA93261.2|  Serine carboxypeptidase family protein, expressed       172   2e-48    
ref|XP_003577668.1|  PREDICTED: serine carboxypeptidase-like 19         176   2e-48    
ref|XP_003604933.1|  Serine carboxypeptidase                            176   2e-48    
ref|XP_007201023.1|  hypothetical protein PRUPE_ppa005420mg             176   2e-48    
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             176   2e-48    
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    176   2e-48    
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    176   2e-48    
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    176   2e-48    
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         176   2e-48    
gb|KJB73511.1|  hypothetical protein B456_011G236800                    176   2e-48    
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          176   2e-48    
ref|XP_008236281.1|  PREDICTED: serine carboxypeptidase-like 17 i...    176   2e-48    
ref|XP_006651779.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    177   2e-48    
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         176   2e-48    
gb|KJB73512.1|  hypothetical protein B456_011G236800                    176   3e-48    
ref|NP_187828.1|  serine carboxypeptidase-like 17                       175   3e-48    
emb|CDP02851.1|  unnamed protein product                                176   3e-48    
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          176   3e-48    
ref|XP_004306039.2|  PREDICTED: serine carboxypeptidase-like 16 i...    171   3e-48    
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         176   3e-48    
ref|XP_011466202.1|  PREDICTED: serine carboxypeptidase-like 2 is...    176   4e-48    
ref|NP_001047778.1|  Os02g0687900                                       175   4e-48    
ref|XP_004289772.1|  PREDICTED: serine carboxypeptidase-like 18         176   4e-48    
ref|NP_187656.1|  serine carboxypeptidase-like 7                        174   5e-48    
gb|AAF64227.1|AF248647_1  glucose acyltransferase                       175   5e-48    
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    174   5e-48    
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    175   5e-48    
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    180   6e-48    
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    175   6e-48    
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         175   6e-48    
ref|XP_002522133.1|  serine carboxypeptidase, putative                  175   6e-48    
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         174   6e-48    
emb|CDY52617.1|  BnaCnng22960D                                          179   6e-48    
ref|XP_006353976.1|  PREDICTED: serine carboxypeptidase-like 18-like    175   7e-48    
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    173   7e-48    
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         174   7e-48    
emb|CDY08603.1|  BnaA05g28390D                                          174   7e-48    
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          174   8e-48    
emb|CDY02322.1|  BnaA09g25800D                                          174   8e-48    
gb|EMS50425.1|  Serine carboxypeptidase-like 17                         177   9e-48    
emb|CDX73832.1|  BnaA03g32150D                                          174   9e-48    
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          174   9e-48    
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     174   9e-48    
emb|CDX83199.1|  BnaA03g23070D                                          168   1e-47    
ref|XP_006651778.1|  PREDICTED: serine carboxypeptidase-like 18-like    175   1e-47    
ref|XP_010028338.1|  PREDICTED: serine carboxypeptidase-like 13         174   1e-47    
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    174   1e-47    
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         174   1e-47    
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    174   1e-47    
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         175   1e-47    
gb|EEE57601.1|  hypothetical protein OsJ_07974                          174   1e-47    
ref|XP_004141409.1|  PREDICTED: serine carboxypeptidase-like 1-like     174   1e-47    
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    178   1e-47    
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    174   1e-47    
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         174   1e-47    
gb|KGN55284.1|  hypothetical protein Csa_4G644120                       174   1e-47    
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    178   1e-47    
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             174   1e-47    



>emb|CDP03970.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L L+C ++  ++ T+SAP+ AL+T IPGFNGTLPSKHYAGYVT+DE+ G+KL+YYFV SE
Sbjct  13   LLLICVVVSFVR-TQSAPETALITSIPGFNGTLPSKHYAGYVTVDESCGRKLYYYFVVSE  71

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            RNPS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE GKT  SLPTLHLNPYSW+KV+NI+Y
Sbjct  72   RNPSQDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTPDSLPTLHLNPYSWSKVSNIVY  131

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP+GVG SYS NE+DYITGDLKTASDSHTFL KWFELY EFL NPF+I GESYAGVYV
Sbjct  132  LDSPAGVGFSYSGNESDYITGDLKTASDSHTFLFKWFELYPEFLSNPFYIVGESYAGVYV  191

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTLSYEV +GID  VKPVLNF
Sbjct  192  PTLSYEVAKGIDEGVKPVLNF  212



>ref|XP_002321240.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE99555.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=495

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +2

Query  59   VKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKL  238
            +    P+   + C LL  + LT SAP+ ALVT++PGF+GT PSKHY+GYVTIDE+ GK+L
Sbjct  1    MAKSCPILYRIFCMLLSFVLLTHSAPETALVTQLPGFSGTFPSKHYSGYVTIDESQGKRL  60

Query  239  FYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSW  418
            FYYFVESERNP KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  +T G LP LHLNPYSW
Sbjct  61   FYYFVESERNPPKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAETKGDLPKLHLNPYSW  120

Query  419  TKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAG  598
            +KV++++YLDSP+GVGLSYS NETDYITGD KTASDSH FLLKWFELY EFL NPFFI+G
Sbjct  121  SKVSSVLYLDSPAGVGLSYSKNETDYITGDTKTASDSHAFLLKWFELYPEFLSNPFFISG  180

Query  599  ESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            ESYAG+YVPTL+YEVV+G+DA VKP+LNF
Sbjct  181  ESYAGIYVPTLAYEVVKGLDAGVKPILNF  209



>ref|XP_011009329.1| PREDICTED: serine carboxypeptidase-like 20 [Populus euphratica]
Length=495

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K G P+   + C LL  + LT SAP+ ALVT++PGF+GT PSKHY+GYVTIDE+ GK+
Sbjct  1    MAKLG-PILYRIFCMLLSFVLLTHSAPETALVTQLPGFSGTFPSKHYSGYVTIDESQGKR  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFVESERNP KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  +T G LP LHLNPYS
Sbjct  60   LFYYFVESERNPPKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAETKGDLPKLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV++++YLDSP+GVGLSYS NETDYITGD +TASDSH FLLKWFELY EFL NPFFI+
Sbjct  120  WSKVSSVLYLDSPAGVGLSYSKNETDYITGDTRTASDSHAFLLKWFELYPEFLSNPFFIS  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTL+YEVV+G+DA VKP+LNF
Sbjct  180  GESYAGIYVPTLAYEVVKGLDAGVKPILNF  209



>gb|KDP45241.1| hypothetical protein JCGZ_15106 [Jatropha curcas]
Length=492

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            +C L+    L   AP  +L+T+IPGFNGTLPSKHY+GYVTIDE+ GKKLFYYFVESE NP
Sbjct  9    LCLLVSFFLLAHCAPQSSLITQIPGFNGTLPSKHYSGYVTIDESHGKKLFYYFVESEGNP  68

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K  G LPTLHLNPYSW+KV+NI+YLDS
Sbjct  69   SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKAHGDLPTLHLNPYSWSKVSNILYLDS  128

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P+GVGLSYS N++DYITGD+KT+ DSHTFLLKWFE+Y EFLPNPFFI+GESYAGVYVPTL
Sbjct  129  PAGVGLSYSKNKSDYITGDVKTSLDSHTFLLKWFEIYPEFLPNPFFISGESYAGVYVPTL  188

Query  632  SYEVVQGIDAAVKPVLNF  685
            SYEVV+G+DA VKP LNF
Sbjct  189  SYEVVKGMDAGVKPTLNF  206



>gb|KDO58564.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=399

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCF-LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K  L ++  L C+ LL    LT SAP+ AL+ +IPGF+G LPSKHY+GYVT+DE+ G+
Sbjct  1    MGKGRLIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGR  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYFVESE NPSKDPVVLWLNGGPGCSSFDGF+YEHGPFNFE   T GSLP LH+NPY
Sbjct  61   NLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SWTKV++IIYLDSP+GVGLSYS+N+TDY+TGDLKTASD+HTFLLKWFELY EFL NPFFI
Sbjct  121  SWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGESYAG+YVPTL+YEV++GIDA  KPVLNF
Sbjct  181  AGESYAGIYVPTLAYEVMKGIDAGEKPVLNF  211



>gb|KDO58563.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=463

 Score =   333 bits (853),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCF-LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K  L ++  L C+ LL    LT SAP+ AL+ +IPGF+G LPSKHY+GYVT+DE+ G+
Sbjct  1    MGKGRLIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGR  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYFVESE NPSKDPVVLWLNGGPGCSSFDGF+YEHGPFNFE   T GSLP LH+NPY
Sbjct  61   NLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SWTKV++IIYLDSP+GVGLSYS+N+TDY+TGDLKTASD+HTFLLKWFELY EFL NPFFI
Sbjct  121  SWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGESYAG+YVPTL+YEV++GIDA  KPVLNF
Sbjct  181  AGESYAGIYVPTLAYEVMKGIDAGEKPVLNF  211



>ref|XP_006447984.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 gb|ESR61224.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
Length=486

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCF-LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K  L ++  L C+ LL    LT SAP+ AL+ +IPGF+G LPSKHY+GYVT+DE+ G+
Sbjct  1    MGKGRLIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGR  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYFVESE NPSKDPVVLWLNGGPGCSSFDGF+YEHGPFNFE   T GSLP LH+NPY
Sbjct  61   NLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SWTKV++IIYLDSP+GVGLSYS+N+TDY+TGDLKTASD+HTFLLKWFELY EFL NPFFI
Sbjct  121  SWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGESYAG+YVPTL+YEV++GIDA  KPVLNF
Sbjct  181  AGESYAGIYVPTLAYEVMKGIDAGEKPVLNF  211



>gb|KDO58562.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=498

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCF-LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K  L ++  L C+ LL    LT SAP+ AL+ +IPGF+G LPSKHY+GYVT+DE+ G+
Sbjct  1    MGKGRLIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGR  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYFVESE NPSKDPVVLWLNGGPGCSSFDGF+YEHGPFNFE   T GSLP LH+NPY
Sbjct  61   NLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SWTKV++IIYLDSP+GVGLSYS+N+TDY+TGDLKTASD+HTFLLKWFELY EFL NPFFI
Sbjct  121  SWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGESYAG+YVPTL+YEV++GIDA  KPVLNF
Sbjct  181  AGESYAGIYVPTLAYEVMKGIDAGEKPVLNF  211



>ref|XP_006447985.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 ref|XP_006492224.1| PREDICTED: serine carboxypeptidase-like 20-like [Citrus sinensis]
 gb|ESR61225.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 gb|KDO58561.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=497

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCF-LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K  L ++  L C+ LL    LT SAP+ AL+ +IPGF+G LPSKHY+GYVT+DE+ G+
Sbjct  1    MGKGRLIMYKILACYTLLSFSVLTHSAPETALIAQIPGFSGNLPSKHYSGYVTVDESHGR  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYFVESE NPSKDPVVLWLNGGPGCSSFDGF+YEHGPFNFE   T GSLP LH+NPY
Sbjct  61   NLFYYFVESEGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAPTTKGSLPKLHVNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SWTKV++IIYLDSP+GVGLSYS+N+TDY+TGDLKTASD+HTFLLKWFELY EFL NPFFI
Sbjct  121  SWTKVSSIIYLDSPAGVGLSYSENKTDYVTGDLKTASDTHTFLLKWFELYPEFLANPFFI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGESYAG+YVPTL+YEV++GIDA  KPVLNF
Sbjct  181  AGESYAGIYVPTLAYEVMKGIDAGEKPVLNF  211



>ref|XP_007199794.1| hypothetical protein PRUPE_ppa004538mg [Prunus persica]
 gb|EMJ00993.1| hypothetical protein PRUPE_ppa004538mg [Prunus persica]
Length=504

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 181/205 (88%), Gaps = 1/205 (0%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
            L L L+L+   L  L   +SAP  AL+T+IPGF+GTLPSKHY+GYVTID++ G+ LFYYF
Sbjct  14   LYLLLSLIYVFLSFLP-AQSAPQSALITQIPGFSGTLPSKHYSGYVTIDQSHGRNLFYYF  72

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
            +ESER PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT GSLP LHLNPYSW+KV+
Sbjct  73   IESERKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTKGSLPQLHLNPYSWSKVS  132

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYA  610
            NIIYLDSP+GVG SYS+N+TDY TGDLKTASDSHTFLLKWFELY E+L NPFFI+GESYA
Sbjct  133  NIIYLDSPAGVGFSYSENKTDYYTGDLKTASDSHTFLLKWFELYPEYLSNPFFISGESYA  192

Query  611  GVYVPTLSYEVVQGIDAAVKPVLNF  685
            GVYVPTLS EVV+GIDAAVKP+LNF
Sbjct  193  GVYVPTLSSEVVKGIDAAVKPILNF  217



>ref|XP_002527263.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF35107.1| serine carboxypeptidase, putative [Ricinus communis]
Length=498

 Score =   332 bits (850),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  86   TLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESER  265
             + CFL   + +T SAP  ALV  IPGF+G LPSKHY+GYVTIDE+ GKKLFYYFVESE 
Sbjct  13   CIACFLFSFVLITHSAPQDALVIEIPGFSGALPSKHYSGYVTIDESHGKKLFYYFVESEG  72

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            NPS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE    S  LP LHLNPYSW+KV+NI+YL
Sbjct  73   NPSQDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAANASADLPKLHLNPYSWSKVSNILYL  132

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVGLSYS N TDYITGD+KTA DSHTFLLKWFELY EFL NPFFIAGESYAGVYVP
Sbjct  133  DSPAGVGLSYSKNTTDYITGDIKTALDSHTFLLKWFELYPEFLSNPFFIAGESYAGVYVP  192

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL+YEV++GIDA+VKP+LN 
Sbjct  193  TLAYEVMKGIDASVKPILNL  212



>ref|XP_006352654.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=498

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 2/212 (1%)
 Frame = +2

Query  56   MVKNGLPLH--LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            M K    LH  + LV FL+ L  +T+ AP  ALVT++PGFNGT  SKHYAGYV IDE+ G
Sbjct  1    MAKKNFVLHYNILLVSFLIFLFLVTEGAPQSALVTQLPGFNGTFHSKHYAGYVNIDESHG  60

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            K L+YYF+ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GK SGSLP+LH NP
Sbjct  61   KNLYYYFIESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFDFGKPSGSLPSLHNNP  120

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+NIIYLDSP GVGLSYS N++DY+TGDLKTASDSH+FLLKWFE+Y EFL NPF+
Sbjct  121  YSWSKVSNIIYLDSPVGVGLSYSGNKSDYVTGDLKTASDSHSFLLKWFEIYPEFLTNPFY  180

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            I+GESYAG+YVPTL+ EVV+GIDA VKP +NF
Sbjct  181  ISGESYAGIYVPTLASEVVKGIDAGVKPAINF  212



>ref|XP_004510209.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=495

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 182/210 (87%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K G  + L L+   L +L +T SAP+ A+VT+IPGFNGT+PSKHYAGYVT+DE+ G+ 
Sbjct  1    MNKVGSTICLILLHIYLSIL-VTNSAPETAIVTQIPGFNGTIPSKHYAGYVTVDESHGRN  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            L+YYFVESE  PS+DPVVLWLNGGPGCSSFDGF+YEHGPFNFE  KT  SLPTLHLNPYS
Sbjct  60   LYYYFVESEGKPSEDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAAKTKESLPTLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            WTKV++IIYLDSP+GVG SYS+NETDY TGD+KTASD+H FLLKWFELY EFL NPFFIA
Sbjct  120  WTKVSSIIYLDSPAGVGFSYSENETDYQTGDIKTASDTHAFLLKWFELYPEFLANPFFIA  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL+YEV++GIDA VKP LNF
Sbjct  180  GESYAGVYVPTLAYEVLKGIDAGVKPNLNF  209



>gb|EYU40664.1| hypothetical protein MIMGU_mgv1a004824mg [Erythranthe guttata]
Length=508

 Score =   330 bits (845),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = +2

Query  50   LNMVKNGLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETS  226
            + M K  L  +LTL    + L  +   SAP+ ALVT IPGF+G+ PSKH++GYVTIDET 
Sbjct  10   IKMRKIHLFSYLTLFLIQIALSFKKGSSAPEDALVTHIPGFHGSFPSKHHSGYVTIDETY  69

Query  227  GKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLN  406
            GKKLFYYFVESERNP+KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE GK  GSLPTLHLN
Sbjct  70   GKKLFYYFVESERNPNKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAGKPRGSLPTLHLN  129

Query  407  PYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPF  586
            PYSWTKV++IIYLDSP+GVGLSYS NE+DY+TGDLKTA DSH FLLKWFELY EFL NPF
Sbjct  130  PYSWTKVSSIIYLDSPAGVGLSYSRNESDYVTGDLKTAFDSHLFLLKWFELYPEFLSNPF  189

Query  587  FIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +I+GESYAG+YVPTL+YEV  GIDA VKP+LN 
Sbjct  190  YISGESYAGIYVPTLAYEVANGIDAGVKPILNL  222



>gb|KEH18097.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=482

 Score =   328 bits (842),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K    + L L+   L ++ LT SAP+ A+VT++PGFNGT+PSKHYAGYVT+DE+ G+ 
Sbjct  1    MNKTRSTVCLVLLQIYLSIV-LTISAPETAIVTQVPGFNGTIPSKHYAGYVTVDESHGRN  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            L+YYFVESE  PS DPVVLWLNGGPGCSSFDGF+YEHGPFNFE  KT GSLPTLHLNPYS
Sbjct  60   LYYYFVESEGKPSVDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAAKTKGSLPTLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            WTKV++IIYLDSP+GVG SYS NETDYITGD+KTASD+H FLLKWFELY EFL NPFFIA
Sbjct  120  WTKVSSIIYLDSPAGVGFSYSKNETDYITGDIKTASDTHAFLLKWFELYPEFLSNPFFIA  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL+YE ++GIDA VKP LNF
Sbjct  180  GESYAGVYVPTLAYEAMKGIDAGVKPKLNF  209



>ref|XP_009358971.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358972.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Pyrus 
x bretschneideri]
Length=494

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 178/205 (87%), Gaps = 6/205 (3%)
 Frame = +2

Query  89   LVCFLLPLLQL------TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
            L  FL+PL+ +      T+SAP  AL+++IPGF+GTLPSKHY+GYVT+D + G+ LFYYF
Sbjct  6    LSLFLVPLIYIFLSFLPTQSAPQSALISQIPGFSGTLPSKHYSGYVTVDPSHGRNLFYYF  65

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
            VESE  P++DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT GSLP LHLNPYSW+KV+
Sbjct  66   VESEGKPAEDPVVLWLNGGPGCSSFDGFVYEHGPFNFERAKTKGSLPQLHLNPYSWSKVS  125

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYA  610
            NIIYLDSP+GVGLSYS NETDY TGDLKTASDSHTFLLKWFELY EFL NPFFIAGESYA
Sbjct  126  NIIYLDSPAGVGLSYSKNETDYKTGDLKTASDSHTFLLKWFELYPEFLSNPFFIAGESYA  185

Query  611  GVYVPTLSYEVVQGIDAAVKPVLNF  685
            GVYVPTLS EVV+GIDA V PVLNF
Sbjct  186  GVYVPTLSSEVVKGIDAGVTPVLNF  210



>ref|XP_003626861.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AET01337.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK43057.1| unknown [Medicago truncatula]
Length=495

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 180/210 (86%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K    + L L+   L ++ LT SAP+ A+VT++PGFNGT+PSKHYAGYVT+DE+ G+ 
Sbjct  1    MNKTRSTVCLVLLQIYLSIV-LTISAPETAIVTQVPGFNGTIPSKHYAGYVTVDESHGRN  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            L+YYFVESE  PS DPVVLWLNGGPGCSSFDGF+YEHGPFNFE  KT GSLPTLHLNPYS
Sbjct  60   LYYYFVESEGKPSVDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAAKTKGSLPTLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            WTKV++IIYLDSP+GVG SYS NETDYITGD+KTASD+H FLLKWFELY EFL NPFFIA
Sbjct  120  WTKVSSIIYLDSPAGVGFSYSKNETDYITGDIKTASDTHAFLLKWFELYPEFLSNPFFIA  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL+YE ++GIDA VKP LNF
Sbjct  180  GESYAGVYVPTLAYEAMKGIDAGVKPKLNF  209



>ref|XP_004290128.1| PREDICTED: serine carboxypeptidase-like 20 [Fragaria vesca subsp. 
vesca]
Length=496

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K  + +  +L+      L  T+SAP+ AL+T+IPGFNGTLPSKH +GYVTIDE+ G+ 
Sbjct  1    MAKTSITVLYSLLSVTFLSLVPTQSAPEAALITQIPGFNGTLPSKHRSGYVTIDESHGRN  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFVESER PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT G LP LHLNPYS
Sbjct  61   LFYYFVESERKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTKGGLPKLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NI+YLDSP+GVGLSYS N++DYITGDLKTASDSHTFLLKWFELY EFL NPFFI+
Sbjct  121  WSKVSNILYLDSPAGVGLSYSKNKSDYITGDLKTASDSHTFLLKWFELYPEFLSNPFFIS  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL+  VV+GIDA  KP +NF
Sbjct  181  GESYAGVYVPTLASAVVKGIDAGTKPKINF  210



>ref|XP_004242437.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=498

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 181/212 (85%), Gaps = 2/212 (1%)
 Frame = +2

Query  56   MVKNGLPLH--LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            M K  + LH  + L+C L  L  LT+ AP  ALVT++PGFNGT  SKHYAGYV IDE+ G
Sbjct  1    MAKKNIVLHYNILLICLLAFLFLLTEGAPQSALVTQLPGFNGTFNSKHYAGYVNIDESHG  60

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            K L+YYFVESER+PS DPVVLWLNGGPGCSSFDGFVYEHGPFNF+ G+ SGSLP+LH NP
Sbjct  61   KNLYYYFVESERDPSNDPVVLWLNGGPGCSSFDGFVYEHGPFNFDFGEPSGSLPSLHNNP  120

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+NIIYLDSP GVGLSYS+N++DY+TGDLKTASDSH FLLKWFE+Y EFL NPF+
Sbjct  121  YSWSKVSNIIYLDSPVGVGLSYSNNKSDYVTGDLKTASDSHKFLLKWFEIYPEFLMNPFY  180

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            I+GESYAG+YVPTL+ EVV+GIDA VKP +NF
Sbjct  181  ISGESYAGIYVPTLASEVVKGIDAGVKPDINF  212



>ref|XP_008235895.1| PREDICTED: serine carboxypeptidase-like 20 [Prunus mume]
Length=504

 Score =   327 bits (838),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 178/205 (87%), Gaps = 1/205 (0%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
            L L L+L+   L      +SAP  AL+T+IPGF+GTLPSKHY+GYVTID++ G+ LFYYF
Sbjct  14   LYLLLSLIYVFLSFFP-AQSAPQSALITQIPGFSGTLPSKHYSGYVTIDQSHGRNLFYYF  72

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
            +ESER PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT GSLP LH NPYSW+KV+
Sbjct  73   IESERKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTKGSLPQLHFNPYSWSKVS  132

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYA  610
            NIIYLDSP+GVG SYS+N+TDY TGDLKTASDSHTFLLKWFELY E+L NPFFI+GESYA
Sbjct  133  NIIYLDSPAGVGFSYSENKTDYYTGDLKTASDSHTFLLKWFELYPEYLSNPFFISGESYA  192

Query  611  GVYVPTLSYEVVQGIDAAVKPVLNF  685
            G+YVPTLS EVV+GIDA VKP+LNF
Sbjct  193  GIYVPTLSSEVVKGIDAGVKPILNF  217



>ref|XP_006366825.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=499

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 179/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   MVKNGLPLH---LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETS  226
            M +    LH   L +  FL  L  +T+ AP  ALVT+IPGFNGT  SKHYAGYV IDE+ 
Sbjct  1    MARKNFILHCNILLITSFLTFLFLVTEGAPQSALVTQIPGFNGTFHSKHYAGYVNIDESH  60

Query  227  GKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLN  406
            GK L+YYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGK S SLP+LH N
Sbjct  61   GKNLYYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKPSTSLPSLHNN  120

Query  407  PYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPF  586
            PYSW+KV+++IYLDSP GVGLSYS N++DY+TGDLKTA D+H+FLLKWFE+Y EFL NPF
Sbjct  121  PYSWSKVSSVIYLDSPVGVGLSYSKNKSDYVTGDLKTAFDTHSFLLKWFEIYPEFLTNPF  180

Query  587  FIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +I+GESYAG+YVPTLSYEVV+GIDA V P +NF
Sbjct  181  YISGESYAGIYVPTLSYEVVKGIDAGVTPAINF  213



>ref|XP_011089617.1| PREDICTED: serine carboxypeptidase 1 [Sesamum indicum]
Length=498

 Score =   323 bits (829),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 6/208 (3%)
 Frame = +2

Query  80   HLTLVCFLLPLLQLT------KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLF  241
            HL+   F L L+Q+        SAP GA +T +PGF+G LPSKHYAGYVT+DE+ GKKL+
Sbjct  7    HLSYCYFTLILIQIVVSFKPVSSAPQGAFITSLPGFSGNLPSKHYAGYVTVDESHGKKLY  66

Query  242  YYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWT  421
            YYFVESE NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE GK   SLPTLHLNPYSW+
Sbjct  67   YYFVESEGNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAGKPHDSLPTLHLNPYSWS  126

Query  422  KVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGE  601
            KV++IIYLDSPSGVG+SYS N +DY TGDLKTA+DSHTFLLKWFELY EFL NPF+I+GE
Sbjct  127  KVSSIIYLDSPSGVGMSYSGNVSDYETGDLKTAADSHTFLLKWFELYPEFLSNPFYISGE  186

Query  602  SYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            SYAGVYVPTL+YEV QGI A +KP++N 
Sbjct  187  SYAGVYVPTLAYEVAQGISAGIKPIINL  214



>ref|XP_008365929.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=494

 Score =   323 bits (829),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPLLQL--TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLF  241
            G  L+L  V  +   L +  T+SAP  ALV++IPGF+GTLPSKHYAGYVT+D++ G+ LF
Sbjct  3    GRILYLFFVPLIYTFLSILPTQSAPQSALVSQIPGFSGTLPSKHYAGYVTVDQSHGRNLF  62

Query  242  YYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWT  421
            YYFVESE  P++DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT GSL  LHLNPYSW+
Sbjct  63   YYFVESEGKPAEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEKAKTKGSLTQLHLNPYSWS  122

Query  422  KVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGE  601
            KV+NIIYLDSP+GVG SYS NETDY TGDLKTASDSH FLLKWFELY EFL NPFFIAGE
Sbjct  123  KVSNIIYLDSPAGVGFSYSKNETDYETGDLKTASDSHAFLLKWFELYPEFLSNPFFIAGE  182

Query  602  SYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            SYAGVYVPTLS EVV+GIDA V PVLNF
Sbjct  183  SYAGVYVPTLSSEVVKGIDAGVTPVLNF  210



>ref|XP_009785823.1| PREDICTED: serine carboxypeptidase-like 20 [Nicotiana sylvestris]
Length=499

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = +2

Query  62   KNGLPLH--LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            KN   LH  + L+ FL     L +  P+ AL+T+IPGFNGT  SKHYAGYVTIDE+ GKK
Sbjct  4    KNSYFLHYNILLLSFLAFSFLLIEGVPENALITQIPGFNGTFQSKHYAGYVTIDESHGKK  63

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFVESE++P+KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTS SLP LH NPYS
Sbjct  64   LFYYFVESEKDPTKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSESLPILHNNPYS  123

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+++IYLDSP GVG SYS NE+DY TGDLKTASD+H+FLLKWFE+Y EFL NPF+I+
Sbjct  124  WSKVSSVIYLDSPVGVGFSYSGNESDYKTGDLKTASDTHSFLLKWFEIYPEFLKNPFYIS  183

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTLSYEV +GIDA V PV+NF
Sbjct  184  GESYAGIYVPTLSYEVAKGIDAGVMPVINF  213



>ref|XP_010678976.1| PREDICTED: serine carboxypeptidase-like 20 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 4/212 (2%)
 Frame = +2

Query  50   LNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            LN++K   PL L +V F       T+SAP  +LVT++PGF GT PSKHY+GYVTIDE+ G
Sbjct  9    LNLIK--APLMLMVVFFFC--FIFTESAPQSSLVTQLPGFTGTFPSKHYSGYVTIDESHG  64

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            KKLFYYFVESERNPS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT G LP LH+NP
Sbjct  65   KKLFYYFVESERNPSQDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTEGGLPKLHINP  124

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+N+IYLDSP+GVG SYS + +DY TGD+KTA+D+HTFLLKWF++YKEF+ NPFF
Sbjct  125  YSWSKVSNVIYLDSPAGVGYSYSRDTSDYSTGDIKTATDAHTFLLKWFDIYKEFVANPFF  184

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            IAGESYAG+YVPTL+ EVV+G+DA +KPV+N 
Sbjct  185  IAGESYAGIYVPTLASEVVKGLDAGLKPVINL  216



>ref|XP_003547759.1| PREDICTED: serine carboxypeptidase-like 20-like isoformX1 [Glycine 
max]
 ref|XP_006599137.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X2 [Glycine 
max]
 ref|XP_006599138.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X3 [Glycine 
max]
 ref|XP_006599139.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X4 [Glycine 
max]
 gb|KHN04567.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=498

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 178/207 (86%), Gaps = 6/207 (3%)
 Frame = +2

Query  83   LTLVCFLLPLLQL------TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
              ++C  L LL +       +SAP+ A+VT+IPGF+GTLPSKHYAGYVT+D++ G+ L+Y
Sbjct  5    CCVMCLCLILLHIFLRFVPIQSAPESAIVTQIPGFSGTLPSKHYAGYVTVDKSHGRNLYY  64

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESE  PS+DPVVLWLNGGPGCSSFDGF+YEHGPFNFE  KT G LPTLHLNPYSW+K
Sbjct  65   YFVESEGKPSEDPVVLWLNGGPGCSSFDGFIYEHGPFNFEAAKTRGGLPTLHLNPYSWSK  124

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+++IYLDSP+GVG SYS+N+TDYITGD+KTA+DSH FLLKWFELY EFL NPFFIAGES
Sbjct  125  VSSVIYLDSPAGVGFSYSENKTDYITGDIKTATDSHAFLLKWFELYPEFLSNPFFIAGES  184

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            YAGVYVPTL+ EVV+GIDA V+P LNF
Sbjct  185  YAGVYVPTLASEVVKGIDAGVEPKLNF  211



>ref|XP_010095610.1| Serine carboxypeptidase-like 20 [Morus notabilis]
 gb|EXB61183.1| Serine carboxypeptidase-like 20 [Morus notabilis]
Length=499

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  +  L+  L   +SAPD AL+T+IPGF+GT PSKHY+GYVT+D+  G+ LFYYFVESE
Sbjct  13   LVFLACLIKSLVPAQSAPDDALITQIPGFSGTFPSKHYSGYVTVDQNHGRNLFYYFVESE  72

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            R PS+DPVVLWLNGGPGCSSFDGF+YEHGPFNFE  KT GSLP LHLN YSW+KV+NIIY
Sbjct  73   RKPSEDPVVLWLNGGPGCSSFDGFIYEHGPFNFEKAKTKGSLPQLHLNQYSWSKVSNIIY  132

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP+GVG SYS N +DY TGD KTASDSHTFLLKWFELY EFL NPFFIAGES+AGVYV
Sbjct  133  LDSPAGVGCSYSKNHSDYTTGDRKTASDSHTFLLKWFELYPEFLSNPFFIAGESFAGVYV  192

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+YEVV+GIDA  KP++N 
Sbjct  193  PTLTYEVVKGIDAGTKPIINL  213



>ref|XP_010245947.1| PREDICTED: serine carboxypeptidase 1 [Nelumbo nucifera]
Length=494

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 175/210 (83%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M  + + L L LVC  L   +L  +AP+GAL+T +PGF GT PS+HY+GY+TIDE+ GKK
Sbjct  1    MATDKVFLCLVLVCVFL-RFELIGAAPEGALITELPGFEGTFPSQHYSGYITIDESHGKK  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SERN S DPVVLWLNGGPGCSSFDGFVYEHGPFNFE G T  SLP LHLNPYS
Sbjct  60   LFYYFVVSERNASNDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAGSTPTSLPKLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVGLSYS N+TDY TGDLKTASD+HTFLLKWFE Y EFL NPFFIA
Sbjct  120  WSKVSNIIYLDSPAGVGLSYSRNKTDYRTGDLKTASDTHTFLLKWFEQYPEFLSNPFFIA  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL+ EVV+G+    KP+LNF
Sbjct  180  GESYAGVYVPTLASEVVKGMKKGSKPILNF  209



>ref|XP_002264454.2| PREDICTED: serine carboxypeptidase 1 [Vitis vinifera]
Length=495

 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 176/212 (83%), Gaps = 2/212 (1%)
 Frame = +2

Query  50   LNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            + M +     +  L+C L   + LT++AP  ALVT++PGFNGT PSKHY+GYVTIDE  G
Sbjct  1    MGMTRERPMFYWVLICMLFSFV-LTEAAPQTALVTKLPGFNGTFPSKHYSGYVTIDENHG  59

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            KKLFYY V SE NPS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  +T G LP LHLNP
Sbjct  60   KKLFYYMVVSENNPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFE-ARTQGDLPQLHLNP  118

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+K++NIIYLDSP+GVG SYS+N TDY TGDLKTASDSH F+LKWFELY EFL NPF+
Sbjct  119  YSWSKLSNIIYLDSPAGVGFSYSENLTDYRTGDLKTASDSHAFILKWFELYPEFLSNPFY  178

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            IAGESYAGVYVPTL+YEVV+GI   +KP+LNF
Sbjct  179  IAGESYAGVYVPTLAYEVVKGIKGGIKPILNF  210



>ref|XP_009334243.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=494

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 173/205 (84%), Gaps = 6/205 (3%)
 Frame = +2

Query  89   LVCFLLPLLQL------TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
            L  F +PL+        T+SAP  ALVT+IPGF+GTLPSKHYAGYVT+D++ G+ LFYYF
Sbjct  6    LYLFFVPLIYTFLSILPTQSAPQSALVTQIPGFSGTLPSKHYAGYVTVDQSHGRNLFYYF  65

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
            VESE  P++DPVVLWLNGGPGCSS DGFVYEHGPFNFE   T GSL  LHLNPYSW+KV+
Sbjct  66   VESEGKPAEDPVVLWLNGGPGCSSLDGFVYEHGPFNFEKAMTKGSLLQLHLNPYSWSKVS  125

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYA  610
            NIIYLDSP+GVG SYS NETDY TGDLKTASDSHTFLLKWFELY EFL NPFFIAGESYA
Sbjct  126  NIIYLDSPAGVGFSYSKNETDYETGDLKTASDSHTFLLKWFELYPEFLSNPFFIAGESYA  185

Query  611  GVYVPTLSYEVVQGIDAAVKPVLNF  685
            GVYVPTLS EVV+GIDA V PVLNF
Sbjct  186  GVYVPTLSSEVVKGIDAGVTPVLNF  210



>ref|XP_007049588.1| Serine carboxypeptidase-like 20 isoform 2 [Theobroma cacao]
 gb|EOX93745.1| Serine carboxypeptidase-like 20 isoform 2 [Theobroma cacao]
Length=457

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            ++   F   +  +T+SAP+ ALVT++PGF  T  SKHY+GYV ID++ GK LFYYFVESE
Sbjct  13   ISFCLFFSFVAVVTQSAPESALVTQLPGFADTFLSKHYSGYVNIDQSHGKNLFYYFVESE  72

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            R PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT+GSLP LHLN YSW+KV+NIIY
Sbjct  73   RKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTNGSLPQLHLNLYSWSKVSNIIY  132

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVGLSYS N++DY+TGDL+TA+D+H FLLKWF+LY EFL NPFFIAGESYAGVYV
Sbjct  133  LDSPVGVGLSYSKNQSDYVTGDLQTATDTHAFLLKWFQLYSEFLSNPFFIAGESYAGVYV  192

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTLSYEVV+GIDA  KPV+NF
Sbjct  193  PTLSYEVVKGIDAGAKPVINF  213



>ref|XP_006366827.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=492

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQL-TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M +  + L  T+V  LL    L T+ AP GALVT+IPGF G L SKHYAGYV +DE+ GK
Sbjct  1    MARKNIILEYTIVLTLLAFCFLVTEGAPQGALVTQIPGFTGKLLSKHYAGYVNLDESHGK  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             ++YYF+ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGK +GSLP LH NPY
Sbjct  61   NMYYYFIESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKANGSLPILHNNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SW+KV+NIIYLDSP GVGLSYS N+ DY TGDLKTA+++H FLLKWFE+Y EFL NPF+I
Sbjct  121  SWSKVSNIIYLDSPVGVGLSYSKNKADYNTGDLKTATETHAFLLKWFEIYPEFLTNPFYI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +GESYAG+YVPTL+ EVV+GIDA V PV+NF
Sbjct  181  SGESYAGIYVPTLASEVVKGIDAKVTPVINF  211



>gb|KCW57984.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL++EV  GID  VKPVLN 
Sbjct  181  GESYAGVYVPTLAFEVANGIDTGVKPVLNL  210



>gb|KCW57985.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL++EV  GID  VKPVLN 
Sbjct  181  GESYAGVYVPTLAFEVANGIDTGVKPVLNL  210



>ref|XP_010069589.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=496

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL++EV  GID  VKPVLN 
Sbjct  181  GESYAGVYVPTLAFEVANGIDTGVKPVLNL  210



>gb|KCW57986.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
 gb|KCW57987.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL++EV  GID  VKPVLN 
Sbjct  181  GESYAGVYVPTLAFEVANGIDTGVKPVLNL  210



>gb|KCW57982.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
 gb|KCW57983.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAGVYVPTL++EV  GID  VKPVLN 
Sbjct  181  GESYAGVYVPTLAFEVANGIDTGVKPVLNL  210



>ref|XP_007049587.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
 gb|EOX93744.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
Length=499

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            ++   F   +  +T+SAP+ ALVT++PGF  T  SKHY+GYV ID++ GK LFYYFVESE
Sbjct  13   ISFCLFFSFVAVVTQSAPESALVTQLPGFADTFLSKHYSGYVNIDQSHGKNLFYYFVESE  72

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            R PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT+GSLP LHLN YSW+KV+NIIY
Sbjct  73   RKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTNGSLPQLHLNLYSWSKVSNIIY  132

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVGLSYS N++DY+TGDL+TA+D+H FLLKWF+LY EFL NPFFIAGESYAGVYV
Sbjct  133  LDSPVGVGLSYSKNQSDYVTGDLQTATDTHAFLLKWFQLYSEFLSNPFFIAGESYAGVYV  192

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTLSYEVV+GIDA  KPV+NF
Sbjct  193  PTLSYEVVKGIDAGAKPVINF  213



>emb|CAN64572.1| hypothetical protein VITISV_010382 [Vitis vinifera]
Length=478

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = +2

Query  50   LNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            + M +     +  L+C L   + LT++AP  ALVT++PGFNGT PSKHY+GYVT DE  G
Sbjct  1    MGMTRERPMFYWVLICMLFSFV-LTEAAPQTALVTKLPGFNGTFPSKHYSGYVTXDENHG  59

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            KKLFYY V SE NPS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE   T G LP LHLNP
Sbjct  60   KKLFYYMVVSENNPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFE-ASTQGDLPQLHLNP  118

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+K++NIIYLDSP+GVG SYS+N TDY TGDLKTASDSH F+LKWFELY EFL NPF+
Sbjct  119  YSWSKLSNIIYLDSPAGVGFSYSENLTDYRTGDLKTASDSHAFILKWFELYPEFLSNPFY  178

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            IAGESYAGVYVPTL+YEVV+GI   +KP+LNF
Sbjct  179  IAGESYAGVYVPTLAYEVVKGIKGGIKPILNF  210



>ref|NP_001234691.1| wound-inducible carboxypeptidase precursor [Solanum lycopersicum]
 gb|AAF44708.1|AF242849_1 wound-inducible carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  122  TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLN  301
            T+ AP  ALVT++PGFNGT  SKHYAGYV IDE+ GK L+YYFVESERNPSKDPVVLWLN
Sbjct  25   TEGAPQSALVTQLPGFNGTFNSKHYAGYVNIDESHGKNLYYYFVESERNPSKDPVVLWLN  84

Query  302  GGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSD  481
            GGPGCSSFDGFVYEHGPFNF+ GK SGSLP+LH NPYSW+KV+NIIYLDSP GVGLSYS 
Sbjct  85   GGPGCSSFDGFVYEHGPFNFDFGKPSGSLPSLHNNPYSWSKVSNIIYLDSPVGVGLSYSG  144

Query  482  NETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDA  661
            N++DY TGDLKTASDSH+FLLKWFE+Y EFL NPF+I+GESYAG+YVPTL+ EV++GIDA
Sbjct  145  NKSDYNTGDLKTASDSHSFLLKWFEIYPEFLKNPFYISGESYAGIYVPTLASEVIKGIDA  204

Query  662  AVKPVLNF  685
             V+P +NF
Sbjct  205  GVRPAINF  212



>ref|XP_010323102.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=498

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQL-TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M +  + L  ++V  LL    L T+ AP  ALVT+IPGFNGT  SKHYAGYV +DE+ GK
Sbjct  1    MARKNIILEYSIVLTLLAFWFLVTQGAPQSALVTQIPGFNGTFQSKHYAGYVNLDESHGK  60

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             +FYYF+ESE+NPS DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGK +GSLP LH NPY
Sbjct  61   NMFYYFIESEKNPSNDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKANGSLPILHNNPY  120

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SW+KV+NIIYLDSP GVGLSYS N+ DY TGDLKTAS++H+FLLKWF +Y EFL NPF+I
Sbjct  121  SWSKVSNIIYLDSPVGVGLSYSKNKDDYNTGDLKTASETHSFLLKWFAIYPEFLKNPFYI  180

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +GESYAG+YVPTL+ EVV+GIDA V+PV+NF
Sbjct  181  SGESYAGIYVPTLASEVVKGIDAKVEPVINF  211



>gb|KCW57981.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTHQSLPQLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYQTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTL+ EV  GID  VKP+LN 
Sbjct  181  GESYAGIYVPTLAIEVANGIDTGVKPILNL  210



>gb|KJB42611.1| hypothetical protein B456_007G160000 [Gossypium raimondii]
Length=387

 Score =   313 bits (802),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C    L+ LT+SAP+ ALVT++PGF+GT PSKHY+GYV +D+  GK +FYYFVESERNPS
Sbjct  9    CLFCSLVVLTQSAPEEALVTQLPGFSGTFPSKHYSGYVNVDQNHGKNMFYYFVESERNPS  68

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            +D +VLWLNGGPGCSSFDGFVYEHGPFNFE  K + SLP LHLNPYSW+KV+NIIYLDSP
Sbjct  69   EDALVLWLNGGPGCSSFDGFVYEHGPFNFEAAKANESLPQLHLNPYSWSKVSNIIYLDSP  128

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N++DY TGD++TA D+H FLLKWFELY EFLPNPFFIAGESYAGVYVPTLS
Sbjct  129  VGVGFSYSKNKSDYETGDVQTAIDTHAFLLKWFELYSEFLPNPFFIAGESYAGVYVPTLS  188

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP+ NF
Sbjct  189  SEVVKGIVAQKKPIPNF  205



>ref|XP_009626166.1| PREDICTED: serine carboxypeptidase-like 20 [Nicotiana tomentosiformis]
Length=499

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 178/210 (85%), Gaps = 2/210 (1%)
 Frame = +2

Query  62   KNGLPLH--LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            KN   LH  + L+ FL     + +  P+ AL+T+IPGFNGT  SKHYAGYVTIDE  GKK
Sbjct  4    KNSYFLHYNILLLSFLAFSFLVIEGVPENALITQIPGFNGTFQSKHYAGYVTIDENHGKK  63

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFVESE++P++DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTS SLP LH NP+S
Sbjct  64   LFYYFVESEKDPTEDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSESLPILHNNPHS  123

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+++IYLDSP GVG SYS NE+DY TGDLKTASD+H+FLLKWFE+Y E+L NPF+I+
Sbjct  124  WSKVSSVIYLDSPVGVGFSYSGNESDYKTGDLKTASDTHSFLLKWFEIYPEYLKNPFYIS  183

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTLSYEV +GIDA V PV+NF
Sbjct  184  GESYAGIYVPTLSYEVAKGIDAGVVPVINF  213



>ref|XP_007134260.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 ref|XP_007134261.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 gb|ESW06254.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 gb|ESW06255.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
Length=497

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 172/204 (84%), Gaps = 6/204 (3%)
 Frame = +2

Query  92   VCFLLPLLQL------TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFV  253
            +C  L LL +      T+SAP+ A VT++PGF+GTLPSKHYAGYVT+ E  GK LFYYFV
Sbjct  7    MCLCLVLLHIFLCFVSTQSAPESATVTQVPGFSGTLPSKHYAGYVTVGENHGKNLFYYFV  66

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
            ES+  PS+DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT G LPTLHLNPYSW+KV++
Sbjct  67   ESQGKPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTKGGLPTLHLNPYSWSKVSS  126

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            +IYLDSP+GVG SYS N TDYITGD +TASDSH FLLKWFELY EFL NPFFIAGESYAG
Sbjct  127  VIYLDSPAGVGFSYSKNATDYITGDTQTASDSHDFLLKWFELYPEFLSNPFFIAGESYAG  186

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            VYVPTL+ EVV+GI+A V+P LNF
Sbjct  187  VYVPTLASEVVKGIEAGVEPKLNF  210



>gb|KCW57980.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   317 bits (811),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PSKHY+GYVTID    K+
Sbjct  1    MAKTGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSKHYSGYVTIDADHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFVTSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTQQSLPHLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYKTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTL+ EV  GID  VKP+LN 
Sbjct  181  GESYAGIYVPTLAIEVANGIDTGVKPILNL  210



>emb|CBI35583.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            LT++AP  ALVT++PGFNGT PSKHY+GYVTIDE  GKKLFYY V SE NPS+DPVVLWL
Sbjct  7    LTEAAPQTALVTKLPGFNGTFPSKHYSGYVTIDENHGKKLFYYMVVSENNPSEDPVVLWL  66

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE  +T G LP LHLNPYSW+K++NIIYLDSP+GVG SYS
Sbjct  67   NGGPGCSSFDGFVYEHGPFNFE-ARTQGDLPQLHLNPYSWSKLSNIIYLDSPAGVGFSYS  125

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
            +N TDY TGDLKTASDSH F+LKWFELY EFL NPF+IAGESYAGVYVPTL+YEVV+GI 
Sbjct  126  ENLTDYRTGDLKTASDSHAFILKWFELYPEFLSNPFYIAGESYAGVYVPTLAYEVVKGIK  185

Query  659  AAVKPVLNF  685
              +KP+LNF
Sbjct  186  GGIKPILNF  194



>ref|XP_004242440.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=499

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 178/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   MVKNGLPLH--LTLVCFLLPLLQL-TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETS  226
            M +    LH  L L+  LL  L L T+ AP  ALVT+IPGFNGT  SKHYAGYV IDE+ 
Sbjct  1    MARKNFILHYELLLIASLLTFLFLVTEGAPQSALVTQIPGFNGTFHSKHYAGYVNIDESH  60

Query  227  GKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLN  406
            GK L+YYFVESER+PS DPVVLWLNGGPGCSSFDGFVYEHGPFN+ELGK S SLP+LH N
Sbjct  61   GKNLYYYFVESERDPSNDPVVLWLNGGPGCSSFDGFVYEHGPFNYELGKPSTSLPSLHNN  120

Query  407  PYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPF  586
            PYSW+KV+++IYLDSP GVGLSYS N+++Y TGDLKTASD+H FLLKWFE+Y EFL NPF
Sbjct  121  PYSWSKVSSVIYLDSPVGVGLSYSKNKSEYETGDLKTASDTHLFLLKWFEIYPEFLTNPF  180

Query  587  FIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +I+GESYAG+YVPTLSYEVV+GIDA V P +NF
Sbjct  181  YISGESYAGIYVPTLSYEVVKGIDAGVTPAINF  213



>ref|XP_010069585.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
 ref|XP_010069586.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=496

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K+GL L+   +  L     LT+ AP+ AL+T++PGFNG+ PS+HY+GYVTID    K+
Sbjct  1    MAKSGLVLYGGALVLLCSCFVLTRCAPESALITQLPGFNGSFPSEHYSGYVTIDPDHEKR  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYF  SE +PSKDPVVLWLNGGPGCSSFDGFVYEHG FNFE  KT  SLP LHLNPYS
Sbjct  61   LFYYFATSEGDPSKDPVVLWLNGGPGCSSFDGFVYEHGCFNFEAAKTQQSLPHLHLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS N +DY TGD+KTA DSHTFLLKWFELY EFLPNPFFIA
Sbjct  121  WSKVSNIIYLDSPAGVGFSYSKNSSDYKTGDIKTALDSHTFLLKWFELYPEFLPNPFFIA  180

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GESYAG+YVPTL+ EV  GID  VKP+LN 
Sbjct  181  GESYAGIYVPTLAIEVANGIDTGVKPILNL  210



>gb|KJB42610.1| hypothetical protein B456_007G160000 [Gossypium raimondii]
Length=491

 Score =   313 bits (802),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C    L+ LT+SAP+ ALVT++PGF+GT PSKHY+GYV +D+  GK +FYYFVESERNPS
Sbjct  9    CLFCSLVVLTQSAPEEALVTQLPGFSGTFPSKHYSGYVNVDQNHGKNMFYYFVESERNPS  68

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            +D +VLWLNGGPGCSSFDGFVYEHGPFNFE  K + SLP LHLNPYSW+KV+NIIYLDSP
Sbjct  69   EDALVLWLNGGPGCSSFDGFVYEHGPFNFEAAKANESLPQLHLNPYSWSKVSNIIYLDSP  128

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N++DY TGD++TA D+H FLLKWFELY EFLPNPFFIAGESYAGVYVPTLS
Sbjct  129  VGVGFSYSKNKSDYETGDVQTAIDTHAFLLKWFELYSEFLPNPFFIAGESYAGVYVPTLS  188

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP+ NF
Sbjct  189  SEVVKGIVAQKKPIPNF  205



>gb|KHG18698.1| Serine carboxypeptidase-like 20 [Gossypium arboreum]
Length=491

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C    L+ LT SAP+ ALVT++PGF+GT PS HY+GYV +D+  GK +FYYFVESERNPS
Sbjct  9    CLFCSLVVLTHSAPEEALVTQLPGFSGTFPSNHYSGYVNVDQNHGKNMFYYFVESERNPS  68

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            +DP+VLWLNGGPGCSSFDGFVYEHGPFNFE  K + SLP LHLNPYSW+KV+NIIYLDSP
Sbjct  69   EDPLVLWLNGGPGCSSFDGFVYEHGPFNFEAAKANESLPQLHLNPYSWSKVSNIIYLDSP  128

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N++DY TGD++TA D+H FLLKWFELY EFLPNPFFIAGESYAGVYVPTLS
Sbjct  129  VGVGFSYSKNKSDYETGDVQTAIDTHAFLLKWFELYSEFLPNPFFIAGESYAGVYVPTLS  188

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP+ NF
Sbjct  189  SEVVKGIVAQKKPIPNF  205



>ref|XP_006366830.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=497

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNG  304
            + AP  ALVT++PGF G   SKHYAGYV IDE+ GK ++YYFVESE+NPSKDPVVLWLNG
Sbjct  25   EGAPQSALVTQLPGFTGKFQSKHYAGYVNIDESHGKNMYYYFVESEKNPSKDPVVLWLNG  84

Query  305  GPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN  484
            GPGCSSFDGFVYEHGPFNFELGKT+GSLP LH NPYSW+KV+NIIYLDSP GVGLSYS N
Sbjct  85   GPGCSSFDGFVYEHGPFNFELGKTNGSLPILHNNPYSWSKVSNIIYLDSPVGVGLSYSKN  144

Query  485  ETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAA  664
            ++DY TGDLKTASD+H+FLLKWFE+Y EFL NPF+I GESYAG+YVPTL+ EV +GIDA 
Sbjct  145  KSDYETGDLKTASDTHSFLLKWFEIYPEFLMNPFYITGESYAGIYVPTLASEVAKGIDAG  204

Query  665  VKPVLNF  685
            VKP +NF
Sbjct  205  VKPAINF  211



>ref|XP_004960778.1| PREDICTED: serine carboxypeptidase 1-like [Setaria italica]
Length=500

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGT-LPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLW  295
             +++AP GA VTR+PGF G  LPSKHYAGYVT+DE  G++LFYY VESER+P+KDP+VLW
Sbjct  23   CSRAAPAGAQVTRVPGFGGAQLPSKHYAGYVTVDEAHGRRLFYYLVESERDPAKDPLVLW  82

Query  296  LNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSY  475
            LNGGPGCSSFDGFVYEHGPFNFE G ++GSLP LHLNPYSW+KV++++YLDSP+GVGLSY
Sbjct  83   LNGGPGCSSFDGFVYEHGPFNFESGGSAGSLPKLHLNPYSWSKVSSVVYLDSPAGVGLSY  142

Query  476  SDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGI  655
            S N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI
Sbjct  143  SKNVSDYETGDLKTAADSHTFLLKWFQLYPEFLNNPFYIAGESYAGVYVPTLSHEVVKGI  202

Query  656  DAAVKPVLNF  685
               VKP +NF
Sbjct  203  HEGVKPTINF  212



>ref|XP_006366826.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=497

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +2

Query  89   LVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERN  268
            ++ FL  L  +T+  P  ALVT++PGFNGT  SKHYAGYV IDE+ GK L+YYFVESERN
Sbjct  13   VLTFLAFLFLVTEGVPQSALVTQLPGFNGTFNSKHYAGYVNIDESHGKNLYYYFVESERN  72

Query  269  PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLD  448
            PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE GKT+ SLP LH NPYSW+KV+NIIYLD
Sbjct  73   PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTNDSLPILHNNPYSWSKVSNIIYLD  132

Query  449  SPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPT  628
            +P GVGLSYS+++ DY TGDLKTASD+H+FLLKWFE+Y EFL N F+I+GESYAG+YVPT
Sbjct  133  APVGVGLSYSNDKADYNTGDLKTASDTHSFLLKWFEIYPEFLTNQFYISGESYAGIYVPT  192

Query  629  LSYEVVQGIDAAVKPVLNF  685
            L+ ++ +GIDA VKP +NF
Sbjct  193  LASDIAKGIDAGVKPAINF  211



>ref|XP_006366824.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 1-like 
[Solanum tuberosum]
Length=498

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            +T+ A   ALVT++PGFNGT  SKHYAGYV IDE+ GK L+YYFVESER+PS DPVVLWL
Sbjct  24   VTEGASQSALVTQLPGFNGTFNSKHYAGYVNIDESHGKNLYYYFVESERDPSNDPVVLWL  83

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNF+ GK SGSLP+LH NPYSW+KV+NIIYLDSP GVGLSYS
Sbjct  84   NGGPGCSSFDGFVYEHGPFNFDFGKPSGSLPSLHNNPYSWSKVSNIIYLDSPVGVGLSYS  143

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
            +N++DY+T DLKTASDSH+FLLKWFE+Y EFL NPF+I+GESYAG+YVPTL+ EVV+GID
Sbjct  144  NNKSDYVTRDLKTASDSHSFLLKWFEIYPEFLTNPFYISGESYAGIYVPTLASEVVKGID  203

Query  659  AAVKPVLNF  685
            A V P +NF
Sbjct  204  AGVTPAINF  212



>ref|XP_010026006.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=495

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            M K GL L+  LV +    + LT+ AP  A V  +PGFNG+ PS+HY+GYVTID   GK+
Sbjct  1    MAKGGLVLYSALVLWCCSFV-LTQCAPKRARVHHLPGFNGSFPSEHYSGYVTIDLHHGKR  59

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            LFYYFV SE NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT  SLP LHLNPYS
Sbjct  60   LFYYFVTSEGNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTQKSLPRLHLNPYS  119

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVGLSYS N +DY TGD +TA DSHTFLLKWF +Y EFLPNPFF+A
Sbjct  120  WSKVSNIIYLDSPAGVGLSYSGNSSDYRTGDFQTAHDSHTFLLKWFHIYPEFLPNPFFVA  179

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GES+AG+YVPTL+ EV  GID  VKPVLN 
Sbjct  180  GESFAGIYVPTLASEVANGIDTGVKPVLNL  209



>tpg|DAA55431.1| TPA: hypothetical protein ZEAMMB73_969275, partial [Zea mays]
Length=240

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNG--TLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L  +AP GALVT +PGF     LPSKHYAGYVT+DE  G++LFYY VESER+P++DPVVL
Sbjct  28   LAVAAPPGALVTSVPGFGNKQQLPSKHYAGYVTVDERHGRRLFYYLVESERDPARDPVVL  87

Query  293  WLNGGPGCSSFDGFVYEHGPFNFEL-GKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            WLNGGPGCSSFDGFVYEHGPF+FE  G ++GSLP LHLNPYSW+KV+++IYLDSP+GVGL
Sbjct  88   WLNGGPGCSSFDGFVYEHGPFSFESSGGSAGSLPKLHLNPYSWSKVSSVIYLDSPAGVGL  147

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SYS+N +DY TGD KTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS EVV+
Sbjct  148  SYSNNVSDYETGDFKTAADSHTFLLKWFQLYPEFLANPFYIAGESYAGVYVPTLSSEVVK  207

Query  650  GIDAAVKPVLNF  685
            GI   VKPV+NF
Sbjct  208  GIHKGVKPVINF  219



>ref|NP_001167902.1| hypothetical protein precursor [Zea mays]
 gb|ACN26453.1| unknown [Zea mays]
 gb|AFW56638.1| hypothetical protein ZEAMMB73_633855 [Zea mays]
Length=507

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGT-LPSKHYAGYVTIDETSGKKLFYY  247
            L   +T +  L  ++   +SAP GALVTR+PGF+G  LPSKHYAGYVT+DE  G KLFYY
Sbjct  9    LARAVTAILLLASIICCCRSAPPGALVTRLPGFDGAKLPSKHYAGYVTVDEHVGSKLFYY  68

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
             VESER+P++DPVVLWLNGGPGCSS DGFVYEHGPFNFE G +SG+LP LHLNPYSW+KV
Sbjct  69   LVESERDPARDPVVLWLNGGPGCSSMDGFVYEHGPFNFESGGSSGNLPKLHLNPYSWSKV  128

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +++IYLDSPSGVGLSYS N +DY TGDLKTA+DSHTFLLKWF+LY EF  NPF+IAGESY
Sbjct  129  SSVIYLDSPSGVGLSYSKNVSDYETGDLKTAADSHTFLLKWFQLYPEFQKNPFYIAGESY  188

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGVY+PTL+ +VVQGI     PV+NF
Sbjct  189  AGVYIPTLANQVVQGIHKGDNPVINF  214



>ref|XP_006847478.1| hypothetical protein AMTR_s00163p00053930 [Amborella trichopoda]
 gb|ERN09059.1| hypothetical protein AMTR_s00163p00053930 [Amborella trichopoda]
Length=530

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 168/199 (84%), Gaps = 0/199 (0%)
 Frame = +2

Query  89   LVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERN  268
            ++C L+    L ++AP+ ALVT +PGFNGTLPS+HYAGYVT+DE  G+ LFYYFVESE N
Sbjct  47   VICLLVWNGPLAEAAPEKALVTHLPGFNGTLPSQHYAGYVTVDENHGRHLFYYFVESEGN  106

Query  269  PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLD  448
            PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNF L   SGSLP LHLNPYSWTKV++IIY+D
Sbjct  107  PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFALANKSGSLPRLHLNPYSWTKVSSIIYMD  166

Query  449  SPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPT  628
            SP+GVGLSYS+   DY TGDLKTASDSH FLLKWFE Y EF+ NPF+I+GESY GVYVPT
Sbjct  167  SPAGVGLSYSETLDDYSTGDLKTASDSHKFLLKWFEQYPEFIGNPFYISGESYGGVYVPT  226

Query  629  LSYEVVQGIDAAVKPVLNF  685
            L+ E+V+GI+   KP +NF
Sbjct  227  LASEIVKGIETGAKPAINF  245



>ref|XP_003578731.1| PREDICTED: serine carboxypeptidase 1 [Brachypodium distachyon]
Length=492

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP  ALVTR+PGF+G LPSKHYAGYVT+DE  G++LFYY VESER+P+KDPVVLWLNGG
Sbjct  25   AAPQAALVTRVPGFDGALPSKHYAGYVTVDEQHGRRLFYYMVESERDPAKDPVVLWLNGG  84

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYEHGPFNFE G +  SLP LHLNPYSW+KV+ +IYLDSP+GVGLSYS N 
Sbjct  85   PGCSSFDGFVYEHGPFNFESGGSVKSLPKLHLNPYSWSKVSTMIYLDSPAGVGLSYSKNV  144

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY TGDLKTA+DSHTFLLKWF +Y EFL NPF+I+GESYAGVYVPTLS+EVV+GI    
Sbjct  145  SDYNTGDLKTAADSHTFLLKWFGMYPEFLSNPFYISGESYAGVYVPTLSHEVVKGIQGGA  204

Query  668  KPVLNF  685
            KP +NF
Sbjct  205  KPTINF  210



>ref|XP_010450258.1| PREDICTED: serine carboxypeptidase-like 20 [Camelina sativa]
Length=283

 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = +2

Query  83   LTLVCFLLP--LLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L  V  LL    + +T+SAP+ ALVT++PGF+GT PSKHY+GYVTID+  GK ++YYFVE
Sbjct  9    LVFVTLLLSSVFVIITESAPESALVTKLPGFDGTFPSKHYSGYVTIDKEHGKNMWYYFVE  68

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE+NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL K + SLP +HLNPYSW+KV+NI
Sbjct  69   SEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLVHLNPYSWSKVSNI  128

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            +YLDSP GVG SYS+N++DY TGD+KTA DSH FLLKWF+++ EF  NPFFI+GESYAGV
Sbjct  129  MYLDSPVGVGFSYSNNKSDYNTGDMKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGV  188

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ EVV G    VKP LNF
Sbjct  189  YVPTLASEVVNGNKNGVKPALNF  211



>ref|XP_010907920.1| PREDICTED: serine carboxypeptidase 1-like [Elaeis guineensis]
Length=378

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 173/207 (84%), Gaps = 2/207 (1%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQ--LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            LP  L     LL L    L  +AP+ AL+T +PGFNGT PSKHY+GYVT+DE+ G+ LFY
Sbjct  7    LPFLLIFSSMLLFLSSAFLILAAPESALITHLPGFNGTFPSKHYSGYVTVDESHGRNLFY  66

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFV SE NPS+DPVVLWLNGGPGCSSFDGF+YEHGPFNF+ G ++GS+P LHLNPYSW+K
Sbjct  67   YFVVSEGNPSEDPVVLWLNGGPGCSSFDGFIYEHGPFNFQSGGSTGSMPQLHLNPYSWSK  126

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NI+YLDSP+GVG+SYS++++DY TGDLKTASDSH FLLKW+ELY EF  NPF+I+GES
Sbjct  127  VSNILYLDSPAGVGMSYSNDKSDYTTGDLKTASDSHKFLLKWYELYPEFQQNPFYISGES  186

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            YAGVYVPTL+ EV +GI+  +KP +NF
Sbjct  187  YAGVYVPTLASEVAKGIEDGLKPTINF  213



>ref|XP_002863203.1| hypothetical protein ARALYDRAFT_333040 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39462.1| hypothetical protein ARALYDRAFT_333040 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 165/192 (86%), Gaps = 0/192 (0%)
 Frame = +2

Query  110  LLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVV  289
            L  +T+SAP+ AL+T++PGF GT PSKHY+GYVTID+  GK L+YYFVESE++PSKDPVV
Sbjct  17   LFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKDHGKNLWYYFVESEKDPSKDPVV  76

Query  290  LWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            LWLNGGPGCSS DGFVYEHGPFNFEL K + SLP LHLNPYSW+KV+NIIYLDSP GVG 
Sbjct  77   LWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVSNIIYLDSPVGVGF  136

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SYS+N +DYITGD KTA DSH FLLKWF+++ EF  NPFFI+GESYAGVYVPTL+ EVV+
Sbjct  137  SYSNNISDYITGDTKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGVYVPTLASEVVK  196

Query  650  GIDAAVKPVLNF  685
            GI   VKP LNF
Sbjct  197  GIKNGVKPALNF  208



>ref|XP_009416609.1| PREDICTED: serine carboxypeptidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  122  TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLN  301
            + SAP+ A VT +PGFNGT PS HYAG+VT+DE  G+KLFYYFV SER+PSKDPVVLWLN
Sbjct  25   SSSAPEDARVTYLPGFNGTFPSAHYAGFVTVDEDHGRKLFYYFVVSERSPSKDPVVLWLN  84

Query  302  GGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSD  481
            GGPGCSSFDGFVYEHGPFNF+ G  SGSLP LHLNPYSW+KV+NIIYLDSP+GVG+SYS 
Sbjct  85   GGPGCSSFDGFVYEHGPFNFQSGVASGSLPQLHLNPYSWSKVSNIIYLDSPAGVGMSYST  144

Query  482  NETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDA  661
            +++DY TGDLKTASDSHTFLLKWF  Y EFL NPF+I+GESYAGVYVPTL+ EVVQGI +
Sbjct  145  DQSDYNTGDLKTASDSHTFLLKWFREYPEFLENPFYISGESYAGVYVPTLASEVVQGIKS  204

Query  662  AVKPVLNF  685
             + P LNF
Sbjct  205  GMTPTLNF  212



>gb|EEC69080.1| hypothetical protein OsI_37959 [Oryza sativa Indica Group]
Length=507

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            + K+AP  A+V  +PGF+G LPSKHYAGYVT++E  G+ LFYY VESER+P+KDP+VLWL
Sbjct  30   VCKAAPASAVVKSVPGFDGALPSKHYAGYVTVEEQHGRNLFYYLVESERDPAKDPLVLWL  89

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE G ++ SLP LHLNPYSW+KV+++IYLDSP+GVGLSYS
Sbjct  90   NGGPGCSSFDGFVYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLSYS  149

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+G+ 
Sbjct  150  KNTSDYNTGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGLH  209

Query  659  AAVKPVLNF  685
              VKP +NF
Sbjct  210  DGVKPTINF  218



>emb|CAB53091.1| SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis 
thaliana]
 emb|CAB78333.1| SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis 
thaliana]
Length=456

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
               V  L  +  +T+SAP+ AL+T++PGF GT PSKHY+GYVTID+  GK L+YYF+ESE
Sbjct  8    FVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYYFIESE  67

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            +NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL K + SLP LHLNPYSW+KV+NIIY
Sbjct  68   KNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVSNIIY  127

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS+N++DYITGD+KTA DSH FLLKWF+++ EF  NPFFI+GESYAGVYV
Sbjct  128  LDSPVGVGFSYSNNKSDYITGDIKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGVYV  187

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV G    VKP LNF
Sbjct  188  PTLASEVVIGNKNGVKPALNF  208



>ref|XP_010251666.1| PREDICTED: serine carboxypeptidase-like 20 [Nelumbo nucifera]
Length=554

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP+ AL+  +PGF+GT PSKHY+GY+TIDE+ GK LFYYFV SERNPS+DPVVLWLNGG
Sbjct  84   AAPESALILDLPGFSGTFPSKHYSGYITIDESHGKNLFYYFVVSERNPSEDPVVLWLNGG  143

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGF+YEHGPFNFE G T  SLP LHLNPYSW+KV+NIIYL+SP+GVG SYS NE
Sbjct  144  PGCSSFDGFIYEHGPFNFEAGSTPRSLPKLHLNPYSWSKVSNIIYLESPAGVGFSYSKNE  203

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY TGDLKTASD+HTFLLKWF  Y EFL NPFFIAGESYAGVYVPTL+ EVV+GI++  
Sbjct  204  SDYKTGDLKTASDTHTFLLKWFGQYPEFLSNPFFIAGESYAGVYVPTLASEVVKGINSGS  263

Query  668  KPVLNF  685
            +P+LNF
Sbjct  264  EPILNF  269



>gb|KCW57988.1| hypothetical protein EUGRSUZ_H00717 [Eucalyptus grandis]
Length=481

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            LT+ AP  A V  +PGFNG+ PS+HY+GYVTID   GK+LFYYFV SE NPSKDPVVLWL
Sbjct  7    LTQCAPKRARVHHLPGFNGSFPSEHYSGYVTIDLHHGKRLFYYFVTSEGNPSKDPVVLWL  66

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE  KT  SLP LHLNPYSW+KV+NIIYLDSP+GVGLSYS
Sbjct  67   NGGPGCSSFDGFVYEHGPFNFEAAKTQKSLPRLHLNPYSWSKVSNIIYLDSPAGVGLSYS  126

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGD +TA DSHTFLLKWF +Y EFLPNPFF+AGES+AG+YVPTL+ EV  GID
Sbjct  127  GNSSDYRTGDFQTAHDSHTFLLKWFHIYPEFLPNPFFVAGESFAGIYVPTLASEVANGID  186

Query  659  AAVKPVLNF  685
              VKPVLN 
Sbjct  187  TGVKPVLNL  195



>emb|CDY33713.1| BnaC04g29380D [Brassica napus]
Length=505

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  V  LL  L  T+SAP+ AL+T++PGF+GT PSKHY+GYVTID+  GK L+YYFVESE
Sbjct  8    LAFVTLLLVFLITTESAPESALITKLPGFSGTFPSKHYSGYVTIDKEHGKNLWYYFVESE  67

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
             NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT+ SLP LHLNPYSW+KV+N+IY
Sbjct  68   MNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTNYSLPLLHLNPYSWSKVSNMIY  127

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS NE+DYITGD+KTA DSH FLLKWF+++ EF  NPF+I+GESYAGVYV
Sbjct  128  LDSPVGVGFSYSKNESDYITGDMKTAVDSHAFLLKWFQMFPEFQSNPFYISGESYAGVYV  187

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV+G    +KP LN 
Sbjct  188  PTLASEVVKGNKEGLKPALNL  208



>ref|NP_193027.5| serine carboxypeptidase-like 20 [Arabidopsis thaliana]
 sp|Q8L7B2.2|SCP20_ARATH RecName: Full=Serine carboxypeptidase-like 20; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE83202.1| serine carboxypeptidase-like 20 [Arabidopsis thaliana]
Length=497

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
               V  L  +  +T+SAP+ AL+T++PGF GT PSKHY+GYVTID+  GK L+YYF+ESE
Sbjct  13   FVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYYFIESE  72

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            +NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL K + SLP LHLNPYSW+KV+NIIY
Sbjct  73   KNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVSNIIY  132

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS+N++DYITGD+KTA DSH FLLKWF+++ EF  NPFFI+GESYAGVYV
Sbjct  133  LDSPVGVGFSYSNNKSDYITGDIKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGVYV  192

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV G    VKP LNF
Sbjct  193  PTLASEVVIGNKNGVKPALNF  213



>gb|AAM97031.1| serine carboxypeptidase 1 precursor-like protein [Arabidopsis 
thaliana]
 gb|AAN15500.1| serine carboxypeptidase 1 precursor-like protein [Arabidopsis 
thaliana]
Length=497

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
               V  L  +  +T+SAP+ AL+T++PGF GT PSKHY+GYVTID+  GK L+YYF+ESE
Sbjct  13   FVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYYFIESE  72

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            +NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL K + SLP LHLNPYSW+KV+NIIY
Sbjct  73   KNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVSNIIY  132

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS+N++DYITGD+KTA DSH FLLKWF+++ EF  NPFFI+GESYAGVYV
Sbjct  133  LDSPVGVGFSYSNNKSDYITGDIKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGVYV  192

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV G    VKP LNF
Sbjct  193  PTLASEVVIGNKNGVKPALNF  213



>ref|NP_001066510.1| Os12g0257000 [Oryza sativa Japonica Group]
 sp|P37890.1|CBP1_ORYSJ RecName: Full=Serine carboxypeptidase 1; AltName: Full=Carboxypeptidase 
C; AltName: Full=Serine carboxypeptidase I; Contains: 
RecName: Full=Serine carboxypeptidase 1 chain A; AltName: 
Full=Serine carboxypeptidase I chain A; Contains: RecName: 
Full=Serine carboxypeptidase 1 chain B; AltName: Full=Serine 
carboxypeptidase I chain B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAA04510.1| serine carboxypeptidase I [Oryza sativa Japonica Group]
 gb|ABA96977.2| Serine carboxypeptidase I precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29529.1| Os12g0257000 [Oryza sativa Japonica Group]
Length=510

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            + ++AP  A+V  +PGF+G LPSKHYAGYVT++E  G+ LFYY VESER+P+KDP+VLWL
Sbjct  33   VCEAAPASAVVKSVPGFDGALPSKHYAGYVTVEEQHGRNLFYYLVESERDPAKDPLVLWL  92

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE G ++ SLP LHLNPYSW+KV+++IYLDSP+GVGLSYS
Sbjct  93   NGGPGCSSFDGFVYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLSYS  152

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+G+ 
Sbjct  153  KNTSDYNTGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGLH  212

Query  659  AAVKPVLNF  685
              VKP +NF
Sbjct  213  DGVKPTINF  221



>emb|CDY39716.1| BnaA04g07190D [Brassica napus]
Length=505

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  V  LL  L  T+SAP  AL+T++PGF+GT PSKHY+GYVTID+  GK L+YYFVESE
Sbjct  8    LAFVTLLLVFLITTESAPQSALITKLPGFSGTFPSKHYSGYVTIDKEHGKNLWYYFVESE  67

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
             NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT+ SLP LHLNPYSW+KV+N+IY
Sbjct  68   MNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTNYSLPLLHLNPYSWSKVSNMIY  127

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS NE+DYITGD+KTA DSH FLLKWF+++ EF  NPF+I+GESYAGVYV
Sbjct  128  LDSPVGVGFSYSKNESDYITGDMKTAVDSHAFLLKWFQMFPEFQSNPFYISGESYAGVYV  187

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV+G    +KP LN 
Sbjct  188  PTLASEVVKGNKEGLKPALNL  208



>ref|XP_009139654.1| PREDICTED: serine carboxypeptidase-like 20 [Brassica rapa]
Length=492

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  V  LL  L  T+SAP  AL+T++PGF+GT PSKHY+GYVTID+  GK L+YYFVESE
Sbjct  8    LAFVTLLLVFLITTESAPQSALITKLPGFSGTFPSKHYSGYVTIDKEHGKNLWYYFVESE  67

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
             NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT+ SLP LHLNPYSW+KV+N+IY
Sbjct  68   MNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTNYSLPLLHLNPYSWSKVSNMIY  127

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS NE+DYITGD+KTA DSH FLLKWF+++ EF  NPF+I+GESYAGVYV
Sbjct  128  LDSPVGVGFSYSKNESDYITGDMKTAVDSHAFLLKWFQMFPEFQSNPFYISGESYAGVYV  187

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV+G    +KP LN 
Sbjct  188  PTLASEVVKGNKEGLKPALNL  208



>tpg|DAA55432.1| TPA: hypothetical protein ZEAMMB73_969275 [Zea mays]
Length=480

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNG--TLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L  +AP GALVT +PGF     LPSKHYAGYVT+DE  G++LFYY VESER+P++DPVVL
Sbjct  28   LAVAAPPGALVTSVPGFGNKQQLPSKHYAGYVTVDERHGRRLFYYLVESERDPARDPVVL  87

Query  293  WLNGGPGCSSFDGFVYEHGPFNFEL-GKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            WLNGGPGCSSFDGFVYEHGPF+FE  G ++GSLP LHLNPYSW+KV+++IYLDSP+GVGL
Sbjct  88   WLNGGPGCSSFDGFVYEHGPFSFESSGGSAGSLPKLHLNPYSWSKVSSVIYLDSPAGVGL  147

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SYS+N +DY TGD KTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS EVV+
Sbjct  148  SYSNNVSDYETGDFKTAADSHTFLLKWFQLYPEFLANPFYIAGESYAGVYVPTLSSEVVK  207

Query  650  GIDAAVKPVLNF  685
            GI   VKPV+NF
Sbjct  208  GIHKGVKPVINF  219



>gb|EMT03686.1| Serine carboxypeptidase 1 [Aegilops tauschii]
Length=447

 Score =   302 bits (773),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP G  VT +PG +G LPSKHYAGYVT+DE  G+ LFYY VESER+P+KDPVVLWLNGG
Sbjct  25   AAPQGVEVTGLPGLDGALPSKHYAGYVTVDEKHGRNLFYYAVESERDPAKDPVVLWLNGG  84

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYEHGPFNFE G +  SLP LHLNPYSW+KV+ +IYLDSP+GVGLSYS+N 
Sbjct  85   PGCSSFDGFVYEHGPFNFESGGSVKSLPKLHLNPYSWSKVSTMIYLDSPAGVGLSYSNNV  144

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI    
Sbjct  145  SDYETGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQGGA  204

Query  668  KPVLNF  685
            KP +NF
Sbjct  205  KPTINF  210



>gb|KCW58760.1| hypothetical protein EUGRSUZ_H01397 [Eucalyptus grandis]
Length=231

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT----KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYY  247
            L  +C +   L LT    ++AP  ++++ +PGF GTLPSKHYAGY+TID + G+K LFYY
Sbjct  15   LKFICSITLALLLTVSTVRAAPKKSVISSLPGFVGTLPSKHYAGYMTIDGSPGEKNLFYY  74

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
            F+ SERNPSKDPVVLWLNGGP CSSFDGF+YEHGPF F+ GK   SLPTLHLNP+SW+KV
Sbjct  75   FIVSERNPSKDPVVLWLNGGPACSSFDGFIYEHGPFKFQAGKPKESLPTLHLNPFSWSKV  134

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +NIIYLDSP GVGLSYS+N  +Y+TGDL+TASD+HTFLLKWF+LY EFL NPF+I+GESY
Sbjct  135  SNIIYLDSPCGVGLSYSNNPKNYVTGDLQTASDTHTFLLKWFKLYPEFLSNPFYISGESY  194

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGVYVPTL+ EVV+GI    KP++NF
Sbjct  195  AGVYVPTLASEVVKGIQIGEKPLINF  220



>ref|XP_008794935.1| PREDICTED: serine carboxypeptidase 1-like [Phoenix dactylifera]
Length=499

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            L  +AP+ AL+T +PGFN T PSKHY+GYVT+DE  G+ LFYYFV SE NPS+DPVV+WL
Sbjct  26   LISAAPESALITHLPGFNATFPSKHYSGYVTVDEGHGRNLFYYFVVSEGNPSEDPVVMWL  85

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGF+YEHGPFNF+ G ++GS+P LHLNPYSW+KV+NI+YLDSP+GVG+SYS
Sbjct  86   NGGPGCSSFDGFIYEHGPFNFQSGGSAGSMPQLHLNPYSWSKVSNILYLDSPAGVGMSYS  145

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
            ++E+DY TGDLKTASDSH F+LKWFELY EF  NPF+I+GESYAGVYVPTL+ EV +GI+
Sbjct  146  NDESDYATGDLKTASDSHKFILKWFELYPEFQQNPFYISGESYAGVYVPTLASEVAKGIE  205

Query  659  AAVKPVLNF  685
              VKP +NF
Sbjct  206  DGVKPTINF  214



>ref|XP_010435332.1| PREDICTED: serine carboxypeptidase-like 20 [Camelina sativa]
Length=495

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = +2

Query  83   LTLVCFLLP--LLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L  V  LL    + +T+SAP+ ALVT++PGF+GT PSKHY+GYVTID+  GK L+YYFVE
Sbjct  9    LVFVTLLLSSVFVIITESAPESALVTKLPGFDGTFPSKHYSGYVTIDKEHGKNLWYYFVE  68

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE+NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL K + SLP +HLNPYSW+KV+NI
Sbjct  69   SEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLVHLNPYSWSKVSNI  128

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            +YLDSP GVG SYS+N++DY TGD+KTA DSH FLLKWF+++ EF  NPFFI+GESYAGV
Sbjct  129  MYLDSPVGVGFSYSNNKSDYNTGDMKTAVDSHAFLLKWFQMFPEFQSNPFFISGESYAGV  188

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ EVV G    VKP LNF
Sbjct  189  YVPTLASEVVNGNKNGVKPALNF  211



>ref|NP_001149341.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG35088.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=517

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNG--TLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L  +AP GALVT +PGF     LPSKHYAGYVT+DE  G++LFYY VESER+P++DPVVL
Sbjct  28   LAVAAPPGALVTSVPGFGNKQQLPSKHYAGYVTVDERHGRRLFYYLVESERDPARDPVVL  87

Query  293  WLNGGPGCSSFDGFVYEHGPFNFE-LGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            WLNGGPGCSSFDGFVYEHGPF+FE  G ++GSLP LHLNPYSW+KV+++IYLDSP+GVGL
Sbjct  88   WLNGGPGCSSFDGFVYEHGPFSFEPSGGSAGSLPKLHLNPYSWSKVSSVIYLDSPAGVGL  147

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SYS+N +DY TGD KTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS EVV+
Sbjct  148  SYSNNVSDYETGDFKTAADSHTFLLKWFQLYPEFLANPFYIAGESYAGVYVPTLSSEVVK  207

Query  650  GIDAAVKPVLNF  685
            GI   VKPV+NF
Sbjct  208  GIHKGVKPVINF  219



>gb|ACN29329.1| unknown [Zea mays]
 tpg|DAA55433.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=517

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNG--TLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L  +AP GALVT +PGF     LPSKHYAGYVT+DE  G++LFYY VESER+P++DPVVL
Sbjct  28   LAVAAPPGALVTSVPGFGNKQQLPSKHYAGYVTVDERHGRRLFYYLVESERDPARDPVVL  87

Query  293  WLNGGPGCSSFDGFVYEHGPFNFEL-GKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            WLNGGPGCSSFDGFVYEHGPF+FE  G ++GSLP LHLNPYSW+KV+++IYLDSP+GVGL
Sbjct  88   WLNGGPGCSSFDGFVYEHGPFSFESSGGSAGSLPKLHLNPYSWSKVSSVIYLDSPAGVGL  147

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SYS+N +DY TGD KTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS EVV+
Sbjct  148  SYSNNVSDYETGDFKTAADSHTFLLKWFQLYPEFLANPFYIAGESYAGVYVPTLSSEVVK  207

Query  650  GIDAAVKPVLNF  685
            GI   VKPV+NF
Sbjct  208  GIHKGVKPVINF  219



>emb|CDM85928.1| unnamed protein product [Triticum aestivum]
Length=462

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            VT +PGF+G LPSKHYAGYVT+DE  G+ LFYY VESER+PSKDPVVLWLNGGPGCSSFD
Sbjct  22   VTGLPGFDGALPSKHYAGYVTVDERHGRNLFYYAVESERDPSKDPVVLWLNGGPGCSSFD  81

Query  329  GFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGD  508
            GFVYEHGPFNFE G +  SLP LHLNPYSW+KV+ +IYLDSP+GVGLSYS N +DY+TGD
Sbjct  82   GFVYEHGPFNFESGGSVKSLPKLHLNPYSWSKVSTMIYLDSPAGVGLSYSKNVSDYVTGD  141

Query  509  LKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            LKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI    KP +NF
Sbjct  142  LKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQGGAKPTINF  200



>ref|XP_002443027.1| hypothetical protein SORBIDRAFT_08g006540 [Sorghum bicolor]
 gb|EES16865.1| hypothetical protein SORBIDRAFT_08g006540 [Sorghum bicolor]
Length=498

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +2

Query  110  LLQLTKSAP-DGALVTRIPGFNGT-LPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDP  283
            ++   +SAP  GALVTR+PGF+G  LPSKHYAGYVT++E  G +LFYY VESER+P++DP
Sbjct  16   MVCCCRSAPPAGALVTRLPGFDGAQLPSKHYAGYVTVNEHVGSRLFYYLVESERDPARDP  75

Query  284  VVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGV  463
            VVLWLNGGPGCSS DGFVYEHGPFNFE G ++GSLP LHLNPYSW+KV++++YLDSPSGV
Sbjct  76   VVLWLNGGPGCSSMDGFVYEHGPFNFESGGSAGSLPKLHLNPYSWSKVSSVLYLDSPSGV  135

Query  464  GLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEV  643
            GLSYS N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVY+PTL+ EV
Sbjct  136  GLSYSKNVSDYETGDLKTAADSHTFLLKWFQLYPEFLKNPFYIAGESYAGVYIPTLANEV  195

Query  644  VQGIDAAVKPVLNF  685
            V+GI     PV+NF
Sbjct  196  VKGIHKGDNPVINF  209



>ref|XP_004492215.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=486

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            LT+SAP  +L+T++PGFNGT+PSKHYAGYVT+DE  GK L+YYF+ES+ NPSKDPVVLWL
Sbjct  17   LTQSAPKESLITKLPGFNGTIPSKHYAGYVTVDEIRGKNLYYYFIESQSNPSKDPVVLWL  76

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNF   KT G+LPTL LNPYSW+ V+NIIYLDSP G+G SYS
Sbjct  77   NGGPGCSSFDGFVYEHGPFNFIKSKTKGALPTLQLNPYSWSLVSNIIYLDSPVGIGFSYS  136

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGD+KTA D+H FLLKWFELY EF  NP F++GESYAGVYVPTL++++V+GI+
Sbjct  137  KNISDYKTGDIKTAFDTHRFLLKWFELYPEFQTNPLFLSGESYAGVYVPTLAHKIVKGIE  196

Query  659  AAVKPVLNF  685
            A  KP LNF
Sbjct  197  AGAKPKLNF  205



>gb|KDP26877.1| hypothetical protein JCGZ_18035 [Jatropha curcas]
Length=478

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 163/191 (85%), Gaps = 3/191 (2%)
 Frame = +2

Query  113  LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L+  + AP G+L+T+IPGFNG  PSKHY+GYV+ ++   K LFYY V SERNPSKDPVVL
Sbjct  5    LEFIEGAPRGSLITQIPGFNGKFPSKHYSGYVSFNQ---KNLFYYLVVSERNPSKDPVVL  61

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSSFDGFVYEHGPFNF+ G   GSLPTLHLNPYSW+KV+NIIYLDSP GVGLS
Sbjct  62   WLNGGPGCSSFDGFVYEHGPFNFQEGHPKGSLPTLHLNPYSWSKVSNIIYLDSPCGVGLS  121

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS N + Y T D KTA+D+HTFLLKWFELY EFL NPF+I+GESYAG+YVPTL++EVV+G
Sbjct  122  YSKNTSKYTTDDFKTAADTHTFLLKWFELYPEFLSNPFYISGESYAGIYVPTLAHEVVKG  181

Query  653  IDAAVKPVLNF  685
            I AA KP++NF
Sbjct  182  IKAAQKPIINF  192



>prf||1314177A CPase I A
Length=266

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  131  APDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGP  310
            AP GA VT +PGF+G LPSKHYAGYVT+DE  G+ LFYY VESER+P KDPVVLWLNGGP
Sbjct  1    APQGAEVTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYYVVESERDPGKDPVVLWLNGGP  60

Query  311  GCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNET  490
            GCSSFDGFVYE GPFNFE G +  SLP LHLNPY+W+KV+ +IYLDSP+GVGLS     +
Sbjct  61   GCSSFDGFVYEPGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSLYSKNS  120

Query  491  DYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVK  670
            DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI    K
Sbjct  121  DYETGDLKTATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQGGAK  180

Query  671  PVLNF  685
            P +NF
Sbjct  181  PTINF  185



>ref|XP_010026201.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=495

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT----KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYY  247
            L  +C +   L LT    ++AP  +L+T +PGF+GTLPS+HYAGYVTID   GKK LFYY
Sbjct  15   LKFICSITLALLLTVSSVRAAPKESLITSLPGFDGTLPSEHYAGYVTIDGIPGKKNLFYY  74

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
            F+ SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPF F +GK  GSLP LHLNP+SW+KV
Sbjct  75   FIASERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFKFHVGKPKGSLPLLHLNPFSWSKV  134

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +NIIYL+SP GVGLSYSDN  +Y+TGDL+TASD+H FLLKWFELY EFL NPF+I+GESY
Sbjct  135  SNIIYLESPCGVGLSYSDNPKNYVTGDLQTASDTHAFLLKWFELYPEFLSNPFYISGESY  194

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AG+YVPTL+ EVV+GI     P++NF
Sbjct  195  AGIYVPTLASEVVKGIQIGETPLINF  220



>gb|KFK23486.1| hypothetical protein AALP_AAs46213U000900 [Arabis alpina]
Length=492

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L     +  +  +T+SAPD AL+T++PGF+GT PSKHY+GYVT+ +   K L+YYFVESE
Sbjct  8    LVFTTLVSSVFVVTESAPDSALITKLPGFDGTFPSKHYSGYVTLGKEHEKNLWYYFVESE  67

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            +NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNF+  KT+ +LP L+LNPYSW+KV+NIIY
Sbjct  68   KNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFKPAKTNTTLPQLYLNPYSWSKVSNIIY  127

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP GVG SYS N++DYITGD KTA DSH FLLKWF+++ EF  NPF+I+GESYAG+YV
Sbjct  128  LDSPVGVGFSYSKNKSDYITGDTKTAVDSHAFLLKWFQMFPEFQANPFYISGESYAGIYV  187

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            PTL+ EVV+GI   VKPVLNF
Sbjct  188  PTLASEVVKGIKEGVKPVLNF  208



>ref|XP_008451218.1| PREDICTED: serine carboxypeptidase-like 20 [Cucumis melo]
Length=485

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = +2

Query  101  LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKD  280
            ++PLL       + A VT++PGF+G LPSKHY+GYV I+E  G+ LFYYFVESERNP +D
Sbjct  8    IIPLLFFFFLLANSAPVTQLPGFSGPLPSKHYSGYVEINEKHGRNLFYYFVESERNPVED  67

Query  281  PVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSG  460
            PVVLWLNGGPGCSSFDGFVYEHGPFNFE   T G LPTLH NPYSW+KV+NIIYLDSP+G
Sbjct  68   PVVLWLNGGPGCSSFDGFVYEHGPFNFEAASTPGGLPTLHRNPYSWSKVSNIIYLDSPAG  127

Query  461  VGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYE  640
            VGLSYS N++DY TGD++TA DSH FLL+WF+L+ +FLPNPFFIAGESYAGVYVPTL+ +
Sbjct  128  VGLSYSKNKSDYTTGDVQTALDSHKFLLEWFKLFPQFLPNPFFIAGESYAGVYVPTLATQ  187

Query  641  VVQGIDAAVKPVLNF  685
            VV+G++  VKP+LNF
Sbjct  188  VVKGLETGVKPILNF  202



>sp|P07519.4|CBP1_HORVU RecName: Full=Serine carboxypeptidase 1; AltName: Full=CP-MI; 
AltName: Full=Carboxypeptidase C; AltName: Full=Serine carboxypeptidase 
I; Contains: RecName: Full=Serine carboxypeptidase 
1 chain A; AltName: Full=Serine carboxypeptidase I chain 
A; Contains: RecName: Full=Serine carboxypeptidase 1 chain 
B; AltName: Full=Serine carboxypeptidase I chain B; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA70816.1| serine carboxypeptidase I, CP-MI [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            VT +PGF+G LPSKHYAGYVT+DE  G+ LFYY VESER+P KDPVVLWLNGGPGCSSFD
Sbjct  37   VTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYYVVESERDPGKDPVVLWLNGGPGCSSFD  96

Query  329  GFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGD  508
            GFVYEHGPFNFE G +  SLP LHLNPY+W+KV+ +IYLDSP+GVGLSYS N +DY TGD
Sbjct  97   GFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSYSKNVSDYETGD  156

Query  509  LKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            LKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI    KP +NF
Sbjct  157  LKTATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQGGAKPTINF  215



>dbj|BAJ95123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            VT +PGF+G LPSKHYAGYVT+DE  G+ LFYY VESER+P KDPVVLWLNGGPGCSSFD
Sbjct  37   VTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYYVVESERDPGKDPVVLWLNGGPGCSSFD  96

Query  329  GFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGD  508
            GFVYEHGPFNFE G +  SLP LHLNPY+W+KV+ +IYLDSP+GVGLSYS N +DY TGD
Sbjct  97   GFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSYSKNVSDYETGD  156

Query  509  LKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            LKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI    KP +NF
Sbjct  157  LKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQGGAKPTINF  215



>ref|XP_010070327.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
 gb|KCW58996.1| hypothetical protein EUGRSUZ_H01620 [Eucalyptus grandis]
Length=496

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT----KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYY  247
            L  +C +   L LT    ++AP  +L+T +PGF+GTLPS+HYAGYVTID   GKK LFYY
Sbjct  15   LKFICSITLALLLTVSSVRAAPKESLITSLPGFDGTLPSEHYAGYVTIDGIPGKKNLFYY  74

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
            F+ SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPF F +GK  GSLP LHLNP+SW+KV
Sbjct  75   FIASERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFKFHVGKPKGSLPLLHLNPFSWSKV  134

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +NIIYL+SP GVGLSYSDN  +Y+TGDL+TASD+H FLLKWF+LY EFL NPF+I+GESY
Sbjct  135  SNIIYLESPCGVGLSYSDNPKNYVTGDLQTASDTHAFLLKWFKLYPEFLSNPFYISGESY  194

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGVYVPTL+ EVV+G      P++NF
Sbjct  195  AGVYVPTLALEVVKGTQIGETPLINF  220



>ref|XP_006283616.1| hypothetical protein CARUB_v10004672mg [Capsella rubella]
 gb|EOA16514.1| hypothetical protein CARUB_v10004672mg [Capsella rubella]
Length=491

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 1/200 (1%)
 Frame = +2

Query  89   LVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERN  268
            LV   L +    +SAP+ AL+T++PGF+G+ PSKHY+GYVTIDE  GK L+YYFVESE+N
Sbjct  8    LVFITLLVSSTIESAPESALITKLPGFDGSFPSKHYSGYVTIDEKHGKNLWYYFVESEKN  67

Query  269  PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEL-GKTSGSLPTLHLNPYSWTKVTNIIYL  445
            PSKDPVVLWLNGGPGCSS DGFVYEHGPFNFEL  K + SLP +HLNPYSW+KV+NIIYL
Sbjct  68   PSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKKNTSLPLVHLNPYSWSKVSNIIYL  127

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP GVG SYS+NE+DY TGD KTA DSH FLLKWFEL+ EF  NPF+I+GESYAGVYVP
Sbjct  128  DSPVGVGFSYSNNESDYETGDTKTAVDSHAFLLKWFELFPEFQSNPFYISGESYAGVYVP  187

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL+ EVV+G    VKP LN 
Sbjct  188  TLASEVVKGNKNGVKPALNL  207



>gb|KEH22522.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=415

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L L L+   L  + + +SAP  +L+T++PGF+G +PSKHYAGYVT+D+  GK L+YYFVE
Sbjct  7    LCLVLLHIFLSFVPI-QSAPRKSLITKLPGFSGIIPSKHYAGYVTLDKIHGKNLYYYFVE  65

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE NPSKDP+VLWLNGGP CSSFDGF+YEHGPFNF   KT G+LPTL LNPYSW+KV+NI
Sbjct  66   SEGNPSKDPLVLWLNGGPACSSFDGFIYEHGPFNFIKPKTKGTLPTLQLNPYSWSKVSNI  125

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP G G SYS NE+DY TGD KTA D+HTFLL+WF+LY EFL NP FIAGESYAG+
Sbjct  126  IYLDSPVGTGFSYSRNESDYYTGDTKTAFDTHTFLLQWFKLYPEFLANPLFIAGESYAGI  185

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ ++V+GI+A +KP LNF
Sbjct  186  YVPTLADKIVEGIEAGIKPKLNF  208



>ref|XP_004139101.1| PREDICTED: serine carboxypeptidase 1-like [Cucumis sativus]
Length=502

 Score =   295 bits (756),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 176/212 (83%), Gaps = 2/212 (1%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGT-LPSKHYAGYVTIDET-SG  229
            M +  + + L L+  ++ ++ + ++AP G+LVT +PGF     PSKH++GY+ IDET SG
Sbjct  1    MERGLIIIMLYLLVNVVDMISIIEAAPQGSLVTHLPGFTSNHFPSKHHSGYINIDETESG  60

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            KKLFYYFV SER+P++DPVVLWLNGGPGCSSFDGFVYEHGPFNFE G   G+LPTLHLNP
Sbjct  61   KKLFYYFVTSERSPAEDPVVLWLNGGPGCSSFDGFVYEHGPFNFEEGNPKGTLPTLHLNP  120

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+NIIYLDSP+GVGLSYS N ++YITGDL+TASD+HTFLLKWF+ + EF+ NPF+
Sbjct  121  YSWSKVSNIIYLDSPAGVGLSYSTNHSNYITGDLQTASDTHTFLLKWFKEFPEFVKNPFY  180

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            IAGESYAG+YVPTL+++VV+GI     P++N 
Sbjct  181  IAGESYAGIYVPTLTFQVVKGIKDGTAPIINL  212



>ref|XP_007029292.1| Serine carboxypeptidase-like 20 isoform 4 [Theobroma cacao]
 gb|EOY09794.1| Serine carboxypeptidase-like 20 isoform 4 [Theobroma cacao]
Length=377

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C L     + ++  +G+LVT++PGFNG  PSKHY+GYV +DE   K LFYYFV SERNPS
Sbjct  11   CMLFSC-AIVEAVQNGSLVTQLPGFNGVFPSKHYSGYVKVDE---KNLFYYFVVSERNPS  66

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GK   SLPTLHLNPYSW+KV+NIIYLDSP
Sbjct  67   KDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGKPKRSLPTLHLNPYSWSKVSNIIYLDSP  126

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N + YITGD +TA+D+H FLLKWF LY EF+ NPF+I+GESYAG+YVPTL+
Sbjct  127  VGVGFSYSKNTSTYITGDRQTAADTHAFLLKWFALYPEFVSNPFYISGESYAGIYVPTLA  186

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP +NF
Sbjct  187  SEVVKGIKAGAKPRINF  203



>ref|XP_002443030.1| hypothetical protein SORBIDRAFT_08g006590 [Sorghum bicolor]
 gb|EES16868.1| hypothetical protein SORBIDRAFT_08g006590 [Sorghum bicolor]
Length=495

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +2

Query  110  LLQLTKSAPDGALVTRIPGFNGT-LPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPV  286
            ++    SAP GALVT +PGF+G  LPSKHYAGYVT++ET G +LFYY VESER+P+ DPV
Sbjct  22   IVCCCHSAPSGALVTHLPGFDGAKLPSKHYAGYVTVNETVGSRLFYYLVESERDPAWDPV  81

Query  287  VLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVG  466
            VLWLNGGPGCSS DGFVYEHGPFNFE G+ +GSLP LHLNPYSW+KV+++IYLDSP+GVG
Sbjct  82   VLWLNGGPGCSSMDGFVYEHGPFNFEAGRKAGSLPKLHLNPYSWSKVSSVIYLDSPAGVG  141

Query  467  LSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVV  646
            LSYS N +DY TGDLKTA DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV
Sbjct  142  LSYSKNVSDYKTGDLKTAVDSHTFLLKWFQLYPEFLTNPFYIAGESYAGVYVPTLSHEVV  201

Query  647  QGIDAAVKPVLNF  685
            +G    +  +L  
Sbjct  202  KGFGFGIVMILRL  214



>gb|KDP26878.1| hypothetical protein JCGZ_18036 [Jatropha curcas]
Length=489

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = +2

Query  98   FLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSK  277
             LL L+   K+A +GAL+T +PGFNG  PSKHY+GYV++     K LFYYFV SERNPSK
Sbjct  10   MLLCLIASIKAAQEGALITYLPGFNGNFPSKHYSGYVSVG--GQKSLFYYFVVSERNPSK  67

Query  278  DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPS  457
            DPVVLWLNGGPGCSSFDGFVYEHGPFNFE G+  GSLP LHLNPYSW+KV+NIIYLDSP+
Sbjct  68   DPVVLWLNGGPGCSSFDGFVYEHGPFNFEEGQPKGSLPILHLNPYSWSKVSNIIYLDSPA  127

Query  458  GVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSY  637
            GVGLSYS NE++Y TGDL TA+D+H+FLLKWF LY EFL NPF++AGESYAGVYVPTL+ 
Sbjct  128  GVGLSYSKNESEYETGDLATAADTHSFLLKWFGLYPEFLNNPFYVAGESYAGVYVPTLAS  187

Query  638  EVVQGIDAAVKPVLNF  685
            ++V+GI A V P++ F
Sbjct  188  QLVKGIKAGVNPIIKF  203



>gb|ACN40340.1| unknown [Picea sitchensis]
Length=303

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 164/200 (82%), Gaps = 5/200 (3%)
 Frame = +2

Query  95   CFLLPLLQL---TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESER  265
            C LL L+ L    ++AP  A +T +PG++G+LPS HYAGYV +  +  K L+YYFV SE 
Sbjct  10   CCLLGLVALHSYAEAAPANARITSLPGYSGSLPSDHYAGYVKV--SKAKNLYYYFVTSEG  67

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            N +KDPVVLWLNGGPGCSSFDGFVYEHGPFN+E GKT GSLP L+LNPYSWTKV+NIIYL
Sbjct  68   NATKDPVVLWLNGGPGCSSFDGFVYEHGPFNYEAGKTVGSLPKLYLNPYSWTKVSNIIYL  127

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP GVGLSYS+N  DY TGDL+TASD+H FLLKWFE Y EFL NPF+I+GESYAG+YVP
Sbjct  128  DSPVGVGLSYSENVDDYNTGDLQTASDTHAFLLKWFEEYPEFLSNPFYISGESYAGIYVP  187

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL  EVV+GI+A V P+LNF
Sbjct  188  TLGSEVVKGIEARVTPILNF  207



>ref|XP_007029291.1| Serine carboxypeptidase-like 20 isoform 3, partial [Theobroma 
cacao]
 gb|EOY09793.1| Serine carboxypeptidase-like 20 isoform 3, partial [Theobroma 
cacao]
Length=458

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 165/203 (81%), Gaps = 6/203 (3%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            LH T + F   +++  +   +G+LVT++PGFNG  PSKHY+GYV +DE   K LFYYFV 
Sbjct  2    LHSTPINFSCAIVEAVQ---NGSLVTQLPGFNGVFPSKHYSGYVKVDE---KNLFYYFVV  55

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GK   SLPTLHLNPYSW+KV+NI
Sbjct  56   SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGKPKRSLPTLHLNPYSWSKVSNI  115

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP GVG SYS N + YITGD +TA+D+H FLLKWF LY EF+ NPF+I+GESYAG+
Sbjct  116  IYLDSPVGVGFSYSKNTSTYITGDRQTAADTHAFLLKWFALYPEFVSNPFYISGESYAGI  175

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ EVV+GI A  KP +NF
Sbjct  176  YVPTLASEVVKGIKAGAKPRINF  198



>ref|XP_004148941.1| PREDICTED: serine carboxypeptidase-like 20-like [Cucumis sativus]
 ref|XP_004161537.1| PREDICTED: serine carboxypeptidase-like 20-like [Cucumis sativus]
 gb|KGN44716.1| hypothetical protein Csa_7G374580 [Cucumis sativus]
Length=485

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = +2

Query  101  LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKD  280
            ++PLL       + A +T +PGF+G+LPSKHY+GYV I++  G+ LFYYFVESERNP +D
Sbjct  8    VIPLLFFFFLLANSAPITHLPGFSGSLPSKHYSGYVEINKEHGRNLFYYFVESERNPVED  67

Query  281  PVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSG  460
            PVVLWLNGGPGCSSFDGFVYEHGPFNFE   T G LPTLHLNPYSW+KV+NIIYLDSP+G
Sbjct  68   PVVLWLNGGPGCSSFDGFVYEHGPFNFEAASTPGGLPTLHLNPYSWSKVSNIIYLDSPAG  127

Query  461  VGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYE  640
            VG SYS NE+DY TGD++TA DSH FLL+WF+L+ +FLPNPF+IAGESYAG+YVPTL+ +
Sbjct  128  VGFSYSKNESDYTTGDVQTALDSHKFLLEWFKLFPQFLPNPFYIAGESYAGIYVPTLATQ  187

Query  641  VVQGIDAAVKPVLNF  685
            V +G++  VKP+LNF
Sbjct  188  VFKGLETGVKPILNF  202



>ref|XP_010527287.1| PREDICTED: serine carboxypeptidase-like 20 isoform X3 [Tarenaya 
hassleriana]
Length=493

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 165/204 (81%), Gaps = 1/204 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQL-TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFV  253
            +  + V  +L L  L T SAP+ ALVT +PGFNGTLPSKHYAGYVTI E   K L+YYF 
Sbjct  5    VEASAVALILSLAVLITHSAPESALVTTLPGFNGTLPSKHYAGYVTIGEKGDKNLWYYFA  64

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
            ESE++P++DPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT GSLP L LNPYSW+KV+N
Sbjct  65   ESEKDPAEDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTDGSLPQLRLNPYSWSKVSN  124

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            IIYLDSP+GVG SYS +E+DY T D +TA D+H FLLKWFE + EF  NPFFI+GES+AG
Sbjct  125  IIYLDSPAGVGFSYSKDESDYSTNDTQTAIDTHAFLLKWFETFPEFQSNPFFISGESFAG  184

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            +YVPTL+ EVV GI  +VKPV+NF
Sbjct  185  IYVPTLASEVVNGIKGSVKPVINF  208



>gb|KCW58763.1| hypothetical protein EUGRSUZ_H01399 [Eucalyptus grandis]
Length=469

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVES  259
             ++   LL  +    +AP  +L+T +PGF+GTL S+HYAGYVTID + GKK LFYYF+ S
Sbjct  6    CSITLALLLTVSSVSAAPKESLITSLPGFDGTLTSEHYAGYVTIDGSPGKKNLFYYFIAS  65

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            ER PSKDP+VLWLNGGPGCSSFDGF+YEHGPF F  GK  GSLP LHLNP+SW+KV+NII
Sbjct  66   ERKPSKDPLVLWLNGGPGCSSFDGFIYEHGPFKFHAGKPEGSLPVLHLNPFSWSKVSNII  125

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            YLDSP GVGLSYSDN  +Y+TGDL+TASD+H FLLKWFELY EFL NPF+I+GESYAGVY
Sbjct  126  YLDSPCGVGLSYSDNPKNYVTGDLQTASDTHAFLLKWFELYPEFLSNPFYISGESYAGVY  185

Query  620  VPTLSYEVVQGIDAAVKPVLNF  685
            VPTL+ EVV+GI     P++NF
Sbjct  186  VPTLASEVVKGIQIGETPLINF  207



>ref|XP_010068275.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=689

 Score =   299 bits (766),  Expect = 3e-93, Method: Composition-based stats.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVESERNPSKDPVVLWLNG  304
            +APD +L+T +PGF+G+LPS HYAGYV I    GKK LFYYF+ SERNPSKDPVVLWLNG
Sbjct  212  AAPDESLITHVPGFDGSLPSSHYAGYVAIPGNPGKKNLFYYFIASERNPSKDPVVLWLNG  271

Query  305  GPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN  484
            GPGCSSF GFV+EHGPFNF+ GK++GSLP L LNP+SW+KV+NIIYL+SP GVG SYS+N
Sbjct  272  GPGCSSFYGFVFEHGPFNFQAGKSNGSLPILQLNPFSWSKVSNIIYLESPCGVGFSYSNN  331

Query  485  ETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAA  664
              +Y TGDL+TASD+H FLLKWFELY E+L NPF+I+GESYAGVYVPTL+  VV+GI   
Sbjct  332  PRNYATGDLQTASDTHAFLLKWFELYPEYLSNPFYISGESYAGVYVPTLASNVVKGIKKG  391

Query  665  VKPVLNF  685
             KP++NF
Sbjct  392  EKPLINF  398



>gb|EPS74136.1| hypothetical protein M569_00619, partial [Genlisea aurea]
Length=478

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            S  +GAL++RIPGF+G   S H+AGYVTID+T GK+L+YY VESE NPS DPVVLWLNGG
Sbjct  19   SVQEGALISRIPGFDGNFSSDHHAGYVTIDDTYGKRLYYYLVESESNPSTDPVVLWLNGG  78

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYEHGPFNFE  + SGSLP LH NP+SW+KV+NIIYLDSP+GVG S S NE
Sbjct  79   PGCSSFDGFVYEHGPFNFEAAQPSGSLPILHPNPHSWSKVSNIIYLDSPAGVGFSCSGNE  138

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY+TGDLKTASDS+TFLLKWF+LY EF  NPFFI+GESYAG+YVPTL+Y V  GIDA  
Sbjct  139  SDYVTGDLKTASDSYTFLLKWFDLYPEFSSNPFFISGESYAGIYVPTLAYAVANGIDAGT  198

Query  668  KPVLNF  685
             P +NF
Sbjct  199  LPKINF  204



>ref|XP_010070157.1| PREDICTED: serine carboxypeptidase 1-like [Eucalyptus grandis]
 gb|KCW58762.1| hypothetical protein EUGRSUZ_H01399 [Eucalyptus grandis]
Length=490

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVES  259
             ++   LL  +    +AP  +L+T +PGF+GTL S+HYAGYVTID + GKK LFYYF+ S
Sbjct  6    CSITLALLLTVSSVSAAPKESLITSLPGFDGTLTSEHYAGYVTIDGSPGKKNLFYYFIAS  65

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            ER PSKDP+VLWLNGGPGCSSFDGF+YEHGPF F  GK  GSLP LHLNP+SW+KV+NII
Sbjct  66   ERKPSKDPLVLWLNGGPGCSSFDGFIYEHGPFKFHAGKPEGSLPVLHLNPFSWSKVSNII  125

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            YLDSP GVGLSYSDN  +Y+TGDL+TASD+H FLLKWFELY EFL NPF+I+GESYAGVY
Sbjct  126  YLDSPCGVGLSYSDNPKNYVTGDLQTASDTHAFLLKWFELYPEFLSNPFYISGESYAGVY  185

Query  620  VPTLSYEVVQGIDAAVKPVLNF  685
            VPTL+ EVV+GI     P++NF
Sbjct  186  VPTLASEVVKGIQIGETPLINF  207



>ref|XP_007029290.1| Serine carboxypeptidase-like 20 isoform 2, partial [Theobroma 
cacao]
 gb|EOY09792.1| Serine carboxypeptidase-like 20 isoform 2, partial [Theobroma 
cacao]
Length=467

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C L     + ++  +G+LVT++PGFNG  PSKHY+GYV +DE   K LFYYFV SERNPS
Sbjct  11   CMLFSC-AIVEAVQNGSLVTQLPGFNGVFPSKHYSGYVKVDE---KNLFYYFVVSERNPS  66

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GK   SLPTLHLNPYSW+KV+NIIYLDSP
Sbjct  67   KDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGKPKRSLPTLHLNPYSWSKVSNIIYLDSP  126

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N + YITGD +TA+D+H FLLKWF LY EF+ NPF+I+GESYAG+YVPTL+
Sbjct  127  VGVGFSYSKNTSTYITGDRQTAADTHAFLLKWFALYPEFVSNPFYISGESYAGIYVPTLA  186

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP +NF
Sbjct  187  SEVVKGIKAGAKPRINF  203



>ref|XP_004492244.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=493

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            LT+SAP  +LVT +PGFNG+L SKHYAGYVT+DE+ G+ L+YYFVESE NPSKDPVVLWL
Sbjct  18   LTQSAPQDSLVTNLPGFNGSLNSKHYAGYVTVDESHGRNLYYYFVESESNPSKDPVVLWL  77

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFV+EHGPFNFE   T G+LP L  NPYSW+KV+NIIYLDSP+GVG SYS
Sbjct  78   NGGPGCSSFDGFVFEHGPFNFEKPATKGALPKLQPNPYSWSKVSNIIYLDSPAGVGFSYS  137

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGD++TA DSH FLLKWFELY EF  NP F++GESYAGVYVPTL+ +VV GI+
Sbjct  138  KNVSDYKTGDIQTAYDSHIFLLKWFELYPEFQANPLFLSGESYAGVYVPTLANQVVIGIE  197

Query  659  AAVKPVLNF  685
               KP LNF
Sbjct  198  NGTKPTLNF  206



>gb|AES78951.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L L L+   L  + + +SAP  +L+T++PGF+G +PSKHYAGYVT+D+  GK L+YYFVE
Sbjct  7    LCLVLLHIFLSFVPI-QSAPRKSLITKLPGFSGIIPSKHYAGYVTLDKIHGKNLYYYFVE  65

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE NPSKDP+VLWLNGGP CSSFDGF+YEHGPFNF   KT G+LPTL LNPYSW+KV+NI
Sbjct  66   SEGNPSKDPLVLWLNGGPACSSFDGFIYEHGPFNFIKPKTKGTLPTLQLNPYSWSKVSNI  125

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP G G SYS NE+DY TGD KTA D+HTFLL+WF+LY EFL NP FIAGESYAG+
Sbjct  126  IYLDSPVGTGFSYSRNESDYYTGDTKTAFDTHTFLLQWFKLYPEFLANPLFIAGESYAGI  185

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ ++V+GI+A +KP LNF
Sbjct  186  YVPTLADKIVEGIEAGIKPKLNF  208



>ref|XP_003622733.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=492

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L L L+   L  + + +SAP  +L+T++PGF+G +PSKHYAGYVT+D+  GK L+YYFVE
Sbjct  4    LCLVLLHIFLSFVPI-QSAPRKSLITKLPGFSGIIPSKHYAGYVTLDKIHGKNLYYYFVE  62

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE NPSKDP+VLWLNGGP CSSFDGF+YEHGPFNF   KT G+LPTL LNPYSW+KV+NI
Sbjct  63   SEGNPSKDPLVLWLNGGPACSSFDGFIYEHGPFNFIKPKTKGTLPTLQLNPYSWSKVSNI  122

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP G G SYS NE+DY TGD KTA D+HTFLL+WF+LY EFL NP FIAGESYAG+
Sbjct  123  IYLDSPVGTGFSYSRNESDYYTGDTKTAFDTHTFLLQWFKLYPEFLANPLFIAGESYAGI  182

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ ++V+GI+A +KP LNF
Sbjct  183  YVPTLADKIVEGIEAGIKPKLNF  205



>ref|XP_010527288.1| PREDICTED: serine carboxypeptidase-like 20 [Tarenaya hassleriana]
Length=492

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            +T SAP+ ALVT +PGFNGTLPSKHYAGYVTIDE   K L+YYF ESE++P++DPVVLWL
Sbjct  20   ITHSAPESALVTTLPGFNGTLPSKHYAGYVTIDEKRDKNLWYYFAESEKDPAEDPVVLWL  79

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSS DGFVYEHGPF+F+  KT GSLP L LNPYSW+KV+NIIYLDSP+GVG SYS
Sbjct  80   NGGPGCSSMDGFVYEHGPFDFKQAKTDGSLPQLRLNPYSWSKVSNIIYLDSPAGVGFSYS  139

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
            + ++DY T D +TA D+H FLLKWF ++ EF  NPF+I+GESYAG+YVPTL+ EVV GI 
Sbjct  140  ETKSDYSTNDTQTAIDAHAFLLKWFRMFPEFQSNPFYISGESYAGIYVPTLASEVVNGIK  199

Query  659  AAVKPVLNF  685
              VKPV+NF
Sbjct  200  DGVKPVINF  208



>gb|KCW58765.1| hypothetical protein EUGRSUZ_H01401, partial [Eucalyptus grandis]
Length=211

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  80   HLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET-SGKKLFYYFVE  256
            H+ L+  +L  +  T+ AP  +LVT +PGF GT PS HY+GYV ID+  +G+ LFYY V 
Sbjct  8    HVNLLFCMLLSVAFTEGAPKESLVTSLPGFTGTFPSHHYSGYVNIDDNPAGRNLFYYLVV  67

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERN + DPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GKT+ +LPTLHLNPYSW+K +NI
Sbjct  68   SERNSTIDPVVLWLNGGPGCSSFDGFVYEHGPFNFQAGKTTSALPTLHLNPYSWSKASNI  127

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            +YLDSP GVGLSYS +  +Y TGDL+TA+ +H FLLKWFEL+ EFL NPF+IAGESYAGV
Sbjct  128  VYLDSPCGVGLSYSTDSNNYNTGDLQTAAATHAFLLKWFELFPEFLNNPFYIAGESYAGV  187

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ EVV+GI+   K  +NF
Sbjct  188  YVPTLAAEVVKGINEGAKLFINF  210



>gb|KHG03245.1| Serine carboxypeptidase 1 [Gossypium arboreum]
Length=466

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 161/197 (82%), Gaps = 3/197 (2%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C LL      ++AP+ +L+T +PGFNG  PSKHY+GYV+I +   K LFYYFV SERNP 
Sbjct  12   CMLLLFSTFIEAAPNDSLITHLPGFNGDFPSKHYSGYVSIGK---KNLFYYFVVSERNPG  68

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ G   GSLPTLHLNPYSW+KV+NIIYLDSP
Sbjct  69   KDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGSPKGSLPTLHLNPYSWSKVSNIIYLDSP  128

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
            +GVG SYS N ++YITGD KTA+D+H FLLKWF LY EF+ NPF+IAGESYAG+YVPTLS
Sbjct  129  AGVGFSYSWNISEYITGDHKTATDTHAFLLKWFGLYPEFVSNPFYIAGESYAGIYVPTLS  188

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI    KP +NF
Sbjct  189  SEVVKGIKVGAKPTINF  205



>ref|XP_010520851.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Tarenaya 
hassleriana]
Length=537

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +2

Query  62   KNGLPLHLTLVCFLLPLLQ-LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKL  238
            + G  +  + V  +L L+  +T SAP+ ALVT +PGFNGTLPSKHYAGYVTIDE  GK L
Sbjct  45   RMGRFVEASAVALILSLVVVITHSAPESALVTTLPGFNGTLPSKHYAGYVTIDEKRGKNL  104

Query  239  FYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSW  418
            +YYF ESE++P++DPVVLWLNGGPGCSS DGFVYEHGPF+F+  KT GSLP L  NPYSW
Sbjct  105  WYYFAESEKDPAEDPVVLWLNGGPGCSSMDGFVYEHGPFDFKQAKTDGSLPQLRRNPYSW  164

Query  419  TKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAG  598
            +KV+NIIYLDSP+GVG SYS+ ++DY T D +TA D+H FLLKWF ++ EF  NPF+I+G
Sbjct  165  SKVSNIIYLDSPAGVGFSYSETKSDYSTNDTQTAIDAHAFLLKWFRMFPEFQSNPFYISG  224

Query  599  ESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            ESYAG+YVPTL+ EVV GI   VKPV+NF
Sbjct  225  ESYAGIYVPTLASEVVNGIKDGVKPVINF  253



>ref|XP_011013064.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Populus 
euphratica]
Length=495

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            +C LL    + ++AP G+L+T +PGFNG  PS HY+GY+T D+   K LFYYF+ SERNP
Sbjct  14   ICVLLNFASV-EAAPKGSLITELPGFNGVFPSNHYSGYITFDD---KNLFYYFIVSERNP  69

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE GK  GSLP LHLNPYSW+KV+NIIYLDS
Sbjct  70   SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEEGKPKGSLPILHLNPYSWSKVSNIIYLDS  129

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P GVG+SYS N++ YI  DL+TA+D+H FLL+WF LY EF+ N F+I+GESYAG+YVPTL
Sbjct  130  PCGVGMSYSKNQSKYINDDLQTAADTHNFLLQWFRLYPEFVNNQFYISGESYAGIYVPTL  189

Query  632  SYEVVQGIDAAVKPVLNF  685
            S EVV+GI A   PV+NF
Sbjct  190  SAEVVKGIQAGQDPVINF  207



>ref|XP_010649231.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Vitis 
vinifera]
Length=496

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 163/203 (80%), Gaps = 0/203 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L  + +C L   +  T++AP G+L+T +PGFNGT PSKHY+GYV I     K LFYYFV 
Sbjct  8    LFTSSLCILFSFVVFTEAAPKGSLITHLPGFNGTFPSKHYSGYVDIGGEPAKNLFYYFVV  67

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNP KDP+VLWLNGGPGCSSFDGFVYEHGPFNFE GKT  SLPTLHLNPYSW+KV+++
Sbjct  68   SERNPGKDPLVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTPNSLPTLHLNPYSWSKVSSM  127

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP+GVG S+S N   Y TGDL+TASD+H FLL+WF+ + EF+ NPF+++GESYAGV
Sbjct  128  IYLDSPAGVGFSFSKNTWQYNTGDLQTASDTHEFLLRWFKEFPEFITNPFYVSGESYAGV  187

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTLS  +V+GI +  KP +NF
Sbjct  188  YVPTLSAAIVKGIKSGAKPTINF  210



>ref|XP_007029289.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
 gb|EOY09791.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
Length=498

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 161/197 (82%), Gaps = 4/197 (2%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C L     + ++  +G+LVT++PGFNG  PSKHY+GYV +DE   K LFYYFV SERNPS
Sbjct  11   CMLFSC-AIVEAVQNGSLVTQLPGFNGVFPSKHYSGYVKVDE---KNLFYYFVVSERNPS  66

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GK   SLPTLHLNPYSW+KV+NIIYLDSP
Sbjct  67   KDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGKPKRSLPTLHLNPYSWSKVSNIIYLDSP  126

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SYS N + YITGD +TA+D+H FLLKWF LY EF+ NPF+I+GESYAG+YVPTL+
Sbjct  127  VGVGFSYSKNTSTYITGDRQTAADTHAFLLKWFALYPEFVSNPFYISGESYAGIYVPTLA  186

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI A  KP +NF
Sbjct  187  SEVVKGIKAGAKPRINF  203



>ref|XP_004515043.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=506

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            LT+SAP  +LVT +PGFNG+L S HYAGYVT+DE+ G+ L+YYFVESE NPSKDPVVLWL
Sbjct  17   LTQSAPQDSLVTNLPGFNGSLNSNHYAGYVTVDESHGRNLYYYFVESESNPSKDPVVLWL  76

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSS DGFV+EHGPFNFE   T G+LP L LNPYSW+KV+NIIYLDSP+GVG SYS
Sbjct  77   NGGPGCSSLDGFVFEHGPFNFEKPATKGALPNLQLNPYSWSKVSNIIYLDSPAGVGFSYS  136

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N +DY TGD++TA DSH FLLKWFELY EF  NP F++GESYAGVYVPTL+ ++V GI+
Sbjct  137  KNVSDYKTGDIQTAYDSHNFLLKWFELYPEFQANPLFLSGESYAGVYVPTLANQIVIGIE  196

Query  659  AAVKPVLNF  685
               KP LNF
Sbjct  197  NGTKPTLNF  205



>emb|CBI17614.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = +2

Query  44   SYLNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET  223
            ++  M      L  + +C L   +  T++AP G+L+T +PGFNGT PSKHY+GYV I   
Sbjct  35   NHFAMAMASFYLFTSSLCILFSFVVFTEAAPKGSLITHLPGFNGTFPSKHYSGYVDIGGE  94

Query  224  SGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHL  403
              K LFYYFV SERNP KDP+VLWLNGGPGCSSFDGFVYEHGPFNFE GKT  SLPTLHL
Sbjct  95   PAKNLFYYFVVSERNPGKDPLVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTPNSLPTLHL  154

Query  404  NPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNP  583
            NPYSW+KV+++IYLDSP+GVG S+S N   Y TGDL+TASD+H FLL+WF+ + EF+ NP
Sbjct  155  NPYSWSKVSSMIYLDSPAGVGFSFSKNTWQYNTGDLQTASDTHEFLLRWFKEFPEFITNP  214

Query  584  FFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            F+++GESYAGVYVPTLS  +V+GI +  KP +NF
Sbjct  215  FYVSGESYAGVYVPTLSAAIVKGIKSGAKPTINF  248



>gb|KHN29264.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=488

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP  +L+T++PGFN   PSKHY+GY++ID    SGK LFYYFV SER+P KDPVVLWL
Sbjct  11   QAAPAPSLITQLPGFNANFPSKHYSGYISIDGNTESGKNLFYYFVSSERSPEKDPVVLWL  70

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE   + G+LPTLH+NPYSW+KV+NIIYLDSP+GVGLSYS
Sbjct  71   NGGPGCSSFDGFVYEHGPFNFEAANSKGNLPTLHINPYSWSKVSNIIYLDSPAGVGLSYS  130

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N + Y TGDL+TASD+H FLLKWF+ + EF  NPF+IAGESYAGVYVPTL++EV +GI 
Sbjct  131  KNTSKYATGDLETASDTHVFLLKWFQQFPEFQANPFYIAGESYAGVYVPTLAFEVAKGIR  190

Query  659  AAVKPVLNF  685
            +  KPV+NF
Sbjct  191  SGTKPVINF  199



>ref|XP_010527284.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Tarenaya 
hassleriana]
Length=499

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 165/212 (78%), Gaps = 9/212 (4%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKS---------APDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            + +  + FL P L  T +         AP+ ALVT +PGFNGTLPSKHYAGYVTI E   
Sbjct  3    VQIIKIFFLFPHLFRTNTKSITPPSLRAPESALVTTLPGFNGTLPSKHYAGYVTIGEKGD  62

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            K L+YYF ESE++P++DPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT GSLP L LNP
Sbjct  63   KNLWYYFAESEKDPAEDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTDGSLPQLRLNP  122

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+NIIYLDSP+GVG SYS +E+DY T D +TA D+H FLLKWFE + EF  NPFF
Sbjct  123  YSWSKVSNIIYLDSPAGVGFSYSKDESDYSTNDTQTAIDTHAFLLKWFETFPEFQSNPFF  182

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            I+GES+AG+YVPTL+ EVV GI  +VKPV+NF
Sbjct  183  ISGESFAGIYVPTLASEVVNGIKGSVKPVINF  214



>gb|KJB26857.1| hypothetical protein B456_004G263400 [Gossypium raimondii]
Length=492

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = +2

Query  95   CFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPS  274
            C LL      ++AP+ +L+T +PGFNG  PSKHY+GYV I E   K LFYY V SERNP 
Sbjct  12   CMLLLFSTFIEAAPNDSLITHLPGFNGDFPSKHYSGYVRIGE---KNLFYYLVVSERNPG  68

Query  275  KDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSP  454
            KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+ G   GSLPTLHLNPYSW+KV+NIIYLDSP
Sbjct  69   KDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEGSPKGSLPTLHLNPYSWSKVSNIIYLDSP  128

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
            +GVG SYS N ++YITGD KTA+D+H FLLKWF LY EF+ NPF+IAGESYAG+YVPTLS
Sbjct  129  AGVGFSYSWNISEYITGDHKTATDTHAFLLKWFGLYPEFVSNPFYIAGESYAGIYVPTLS  188

Query  635  YEVVQGIDAAVKPVLNF  685
             EVV+GI    KP +NF
Sbjct  189  SEVVKGIKVGAKPTINF  205



>ref|XP_010026283.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=609

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT----KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYY  247
            L  +C +   L LT    ++AP  +L+T +PGF+GTLPS+HYAGYV+I  + GKK LFYY
Sbjct  221  LKFICSVTLALLLTVSYVRAAPKESLITSLPGFDGTLPSEHYAGYVSIYGSPGKKNLFYY  280

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
            F+ SER PSKDP++LWLNGGPGCSSFDGF+YEHGPF F  GK  GSLP LHLNP+SW+KV
Sbjct  281  FIASERKPSKDPLLLWLNGGPGCSSFDGFIYEHGPFKFHAGKPKGSLPLLHLNPFSWSKV  340

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +NIIYLDSP GVGLSYSDN  +Y+TGDL+TASD+H FLLKWFELY EFL NPF+I+GESY
Sbjct  341  SNIIYLDSPCGVGLSYSDNPKNYVTGDLQTASDTHAFLLKWFELYPEFLSNPFYISGESY  400

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AGVYVPTL+ EVV+GI     P++NF
Sbjct  401  AGVYVPTLASEVVKGIQIGEMPLINF  426



>ref|XP_010520852.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Tarenaya 
hassleriana]
Length=498

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 166/214 (78%), Gaps = 9/214 (4%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKS---------APDGALVTRIPGFNGTLPSKHYAGYVTIDET  223
            + + +  + FL P L  T +         AP+ ALVT +PGFNGTLPSKHYAGYVTIDE 
Sbjct  1    MHVQIIKIFFLFPHLFRTNTKSITPPSLRAPESALVTTLPGFNGTLPSKHYAGYVTIDEK  60

Query  224  SGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHL  403
             GK L+YYF ESE++P++DPVVLWLNGGPGCSS DGFVYEHGPF+F+  KT GSLP L  
Sbjct  61   RGKNLWYYFAESEKDPAEDPVVLWLNGGPGCSSMDGFVYEHGPFDFKQAKTDGSLPQLRR  120

Query  404  NPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNP  583
            NPYSW+KV+NIIYLDSP+GVG SYS+ ++DY T D +TA D+H FLLKWF ++ EF  NP
Sbjct  121  NPYSWSKVSNIIYLDSPAGVGFSYSETKSDYSTNDTQTAIDAHAFLLKWFRMFPEFQSNP  180

Query  584  FFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            F+I+GESYAG+YVPTL+ EVV GI   VKPV+NF
Sbjct  181  FYISGESYAGIYVPTLASEVVNGIKDGVKPVINF  214



>ref|XP_003622732.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=600

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 167/204 (82%), Gaps = 7/204 (3%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            LH++L         LT SAP G+L+T +PGFNG+LPSKHYAGYVT+D+  G+ L+YYFVE
Sbjct  9    LHISLT------FVLTHSAPKGSLITHLPGFNGSLPSKHYAGYVTVDKNHGRNLYYYFVE  62

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE N SKDP+VLWLNGGPGCSSFDGFVYEHGPFNFE  KT G+LP L  NPYSW+KV+NI
Sbjct  63   SEGNSSKDPLVLWLNGGPGCSSFDGFVYEHGPFNFEKPKTKGTLPKLKPNPYSWSKVSNI  122

Query  437  IYLDSPSGVGLSYSDNETDYIT-GDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            IYLDSP+GVG SYS N +DY + GD+KTASD++TFLLKWFELY EFL NP FI+GESYAG
Sbjct  123  IYLDSPAGVGFSYSKNLSDYKSAGDVKTASDTYTFLLKWFELYPEFLANPLFISGESYAG  182

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            VYVPTL+  +V+GI+A  KP  NF
Sbjct  183  VYVPTLADLIVKGIEAGTKPKFNF  206



>ref|XP_010649230.1| PREDICTED: serine carboxypeptidase-like 20 [Vitis vinifera]
Length=496

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            +C L   +  T++AP G+L+T +PGFNG  PSKHY+GYV I     K LFYYFV SERNP
Sbjct  13   LCMLFSFVVFTEAAPKGSLITHLPGFNGIFPSKHYSGYVDIGGEPAKNLFYYFVVSERNP  72

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            +KDP+VLWLNGGPGCSSFDGFVYEHGPFNFE GKT  SLPTLHLNPYSW+KV+++IYLDS
Sbjct  73   AKDPLVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTPISLPTLHLNPYSWSKVSSMIYLDS  132

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P+GVG S+S N   Y TGD++TASD+H FLL+WF+ + EF+ NPF+++GESYAGVYVPTL
Sbjct  133  PTGVGFSFSKNTWQYKTGDVQTASDTHEFLLRWFKEFPEFITNPFYVSGESYAGVYVPTL  192

Query  632  SYEVVQGIDAAVKPVLNF  685
            S  +V+GI +  KP +NF
Sbjct  193  SAAIVKGIKSGAKPTINF  210



>gb|KHN40479.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=506

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP  +L+T++PGFN   PSKHY+GY++ID    SGK LFYYFV SE +P KDPVVLWL
Sbjct  29   QAAPSPSLITQLPGFNANFPSKHYSGYISIDGNAESGKNLFYYFVSSESSPEKDPVVLWL  88

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE   + G+LPTLH+NPYSW+KV+NIIYLDSP+GVGLSYS
Sbjct  89   NGGPGCSSFDGFVYEHGPFNFEAANSKGNLPTLHINPYSWSKVSNIIYLDSPAGVGLSYS  148

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N + Y TGDL+TASD+H FLLKWF+ + EF  NPF+IAGESYAGVYVPTL++EV +GI 
Sbjct  149  KNTSKYATGDLETASDTHVFLLKWFQQFPEFQANPFYIAGESYAGVYVPTLAFEVAKGIR  208

Query  659  AAVKPVLNF  685
            +  KPV+NF
Sbjct  209  SGTKPVINF  217



>gb|EEE53029.1| hypothetical protein OsJ_35748 [Oryza sativa Japonica Group]
Length=512

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSK--HYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            + ++AP  A+V  +PGF+G LPSK      YVT++E  G+ LFYY VESER+P+KDP+VL
Sbjct  33   VCEAAPASAVVKSVPGFDGALPSKPLRPGTYVTVEEQHGRNLFYYLVESERDPAKDPLVL  92

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSSFDGFVYEHGPFNFE G ++ SLP LHLNPYSW+KV+++IYLDSP+GVGLS
Sbjct  93   WLNGGPGCSSFDGFVYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLS  152

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+G
Sbjct  153  YSKNTSDYNTGDLKTAADSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKG  212

Query  653  IDAAVKPVLNF  685
            +   VKP +NF
Sbjct  213  LHDGVKPTINF  223



>ref|XP_003534508.1| PREDICTED: serine carboxypeptidase-like 20-like [Glycine max]
Length=506

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 3/204 (1%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT-KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFV  253
            ++++C LL    ++ ++AP  +L+T++PGFN   PSKHY+GY++ID    SGK LFYYFV
Sbjct  14   VSILCMLLSGHWISVQAAPAPSLITQLPGFNANFPSKHYSGYISIDGNTESGKNLFYYFV  73

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
             SER+P KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE   + G+LPTLH+NPYSW+KV++
Sbjct  74   SSERSPEKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAANSKGNLPTLHINPYSWSKVSS  133

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            +IYLDSP+GVG SYS N + Y TGDL+TASD+H FLLKWF+ + EF  NPF+IAGESYAG
Sbjct  134  VIYLDSPAGVGFSYSKNTSKYATGDLETASDTHLFLLKWFQQFPEFQANPFYIAGESYAG  193

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            VYVPTL++EV +GI +  KPV+NF
Sbjct  194  VYVPTLAFEVAKGIRSGTKPVINF  217



>ref|XP_003552449.1| PREDICTED: serine carboxypeptidase-like 20-like isoform 1 [Glycine 
max]
Length=506

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP  +L+T++PGFN   PSKHY+GY++ID    SGK LFYYFV SE +P KDPVVLWL
Sbjct  29   QAAPSPSLITQLPGFNANFPSKHYSGYISIDGNAESGKNLFYYFVSSESSPEKDPVVLWL  88

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE   + G+LPTLH+NPYSW+KV+NIIYLDSP+GVGLSYS
Sbjct  89   NGGPGCSSFDGFVYEHGPFNFEAANSKGNLPTLHINPYSWSKVSNIIYLDSPAGVGLSYS  148

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N + Y TGDL+TASD+H FLLKWF+ + EF  NPF+IAGESYAGVYVPTL++EV +GI 
Sbjct  149  KNTSKYATGDLETASDTHVFLLKWFQQFPEFQANPFYIAGESYAGVYVPTLAFEVAKGIR  208

Query  659  AAVKPVLNF  685
            +  KPV+NF
Sbjct  209  SGTKPVINF  217



>gb|KEH23401.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=463

 Score =   286 bits (733),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESER  265
            +C  L L+   ++AP G+L+T++PGF+G   S HY+GY++I+    SGK LFYYFV SER
Sbjct  10   LCMFL-LVLFVEAAPQGSLITQLPGFSGKFLSNHYSGYISIEGNAESGKNLFYYFVSSER  68

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            NP  DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K+ G+LPTLH NPYSW+K++NIIYL
Sbjct  69   NPRNDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKSKGNLPTLHNNPYSWSKISNIIYL  128

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVG SYS+N ++YITGDL+TASD+H FLLKWFE + EF  NPF+++GESYAG+YVP
Sbjct  129  DSPTGVGFSYSNNISNYITGDLQTASDTHAFLLKWFEQFPEFQTNPFYVSGESYAGIYVP  188

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL++E+ +GI +  KPV+N 
Sbjct  189  TLAFEIAKGIQSRAKPVINL  208



>ref|XP_002514835.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47389.1| serine carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 167/211 (79%), Gaps = 8/211 (4%)
 Frame = +2

Query  56   MVKNGLPLHLTL-VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGK  232
            M K+ L     L VC  L +    +SAP  AL+T++PGFNGT PSKHY GYV+ +E   K
Sbjct  1    MAKSKLYFFWVLSVCLALRI----ESAPQDALITQLPGFNGTFPSKHYGGYVSFEE---K  53

Query  233  KLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPY  412
             LFYYF+ SERNPS+DPVVLWLNGGPGCSSFDGFVYEHGPFN+E G+  GSLP LH+NPY
Sbjct  54   NLFYYFIVSERNPSEDPVVLWLNGGPGCSSFDGFVYEHGPFNYEEGQPKGSLPMLHVNPY  113

Query  413  SWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFI  592
            SW+KV+NIIYLDSP GVGLSYS+N   Y T D  TA D+HTFLLKWF +Y EF+ NPF+I
Sbjct  114  SWSKVSNIIYLDSPCGVGLSYSNNTNKYTTDDWHTAVDTHTFLLKWFNIYPEFVKNPFYI  173

Query  593  AGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +GESYAG+YVPTL++EVV+GI + V+P +NF
Sbjct  174  SGESYAGIYVPTLAFEVVKGIKSGVQPSINF  204



>ref|XP_008388814.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=505

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 163/202 (81%), Gaps = 4/202 (2%)
 Frame = +2

Query  83   LTLVCFL-LPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVES  259
            L+L C L + L+ + ++AP  +LVT +PGFN T PSKHY+GY++ID   GK LFYYFV S
Sbjct  10   LSLCCMLFVSLVVIIEAAPQSSLVTHLPGFNATFPSKHYSGYISID---GKNLFYYFVVS  66

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            E NP+ DPVVLWLNGGPGCSSFDGFVYEHGPFNF  GK  G+LP LHLNPYSW+KV+NII
Sbjct  67   EGNPATDPVVLWLNGGPGCSSFDGFVYEHGPFNFAEGKPKGALPVLHLNPYSWSKVSNII  126

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            YLDSP+GVG SYS N+T Y TGD++TA D+H FLL+WF+ + EF PNPF+I+GESYAGVY
Sbjct  127  YLDSPAGVGFSYSRNQTKYTTGDIQTALDTHAFLLRWFQQFPEFQPNPFYISGESYAGVY  186

Query  620  VPTLSYEVVQGIDAAVKPVLNF  685
            VPTL+ ++ +GI+   KP LN 
Sbjct  187  VPTLASQIAKGINKGTKPTLNL  208



>ref|XP_003624187.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES80405.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=498

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESER  265
            +C  L L+   ++AP G+L+T++PGF+G   S HY+GY++I+    SGK LFYYFV SER
Sbjct  10   LCMFL-LVLFVEAAPQGSLITQLPGFSGKFLSNHYSGYISIEGNAESGKNLFYYFVSSER  68

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            NP  DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K+ G+LPTLH NPYSW+K++NIIYL
Sbjct  69   NPRNDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKSKGNLPTLHNNPYSWSKISNIIYL  128

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVG SYS+N ++YITGDL+TASD+H FLLKWFE + EF  NPF+++GESYAG+YVP
Sbjct  129  DSPTGVGFSYSNNISNYITGDLQTASDTHAFLLKWFEQFPEFQTNPFYVSGESYAGIYVP  188

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL++E+ +GI +  KPV+N 
Sbjct  189  TLAFEIAKGIQSRAKPVINL  208



>ref|XP_010026202.1| PREDICTED: serine carboxypeptidase 1-like [Eucalyptus grandis]
Length=232

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 162/202 (80%), Gaps = 1/202 (0%)
 Frame = +2

Query  80   HLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET-SGKKLFYYFVE  256
            H+ L+  +L  +  T+ AP  +LVT +PGF GT PS HY+GYV ID+  +G+ LFYY V 
Sbjct  8    HVNLLFCMLLSVAFTEGAPKESLVTSLPGFTGTFPSHHYSGYVNIDDNPAGRNLFYYLVV  67

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERN + DPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GKT+ +LPTLHLNPYSW+K +NI
Sbjct  68   SERNSTIDPVVLWLNGGPGCSSFDGFVYEHGPFNFQAGKTTSALPTLHLNPYSWSKASNI  127

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            +YLDSP GVGLSYS +  +Y TGDL+TA+ +H FLLKWFEL+ EFL NPF+IAGESYAGV
Sbjct  128  VYLDSPCGVGLSYSTDSNNYNTGDLQTAAATHAFLLKWFELFPEFLNNPFYIAGESYAGV  187

Query  617  YVPTLSYEVVQGIDAAVKPVLN  682
            YVPTL+ EVV+G+++     +N
Sbjct  188  YVPTLAAEVVKGLESGPSAGIN  209



>gb|AGV54426.1| serine carboxypeptidase-like protein [Phaseolus vulgaris]
Length=502

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP  +LV ++PGFN   PSKHY+GY++ID  + +GK+LFYY V SER+  KDPVVLWL
Sbjct  24   QAAPPHSLVAQLPGFNSNFPSKHYSGYISIDGNDENGKRLFYYLVSSERSAEKDPVVLWL  83

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE  K+ G+ PTLH+NPYSW+KV+NIIYLDSP+GVGLSYS
Sbjct  84   NGGPGCSSFDGFVYEHGPFNFEAAKSKGNPPTLHINPYSWSKVSNIIYLDSPAGVGLSYS  143

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N + Y+TGDLKTASD+H FLLKWF+ + EF  NPF+IAGESYAG+YVPTL+ EV +GI 
Sbjct  144  KNTSKYVTGDLKTASDTHAFLLKWFQQFPEFQANPFYIAGESYAGIYVPTLASEVAKGIQ  203

Query  659  AAVKPVLNF  685
            +  KPV+NF
Sbjct  204  SGTKPVINF  212



>ref|XP_008443685.1| PREDICTED: serine carboxypeptidase 1-like isoform X1 [Cucumis 
melo]
Length=499

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +2

Query  134  PDGALVTRIPGF-NGTLPSKHYAGYVTIDE-TSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            P G+LVT +PGF N   PSKH++GY+ IDE  SGKKLFYYFV SER+P++DPVVLWLNGG
Sbjct  25   PQGSLVTHLPGFTNNNFPSKHHSGYINIDEIESGKKLFYYFVTSERSPAEDPVVLWLNGG  84

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYEHGPFNFE G   G+LPTLHLNPYSW+KV+NIIYLDSP+GVGLSYS N 
Sbjct  85   PGCSSFDGFVYEHGPFNFEEGNPKGTLPTLHLNPYSWSKVSNIIYLDSPAGVGLSYSTNH  144

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            T+YITGDL+TASD+HTFLLKWF+ + EF+ NPF+IAGESYAG+YVPTL+ +VV+G+    
Sbjct  145  TNYITGDLQTASDTHTFLLKWFKEFPEFVKNPFYIAGESYAGIYVPTLASQVVKGLKDGA  204

Query  668  KPVLNF  685
             P++N 
Sbjct  205  LPIINL  210



>ref|XP_007139719.1| hypothetical protein PHAVU_008G053600g [Phaseolus vulgaris]
 gb|ESW11713.1| hypothetical protein PHAVU_008G053600g [Phaseolus vulgaris]
Length=501

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTID--ETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP  +LVT++PGFN   PSKHY+GY++ID  + +GK+LFYY V SER+  KDPVVLWL
Sbjct  24   QAAPPHSLVTQLPGFNSNFPSKHYSGYISIDGNDENGKRLFYYLVSSERSAEKDPVVLWL  83

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSSFDGFVYEHGPFNFE  K+ G+ PTLH+NPYSW+KV+NIIY DSP+GVGLSYS
Sbjct  84   NGGPGCSSFDGFVYEHGPFNFEAAKSKGNPPTLHINPYSWSKVSNIIYFDSPAGVGLSYS  143

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
             N + Y+TGDLKTASD+H FLLKWF+ + EF  NPF+IAGESYAG+YVPTL+ EV +GI 
Sbjct  144  KNTSKYVTGDLKTASDTHAFLLKWFQQFPEFQANPFYIAGESYAGIYVPTLASEVAKGIQ  203

Query  659  AAVKPVLNF  685
            +  KPV+NF
Sbjct  204  SGTKPVINF  212



>ref|XP_010527286.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Tarenaya 
hassleriana]
Length=497

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 163/210 (78%), Gaps = 7/210 (3%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTK-------SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            + +  + FL P L  T        S  + ALVT +PGFNGTLPSKHYAGYVTI E   K 
Sbjct  3    VQIIKIFFLFPHLFRTNTKSITPPSLRESALVTTLPGFNGTLPSKHYAGYVTIGEKGDKN  62

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            L+YYF ESE++P++DPVVLWLNGGPGCSS DGFVYEHGPFNFE  KT GSLP L LNPYS
Sbjct  63   LWYYFAESEKDPAEDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPAKTDGSLPQLRLNPYS  122

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP+GVG SYS +E+DY T D +TA D+H FLLKWFE + EF  NPFFI+
Sbjct  123  WSKVSNIIYLDSPAGVGFSYSKDESDYSTNDTQTAIDTHAFLLKWFETFPEFQSNPFFIS  182

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GES+AG+YVPTL+ EVV GI  +VKPV+NF
Sbjct  183  GESFAGIYVPTLASEVVNGIKGSVKPVINF  212



>ref|XP_001770944.1| predicted protein [Physcomitrella patens]
 gb|EDQ64274.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            VC  +PL ++   AP+GA V  +PGF+G LPS+H+AGYV++++T+G++LFYYFVESE +P
Sbjct  10   VCAFVPLARVL-GAPNGAAVESVPGFSGDLPSRHFAGYVSVNDTNGRELFYYFVESEGSP  68

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            + DPVVLWLNGGPGCSSFDGFVYEHGPF FE    S SLP L LNPY+W+K  NI+YLDS
Sbjct  69   ATDPVVLWLNGGPGCSSFDGFVYEHGPFKFEAAADSDSLPKLTLNPYAWSKAANILYLDS  128

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P+GVG SYS   TDYITGDL+TA D+H FLLKWF+ Y E+  NPFFI+GESYAG+YVPTL
Sbjct  129  PAGVGFSYSQTPTDYITGDLQTALDTHAFLLKWFQAYPEYQSNPFFISGESYAGIYVPTL  188

Query  632  SYEVVQGIDAAVKPVLNF  685
            S  V  GI A VKPV+NF
Sbjct  189  SRNVAHGIKAGVKPVINF  206



>ref|XP_004302166.1| PREDICTED: serine carboxypeptidase-like 20 [Fragaria vesca subsp. 
vesca]
Length=506

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 163/199 (82%), Gaps = 5/199 (3%)
 Frame = +2

Query  89   LVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERN  268
            L+C  L     T++AP  +LVT++PGFNGT PS HY+GYV+I E   K LFYYFV SE N
Sbjct  18   LICISL-TTTTTEAAPQASLVTQLPGFNGTFPSNHYSGYVSIGE---KNLFYYFVVSEGN  73

Query  269  PSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLD  448
            P+ DPVVLWLNGGPGCSSFDGFVYEHGPF+FE  K+ GSLPTLHLNPYSW+KV+NI+YLD
Sbjct  74   PADDPVVLWLNGGPGCSSFDGFVYEHGPFDFEQ-KSRGSLPTLHLNPYSWSKVSNILYLD  132

Query  449  SPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPT  628
            SP+GVG SYS++E+ Y+TGDL+TASD+H FLL WF+ Y EFL NPF+IAGESYAGVYVPT
Sbjct  133  SPAGVGFSYSEDESQYVTGDLQTASDTHAFLLSWFKQYPEFLSNPFYIAGESYAGVYVPT  192

Query  629  LSYEVVQGIDAAVKPVLNF  685
            L+++V  GI    KPVLN 
Sbjct  193  LAFQVATGIQNGTKPVLNL  211



>ref|XP_004492844.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=504

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 161/207 (78%), Gaps = 5/207 (2%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET--SGKKLFY  244
            LPL    +  L+  +   +SAP GAL+T +PGF+G   S HY+GY+ ID    +GK LFY
Sbjct  8    LPL---CIFVLVHFIIFGESAPQGALITHLPGFSGKFLSHHYSGYINIDGKGENGKNLFY  64

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFV SERNP KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  KT GSLP LH NPYSW+K
Sbjct  65   YFVSSERNPRKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKTKGSLPILHHNPYSWSK  124

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP+GVGLSYS N + YITGDL+TA D+H FLLKWFE + EF  NPF+I+GES
Sbjct  125  VSNIIYLDSPTGVGLSYSQNSSQYITGDLQTAYDTHDFLLKWFEQFPEFQANPFYISGES  184

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            YAG+YVPTL+ EV +GI    KPV+N 
Sbjct  185  YAGIYVPTLALEVAKGIRRRKKPVINL  211



>ref|XP_011077160.1| PREDICTED: serine carboxypeptidase-like 20 [Sesamum indicum]
Length=496

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 163/212 (77%), Gaps = 0/212 (0%)
 Frame = +2

Query  50   LNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            + M K  L +  T +C  L  L   ++AP+  LVT +PGF GT PSKHY+GYV +D    
Sbjct  1    MAMHKLMLLVMSTSICMFLQYLCPLEAAPEDYLVTNLPGFKGTFPSKHYSGYVKLDGNPP  60

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            K LFYYFV SER+P++DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K  G LP LHLNP
Sbjct  61   KNLFYYFVASERSPARDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKHKGGLPVLHLNP  120

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV +IIYLDSP GVG SYS N T Y+TGDL+TA+++H FLLKWFE + EF  NPF+
Sbjct  121  YSWSKVASIIYLDSPVGVGFSYSANTTYYVTGDLQTAAETHLFLLKWFEQFPEFTSNPFY  180

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            IAGESYAG+Y+PTL+ +V++GI    KPV+NF
Sbjct  181  IAGESYAGIYIPTLASDVIKGIKNGAKPVINF  212



>ref|XP_008370931.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=505

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 159/203 (78%), Gaps = 5/203 (2%)
 Frame = +2

Query  83   LTLVCFLLP--LLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L+L C L    ++ L ++ P  +LVT +PGFN T PSKHY+GY+T D   GK LFYYFV 
Sbjct  9    LSLCCMLFVSLVVNLIEAGPRSSLVTHLPGFNATFPSKHYSGYITTD---GKNLFYYFVV  65

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SER+P  DPVVLWLNGGPGCSSFDGFVYEHGPFNF  GK  G+LP LHLNPYSW+KV+NI
Sbjct  66   SERSPESDPVVLWLNGGPGCSSFDGFVYEHGPFNFAEGKPKGALPVLHLNPYSWSKVSNI  125

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP+GVG SYS N+T YITGD++TA D+H FLLKWF+ + EF PNP +I+GESYAGV
Sbjct  126  IYLDSPAGVGFSYSQNQTKYITGDIQTAHDTHAFLLKWFQQFPEFQPNPLYISGESYAGV  185

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ ++ +GI    KP LN 
Sbjct  186  YVPTLASQIAKGIKNGTKPTLNL  208



>ref|XP_008218456.1| PREDICTED: serine carboxypeptidase-like 20 [Prunus mume]
Length=504

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 165/204 (81%), Gaps = 4/204 (2%)
 Frame = +2

Query  77   LHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFV  253
            L +T+   +L + L + ++AP+ +L+T++PGFNGT PSKHY+GY++ID   GK LFYY V
Sbjct  11   LSITVCMHMLFMSLVIVEAAPESSLITQLPGFNGTFPSKHYSGYISID---GKNLFYYLV  67

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
             SER+P+ DPVVLWLNGGPGCSSFDGFVYEHGPFNF  G+  G LP LHLNPYSW+KV+N
Sbjct  68   VSERSPANDPVVLWLNGGPGCSSFDGFVYEHGPFNFAQGQPKGGLPVLHLNPYSWSKVSN  127

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            IIYLDSP+GVG SYS +E+ Y TGDL+TASD+H FLLKWFE + EFL NPF+IAGESY G
Sbjct  128  IIYLDSPAGVGFSYSKDESKYQTGDLQTASDTHAFLLKWFEQFPEFLSNPFYIAGESYGG  187

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            VYVPTL+ +V +GI+   KP LN 
Sbjct  188  VYVPTLASQVAKGINNGTKPTLNL  211



>gb|EYU39461.1| hypothetical protein MIMGU_mgv1a005253mg [Erythranthe guttata]
Length=492

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = +2

Query  59   VKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKL  238
            ++  + + +  VC  L L  L ++AP  +LV  +PGFNGT PSKHY+GYVT+     K L
Sbjct  3    MQKSMLMSVLSVCMFLQLYPL-QAAPQLSLVNNLPGFNGTFPSKHYSGYVTLKGNPAKNL  61

Query  239  FYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSW  418
            FYYFV SERNP+ DPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K  G LP LHLNPYSW
Sbjct  62   FYYFVVSERNPTTDPVVLWLNGGPGCSSFDGFVYEHGPFNFEAAKQQGGLPVLHLNPYSW  121

Query  419  TKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAG  598
            +KV N+IYLDSP GVGLSYS N + Y+  DLKTAS++H FLLKWFE + EF  NPF+I+G
Sbjct  122  SKVANMIYLDSPVGVGLSYSPNTSYYVNSDLKTASETHHFLLKWFEQFPEFSANPFYISG  181

Query  599  ESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            ESYAG+Y+PTL+  VV+GI   VKP++NF
Sbjct  182  ESYAGIYIPTLASNVVKGIKTGVKPIINF  210



>emb|CBI17613.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  98   FLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSK  277
             L   +  T++AP G+L+T +PGFNG  PSKHY+GYV I     K LFYYFV SERNP+K
Sbjct  1    MLFSFVVFTEAAPKGSLITHLPGFNGIFPSKHYSGYVDIGGEPAKNLFYYFVVSERNPAK  60

Query  278  DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPS  457
            DP+VLWLNGGPGCSSFDGFVYEHGPFNFE GKT  SLPTLHLNPYSW+KV+++IYLDSP+
Sbjct  61   DPLVLWLNGGPGCSSFDGFVYEHGPFNFEAGKTPISLPTLHLNPYSWSKVSSMIYLDSPT  120

Query  458  GVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSY  637
            GVG S+S N   Y TGD++TASD+H FLL+WF+ + EF+ NPF+++GESYAGVYVPTLS 
Sbjct  121  GVGFSFSKNTWQYKTGDVQTASDTHEFLLRWFKEFPEFITNPFYVSGESYAGVYVPTLSA  180

Query  638  EVVQGIDAAVKPVLNF  685
             +V+GI +  KP +NF
Sbjct  181  AIVKGIKSGAKPTINF  196



>ref|XP_006428612.1| hypothetical protein CICLE_v10013875mg [Citrus clementina]
 gb|ESR41852.1| hypothetical protein CICLE_v10013875mg [Citrus clementina]
Length=499

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG--KKLFYYFVESER  265
            +C L+ +  L  +AP+ ALV+++PGF+G+LPSKHY+GYVTI +++   K LFYYFV SER
Sbjct  16   ICLLVNV-ALIGAAPESALVSQLPGFHGSLPSKHYSGYVTIVDSAKTEKNLFYYFVVSER  74

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            NPSKDPVVLWLNGGPGCSS DG +YEHGPFNFE GK+ G +P LHLNPYSW+KV+N++YL
Sbjct  75   NPSKDPVVLWLNGGPGCSSLDGLIYEHGPFNFEAGKSKGRMPILHLNPYSWSKVSNVLYL  134

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVG SYS N + YITGD +TASD+  FLLKWF+ + EF+ NPFF++GESYAGVYVP
Sbjct  135  DSPAGVGFSYSKNTSLYITGDKQTASDTQKFLLKWFQEFPEFVSNPFFVSGESYAGVYVP  194

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TLS ++V GI +  KPV+NF
Sbjct  195  TLSAQIVNGIKSGEKPVINF  214



>gb|KCW63276.1| hypothetical protein EUGRSUZ_G00904 [Eucalyptus grandis]
Length=492

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVESERNPSKDPVVLWLNG  304
            +APD +L+T +PGF+G+LPS HYAGYV I    GKK LFYYF+ SERNPSKDPVVLWLNG
Sbjct  23   AAPDESLITHVPGFDGSLPSSHYAGYVAIPGNPGKKNLFYYFIASERNPSKDPVVLWLNG  82

Query  305  GPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN  484
            GPGCSSF GFV+EHGPFNF+ GK++GSLP L LNP+SW+KV+NIIYL+SP GVG SYS+N
Sbjct  83   GPGCSSFYGFVFEHGPFNFQAGKSNGSLPILQLNPFSWSKVSNIIYLESPCGVGFSYSNN  142

Query  485  ETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAA  664
              +Y TGDL+TASD+H FLLKWFELY E+L NPF+I+GESYAGVYVPTL+  VV+GI   
Sbjct  143  PRNYATGDLQTASDTHAFLLKWFELYPEYLSNPFYISGESYAGVYVPTLASNVVKGIKKG  202

Query  665  VKPVLNF  685
             KP++NF
Sbjct  203  EKPLINF  209



>ref|XP_007205172.1| hypothetical protein PRUPE_ppa005545mg [Prunus persica]
 gb|EMJ06371.1| hypothetical protein PRUPE_ppa005545mg [Prunus persica]
Length=455

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = +2

Query  113  LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
            L + ++AP+ +L+T++PGFNGT PSKHY+GY++ID   GK LFYY V SER+P+ DPVVL
Sbjct  3    LVIVEAAPESSLITQLPGFNGTFPSKHYSGYISID---GKNLFYYLVVSERSPANDPVVL  59

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSSFDGFVYEHGPFNF  G   G LP LHLNPYSW+KV+NIIYLDSP+GVG S
Sbjct  60   WLNGGPGCSSFDGFVYEHGPFNFAQGPPKGGLPVLHLNPYSWSKVSNIIYLDSPAGVGFS  119

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS +E+ Y TGDL+TASD+H FLLKWFE + EFL NPF+IAGESYAGVYVPTL+ +V +G
Sbjct  120  YSQDESKYQTGDLQTASDTHAFLLKWFEQFPEFLSNPFYIAGESYAGVYVPTLASQVAKG  179

Query  653  IDAAVKPVLNF  685
            I    KP LN 
Sbjct  180  IYNGTKPTLNL  190



>gb|AFW58028.1| hypothetical protein ZEAMMB73_889629 [Zea mays]
Length=402

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP+  LVT +PGF+G  PSKHY+GYVT+DE S + LFYY V SER+P+ DPVV+WLNGG
Sbjct  49   AAPEEHLVTGLPGFHGAFPSKHYSGYVTVDERSERSLFYYLVLSERDPAGDPVVVWLNGG  108

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVY +GPFNFE G + GSLP L LNPYSW+KV+NI+YLDSP+GVG+SYS N 
Sbjct  109  PGCSSFDGFVYGNGPFNFEPGSSPGSLPKLQLNPYSWSKVSNIMYLDSPAGVGMSYSLNR  168

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY+TGDLKTA+D+H FL KWFELY EF  NPF+I+GESYAGVY+PT++ EVV+GI+  V
Sbjct  169  SDYVTGDLKTAADAHKFLSKWFELYPEFQLNPFYISGESYAGVYIPTITDEVVKGIERGV  228

Query  668  KPVLNF  685
            KP +NF
Sbjct  229  KPRINF  234



>ref|XP_006480515.1| PREDICTED: serine carboxypeptidase-like 20-like [Citrus sinensis]
Length=528

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSG--KKLFYYFVESER  265
            +C L+ +  L  +AP+ ALV+++PGF+G+LPSKHY+GYVTI +++   K LFYYFV SER
Sbjct  16   ICLLVNV-ALIGAAPESALVSQLPGFHGSLPSKHYSGYVTIVDSAKTEKNLFYYFVVSER  74

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            NPSKDPVVLWLNGGPGCSS DG +YEHGPFNFE GK+ G +P LHLNPYSW+KV+N++YL
Sbjct  75   NPSKDPVVLWLNGGPGCSSLDGLIYEHGPFNFEAGKSKGRMPILHLNPYSWSKVSNVLYL  134

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVG SYS N + YITGD +TASD+  FLLKWF+ + EF+ NPFF++GESYAGVYVP
Sbjct  135  DSPAGVGFSYSKNTSLYITGDKQTASDTQKFLLKWFQEFPEFVSNPFFVSGESYAGVYVP  194

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TLS ++V GI +  KPV+NF
Sbjct  195  TLSAQIVNGIKSGEKPVINF  214



>ref|XP_010070328.1| PREDICTED: serine carboxypeptidase-like 21 [Eucalyptus grandis]
Length=494

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +2

Query  80   HLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET-SGKKLFYYFVE  256
            H+ L+  +L  +  T+ AP  +LVT +PGF GT PS HY+GYV ID+  +G+ LFYY V 
Sbjct  8    HVNLLFCMLLSVAFTEGAPKESLVTSLPGFTGTFPSHHYSGYVNIDDNPAGRNLFYYLVV  67

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERN + DPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GKT+ +LPTLHLNPYSW+K +NI
Sbjct  68   SERNSTIDPVVLWLNGGPGCSSFDGFVYEHGPFNFQAGKTTSALPTLHLNPYSWSKASNI  127

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            +YLDSP GVGLSYS +  +Y TGDL+TA+ +H FLLKWFEL+ EFL NPF+IAGESYAGV
Sbjct  128  VYLDSPCGVGLSYSTDSNNYNTGDLQTAAATHAFLLKWFELFPEFLNNPFYIAGESYAGV  187

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ EVV+GI+   K  +NF
Sbjct  188  YVPTLAAEVVKGINEGAKLFINF  210



>ref|XP_009340398.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=503

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 159/203 (78%), Gaps = 5/203 (2%)
 Frame = +2

Query  83   LTLVC--FLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L L C  F+  ++ + ++AP  +LVT +PGFN T PSKHY+GY+T D    K LFYYFV 
Sbjct  7    LALCCMFFVSLVVNIIEAAPRSSLVTHLPGFNATFPSKHYSGYITTDR---KNLFYYFVV  63

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SER+P  DPVVLWLNGGPGCSSFDGFVYEHGPFNF  GK  G+LP LHLNPYSW+KV+NI
Sbjct  64   SERSPESDPVVLWLNGGPGCSSFDGFVYEHGPFNFAEGKPKGALPVLHLNPYSWSKVSNI  123

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP+GVG SYS N+T YITGD++TA D+H FLLKWF+ + EF PNP +I+GESYAGV
Sbjct  124  IYLDSPAGVGFSYSQNQTKYITGDIQTAYDTHAFLLKWFQQFPEFQPNPLYISGESYAGV  183

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTL+ ++ +GI    KP LN 
Sbjct  184  YVPTLASQIAKGIKNGTKPTLNL  206



>ref|XP_002447646.1| hypothetical protein SORBIDRAFT_06g011100 [Sorghum bicolor]
 gb|EES11974.1| hypothetical protein SORBIDRAFT_06g011100 [Sorghum bicolor]
Length=492

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP+  LVT +PGF+G  PSKHY+GYVT+DE S + LFYY V SER+P+ DPVV+WLNGG
Sbjct  22   AAPEEHLVTGLPGFHGAFPSKHYSGYVTVDERSERSLFYYLVLSERDPATDPVVIWLNGG  81

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVY +GPFNFE G + GSLP L LNPYSW+KV+NI+YLDSP+GVG+SYS N+
Sbjct  82   PGCSSFDGFVYGNGPFNFEPGSSPGSLPKLQLNPYSWSKVSNIMYLDSPAGVGMSYSLNK  141

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DYITGDLKTA+D+H FLLKWFELY EF  NPF+I+GESYAGVY+PT++ EVV+GI+  V
Sbjct  142  SDYITGDLKTAADAHKFLLKWFELYPEFQLNPFYISGESYAGVYIPTITDEVVKGIERGV  201

Query  668  KPVLNF  685
            KP +NF
Sbjct  202  KPRINF  207



>emb|CDP04191.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = +2

Query  122  TKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLN  301
             ++AP  ALVT +PGFNG  PSKHY+GYVTID  + K LFYYFVESERNP KDP+VLWLN
Sbjct  23   VEAAPKDALVTSLPGFNGAFPSKHYSGYVTIDSATPKHLFYYFVESERNPLKDPLVLWLN  82

Query  302  GGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSD  481
            GGPGCSSFDGF+YEHGPFNFE  K  G LP LHLNP SW+KV+NIIYLDSPSGVG SY  
Sbjct  83   GGPGCSSFDGFIYEHGPFNFEAPKKQGELPILHLNPSSWSKVSNIIYLDSPSGVGFSY--  140

Query  482  NETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDA  661
               +  TGDL+TASD+H FLLKW E Y EF  NPF+I+GESYAG+YVPTL+ EV +GI  
Sbjct  141  --PNLPTGDLQTASDTHAFLLKWLEQYPEFQANPFYISGESYAGIYVPTLASEVDEGIKG  198

Query  662  AVKPVLNF  685
             +KP +NF
Sbjct  199  GIKPKINF  206



>sp|Q9LSV8.2|SCP21_ARATH RecName: Full=Serine carboxypeptidase-like 21; Flags: Precursor 
[Arabidopsis thaliana]
Length=494

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 160/207 (77%), Gaps = 3/207 (1%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            G  +   +   LL L   +TKSAP  AL+T +PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GRLVEAIIASILLSLCFTITKSAPKSALITNLPGFNGTFPSKHYAGYVAIDKHRNKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNFE  K +  L  LHLNPYSW+K
Sbjct  62   YFVESERNASVDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPKKKNSHL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS++  DY T D KTASD+HTFLL+WF+++ EF  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSNDNADYTTDDTKTASDTHTFLLEWFKMFPEFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            YAG+YVPTL+ EVV+G     KPV+NF
Sbjct  180  YAGIYVPTLAAEVVKGHKNVTKPVINF  206



>ref|NP_189169.1| serine carboxypeptidase-like 21 [Arabidopsis thaliana]
 gb|AEE77009.1| serine carboxypeptidase-like 21 [Arabidopsis thaliana]
Length=505

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 160/207 (77%), Gaps = 3/207 (1%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            G  +   +   LL L   +TKSAP  AL+T +PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GRLVEAIIASILLSLCFTITKSAPKSALITNLPGFNGTFPSKHYAGYVAIDKHRNKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNFE  K +  L  LHLNPYSW+K
Sbjct  62   YFVESERNASVDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPKKKNSHL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS++  DY T D KTASD+HTFLL+WF+++ EF  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSNDNADYTTDDTKTASDTHTFLLEWFKMFPEFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            YAG+YVPTL+ EVV+G     KPV+NF
Sbjct  180  YAGIYVPTLAAEVVKGHKNVTKPVINF  206



>ref|XP_010673905.1| PREDICTED: serine carboxypeptidase-like 20 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 166/212 (78%), Gaps = 10/212 (5%)
 Frame = +2

Query  80   HLTLVCFLLP----LLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKL---  238
            H+ L+  L      ++ ++++AP  +L+T++PGF  + PSKHY+GY+T++    K+L   
Sbjct  9    HIVLLMILTSNYGNIIMISEAAPANSLITKLPGFTASFPSKHYSGYITLNGHPNKQLRAP  68

Query  239  ---FYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
               FYYFVESERNP KD VVLWLNGGPGCSSFDGFVYEHGPFNF+ GKT  SLP LHLNP
Sbjct  69   KNLFYYFVESERNPKKDAVVLWLNGGPGCSSFDGFVYEHGPFNFQAGKTKNSLPVLHLNP  128

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFF  589
            YSW+KV+NIIYLDSP+GVGLSYS+N+T Y TGD++TA D+H FLLKWF+ + EF  N F+
Sbjct  129  YSWSKVSNIIYLDSPTGVGLSYSENQTKYQTGDVQTALDTHAFLLKWFKQFSEFRNNSFY  188

Query  590  IAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +AGESY G+YVPTL+ E+V+GI A V P +NF
Sbjct  189  VAGESYGGIYVPTLATEIVKGIKAKVHPTINF  220



>ref|XP_006296649.1| hypothetical protein CARUB_v10015503mg, partial [Capsella rubella]
 gb|EOA29547.1| hypothetical protein CARUB_v10015503mg, partial [Capsella rubella]
Length=194

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 157/195 (81%), Gaps = 3/195 (2%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            G  +   +   LL L   +T+SAP+ AL+T++PGFNG+ PSKHYAGYV ID+   K L+Y
Sbjct  2    GWLVEALVASILLSLCFAITESAPESALITKLPGFNGSFPSKHYAGYVAIDKEGSKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLW NGGPGCSS DGFVYEHGPFNFE  KT+  L  LHLNPYSW+K
Sbjct  62   YFVESERNASIDPVVLWFNGGPGCSSMDGFVYEHGPFNFEQTKTNKHL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS N++DYIT D KTASDS+TFLLKWF+++ EF  NPF+I+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSKNKSDYITNDTKTASDSYTFLLKWFKMFPEFQSNPFYISGES  179

Query  605  YAGVYVPTLSYEVVQ  649
            YAG+YVPTL+ +VV+
Sbjct  180  YAGIYVPTLASKVVK  194



>gb|KCW58999.1| hypothetical protein EUGRSUZ_H01627 [Eucalyptus grandis]
Length=481

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = +2

Query  101  LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDET-SGKKLFYYFVESERNPSK  277
            +L  +  T+ AP  +LVT +PGF GT PS HY+GYV ID+  +G+ LFYY V SERN + 
Sbjct  1    MLLSVAFTEGAPKESLVTSLPGFTGTFPSHHYSGYVNIDDNPAGRNLFYYLVVSERNSTI  60

Query  278  DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPS  457
            DPVVLWLNGGPGCSSFDGFVYEHGPFNF+ GKT+ +LPTLHLNPYSW+K +NI+YLDSP 
Sbjct  61   DPVVLWLNGGPGCSSFDGFVYEHGPFNFQAGKTTSALPTLHLNPYSWSKASNIVYLDSPC  120

Query  458  GVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSY  637
            GVGLSYS +  +Y TGDL+TA+ +H FLLKWFEL+ EFL NPF+IAGESYAGVYVPTL+ 
Sbjct  121  GVGLSYSTDSNNYNTGDLQTAAATHAFLLKWFELFPEFLNNPFYIAGESYAGVYVPTLAA  180

Query  638  EVVQGIDAAVKPVLNF  685
            EVV+GI+   K  +NF
Sbjct  181  EVVKGINEGAKLFINF  196



>ref|XP_009340341.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=492

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = +2

Query  98   FLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSK  277
            F+  ++ + ++AP  +LVT +PGFN T PSKHY+GY+T D    K LFYYFV SER+P  
Sbjct  3    FVSLVVNIIEAAPRSSLVTHLPGFNATFPSKHYSGYITTDR---KNLFYYFVVSERSPES  59

Query  278  DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPS  457
            DPVVLWLNGGPGCSSFDGFVYEHGPFNF  GK  G+LP LHLNPYSW+KV+NIIYLDSP+
Sbjct  60   DPVVLWLNGGPGCSSFDGFVYEHGPFNFAEGKPKGALPVLHLNPYSWSKVSNIIYLDSPA  119

Query  458  GVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSY  637
            GVG SYS N+T YITGD++TA D+H FLLKWF+ + EF PNP +I+GESYAGVYVPTL+ 
Sbjct  120  GVGFSYSQNQTKYITGDIQTAYDTHAFLLKWFQQFPEFQPNPLYISGESYAGVYVPTLAS  179

Query  638  EVVQGIDAAVKPVLNF  685
            ++ +GI    KP LN 
Sbjct  180  QIAKGIKNGTKPTLNL  195



>ref|XP_004975273.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Setaria 
italica]
Length=493

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
             PL   LV   L L     +AP+  LVT +PGF+G  PS HY+GYVT+DE SG+ LFYY 
Sbjct  5    FPLLFFLVAAAL-LRTPAAAAPEEHLVTGLPGFHGDFPSNHYSGYVTVDEASGRSLFYYL  63

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
              SER+P+ DPVVLWLNGGPGCSSFDGFVYE+GPFNFE G   G LP L LNPYSW+KV+
Sbjct  64   ALSERDPAADPVVLWLNGGPGCSSFDGFVYENGPFNFEPGTKPGGLPRLQLNPYSWSKVS  123

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYA  610
            NI+YLDSP+GVG+SYS N++DY TGDLKTA+D+H FLLKWFE+Y EF  NPF+I+GESYA
Sbjct  124  NIMYLDSPAGVGMSYSLNKSDYTTGDLKTAADAHKFLLKWFEIYPEFQSNPFYISGESYA  183

Query  611  GVYVPTLSYEVVQGIDAAVKPVLNF  685
            GVY+PTL+ EVV+GI+  V+P ++F
Sbjct  184  GVYIPTLADEVVKGIEKGVEPRISF  208



>ref|NP_001052464.1| Os04g0321700 [Oryza sativa Japonica Group]
 emb|CAD40292.2| OSJNBb0062H02.3 [Oryza sativa Japonica Group]
 dbj|BAF14378.1| Os04g0321700 [Oryza sativa Japonica Group]
 emb|CAH66333.1| OSIGBa0097I24.1 [Oryza sativa Indica Group]
 dbj|BAG94108.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77014.1| hypothetical protein OsI_15357 [Oryza sativa Indica Group]
 gb|EEE60735.1| hypothetical protein OsJ_14259 [Oryza sativa Japonica Group]
Length=504

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +2

Query  137  DGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGC  316
            DG LV  +PGF+G  PSKHY+GYVT+DE SG++LFYY V SER+ + DPVVLWLNGGPGC
Sbjct  36   DGHLVASLPGFHGAFPSKHYSGYVTVDEGSGRRLFYYLVTSERDAAADPVVLWLNGGPGC  95

Query  317  SSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDY  496
            SS DGFVYE+GPFNFE G   G LP L LNPYSW+KV+N++YLDSP+GVG+SYS N++DY
Sbjct  96   SSLDGFVYENGPFNFERGSDPGGLPNLELNPYSWSKVSNVVYLDSPAGVGMSYSLNKSDY  155

Query  497  ITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPV  676
             TGDLKTA+D+HTFLLKWFELY EF  NPF+++GES+AG+Y+PTL+ EVV+GI+  +KP 
Sbjct  156  TTGDLKTAADAHTFLLKWFELYPEFQSNPFYMSGESFAGIYIPTLADEVVKGIEKDLKPR  215

Query  677  LNF  685
            +NF
Sbjct  216  INF  218



>ref|XP_010042090.1| PREDICTED: serine carboxypeptidase 1-like [Eucalyptus grandis]
Length=469

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVESERNPSKDPVVLWLNG  304
            +A D +L+T +PGF+G+LPS HYAGYV I    GKK LFYYF+ SERNPSKDPVVLWLNG
Sbjct  23   AARDESLITHVPGFDGSLPSSHYAGYVAIPGNPGKKNLFYYFIASERNPSKDPVVLWLNG  82

Query  305  GPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN  484
            GPGCSSF GFV+EHGPFNF+ GK++GSLP L LNP+SW+KV+NII LDSP GVGLSYS++
Sbjct  83   GPGCSSFYGFVFEHGPFNFQAGKSNGSLPILQLNPFSWSKVSNIICLDSPCGVGLSYSND  142

Query  485  ETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAA  664
              +Y TGDL+TASD+H FLLKWFELY E+L NPF+I+GESYAGVYVPTL+  VV+GI   
Sbjct  143  PRNYATGDLQTASDTHAFLLKWFELYPEYLSNPFYISGESYAGVYVPTLASNVVKGIKKG  202

Query  665  VKPVLNF  685
             KP++NF
Sbjct  203  EKPLINF  209



>ref|XP_008663135.1| PREDICTED: serine carboxypeptidase 1-like [Zea mays]
 gb|AFW58027.1| hypothetical protein ZEAMMB73_889629 [Zea mays]
Length=519

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP+  LVT +PGF+G  PSKHY+GYVT+DE S + LFYY V SER+P+ DPVV+WLNGG
Sbjct  49   AAPEEHLVTGLPGFHGAFPSKHYSGYVTVDERSERSLFYYLVLSERDPAGDPVVVWLNGG  108

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVY +GPFNFE G + GSLP L LNPYSW+KV+NI+YLDSP+GVG+SYS N 
Sbjct  109  PGCSSFDGFVYGNGPFNFEPGSSPGSLPKLQLNPYSWSKVSNIMYLDSPAGVGMSYSLNR  168

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY+TGDLKTA+D+H FL KWFELY EF  NPF+I+GESYAGVY+PT++ EVV+GI+  V
Sbjct  169  SDYVTGDLKTAADAHKFLSKWFELYPEFQLNPFYISGESYAGVYIPTITDEVVKGIERGV  228

Query  668  KPVLNF  685
            KP +NF
Sbjct  229  KPRINF  234



>ref|XP_002514833.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47387.1| serine carboxypeptidase, putative [Ricinus communis]
Length=494

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 159/200 (80%), Gaps = 3/200 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYV--TIDETSGKKLFYYFVESER  265
            VC L   + L ++AP  ALVT +PGFNGT PSKHY+GYV  T++  S K LFYYFVESER
Sbjct  11   VCMLFNFV-LIQAAPRHALVTHLPGFNGTFPSKHYSGYVNVTVNVNSRKNLFYYFVESER  69

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            + +KDPVVLWLNGGPGCSS DGFVYEHGPF+FE G   G LPTLHLN YSW+KV ++IYL
Sbjct  70   DATKDPVVLWLNGGPGCSSLDGFVYEHGPFDFEAGNQEGDLPTLHLNQYSWSKVASVIYL  129

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP+GVG S++ N + Y TGD KTASD+H FL +WF  + EF+ NPF+IAGESYAGVYVP
Sbjct  130  DSPAGVGFSFAQNTSLYRTGDRKTASDTHRFLRQWFLQFPEFVSNPFYIAGESYAGVYVP  189

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL+ E+V+GI   V+PV+NF
Sbjct  190  TLAAEIVRGIKLGVRPVINF  209



>ref|XP_010111090.1| Serine carboxypeptidase-like 20 [Morus notabilis]
 gb|EXC29952.1| Serine carboxypeptidase-like 20 [Morus notabilis]
Length=499

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 164/207 (79%), Gaps = 1/207 (0%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTID-ETSGKKLFY  244
            G P  L L   L  +L  + ++P  +LVT++PGF+GT PSKHY+GY+ ID   +GK LFY
Sbjct  2    GKPKFLFLFISLCSILFSSDASPPRSLVTQLPGFDGTFPSKHYSGYINIDGNPAGKNLFY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFV SER+P+ DPVVLWLNGGPGCSSFDGFVYEHGPF+FE GK  GSLP LHLN Y+WTK
Sbjct  62   YFVVSERSPATDPVVLWLNGGPGCSSFDGFVYEHGPFSFEEGKPKGSLPKLHLNAYTWTK  121

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS + T Y TGD +T++D+HTFLL+WFE + EF+ NPF+I+GES
Sbjct  122  VSNIIYLDSPVGVGFSYSKDPTKYKTGDQQTSADTHTFLLQWFEQFPEFISNPFYISGES  181

Query  605  YAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +AG+YVPTL+ +V +GI    KPV+NF
Sbjct  182  FAGIYVPTLASQVAKGIKNGEKPVINF  208



>dbj|BAB01313.1| serine carboxypeptidase I [Arabidopsis thaliana]
Length=504

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 162/217 (75%), Gaps = 13/217 (6%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            G  +   +   LL L   +TKSAP  AL+T +PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GRLVEAIIASILLSLCFTITKSAPKSALITNLPGFNGTFPSKHYAGYVAIDKHRNKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNFE  K +  L  LHLNPYSW+K
Sbjct  62   YFVESERNASVDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPKKKNSHL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS++  DY T D KTASD+HTFLL+WF+++ EF  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSNDNADYTTDDTKTASDTHTFLLEWFKMFPEFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQGIDAAV----------KPVLNF  685
            YAG+YVPTL+ EVV+G   A+          KPV+NF
Sbjct  180  YAGIYVPTLAAEVVKGNKNAMRTNKTSKNVTKPVINF  216



>ref|XP_010557747.1| PREDICTED: serine carboxypeptidase-like 20 [Tarenaya hassleriana]
Length=496

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +2

Query  59   VKNGLPLHLTLVCFLLPLLQ-LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            ++ G  + +  V   L L   + +SAP+  LVT++PGFN   PSKHYAGYVTID   GK 
Sbjct  3    LRMGWLVEVVAVALTLSLAAVMAQSAPESDLVTQLPGFNAKFPSKHYAGYVTIDNDRGKN  62

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            ++YYFVESE+NP KDPVVLWLNGGPGCSS DGFVYEHGPF+F+  K  G LP L LN YS
Sbjct  63   MWYYFVESEKNPYKDPVVLWLNGGPGCSSMDGFVYEHGPFDFKQVKPEGGLPHLRLNHYS  122

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIA  595
            W+KV+NIIYLDSP GVG SYS NE+DY T D +TA DSHTFLLKWFE + +F  NPF++A
Sbjct  123  WSKVSNIIYLDSPVGVGFSYSKNESDYRTNDTQTAIDSHTFLLKWFENFPKFQMNPFYLA  182

Query  596  GESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            GES+AGVYVPTL+ E+V G    VKP +NF
Sbjct  183  GESFAGVYVPTLASEIVNGQKDGVKPFINF  212



>ref|XP_004975271.1| PREDICTED: serine carboxypeptidase 1-like [Setaria italica]
Length=497

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGT-LPSKHYAGYVTIDETSGKKLFYYFV  253
            L L +V     L     +AP+  LVT +PGF+G   PSKHYAGYVT+DE S + LFYY  
Sbjct  9    LLLLVVAVASLLCPPAAAAPEEHLVTGLPGFHGANFPSKHYAGYVTVDEASERSLFYYLA  68

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
             SER+P+ DPVVLWLNGGPGCSSFDGFVY +GPFNFE G   G LP L LNPYSW+KV+N
Sbjct  69   LSERDPAADPVVLWLNGGPGCSSFDGFVYGNGPFNFEPGTKPGGLPKLRLNPYSWSKVSN  128

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            I+YLDSP+GVG+SYS N++DY TGDLKTA+D+H FLLKWFELY EF  NPF+I+GESYAG
Sbjct  129  IMYLDSPAGVGMSYSLNKSDYTTGDLKTAADAHKFLLKWFELYPEFQSNPFYISGESYAG  188

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
            VY+PT++ EVV+GI   VKP +NF
Sbjct  189  VYIPTITDEVVKGIQKGVKPRINF  212



>emb|CDY27895.1| BnaA07g04850D [Brassica napus]
Length=493

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +2

Query  113  LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
              LT+SAP+ ALVT+I GF+GT PSKHYAGYV ID+   K L+YYFVESERN S DPVV+
Sbjct  19   FSLTESAPESALVTKISGFSGTFPSKHYAGYVAIDKERNKNLWYYFVESERNASTDPVVI  78

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSS DGF+YEHGPFNFE  KT    P LHLNPYSW+KV+NIIYLDSP GVG S
Sbjct  79   WLNGGPGCSSMDGFIYEHGPFNFERTKTKE--PRLHLNPYSWSKVSNIIYLDSPVGVGYS  136

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS N++DY T D KTASDS+ FL++WF+++ EF  NPFFI+GESYAGVYVPTL+ EVV+G
Sbjct  137  YSGNKSDYNTNDSKTASDSYAFLVEWFKMFPEFQSNPFFISGESYAGVYVPTLASEVVKG  196

Query  653  IDAAVKPVLNF  685
                 KP +N 
Sbjct  197  NKNGTKPAINL  207



>emb|CDY00837.1| BnaCnng00370D [Brassica napus]
Length=498

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = +2

Query  113  LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
              +T+SAP+ ALVT+I GF+GT PSKHYAGYV ID+   K L+YYFVESERN S DPVV+
Sbjct  24   FSVTESAPESALVTKISGFSGTFPSKHYAGYVAIDKERNKNLWYYFVESERNASTDPVVI  83

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSS DGF+YEHGPFNFE  KT    P LHLNPYSW+KV+NIIYLDSP GVG S
Sbjct  84   WLNGGPGCSSMDGFIYEHGPFNFERTKTKE--PRLHLNPYSWSKVSNIIYLDSPVGVGYS  141

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS N++DY T D KTASDS+ FL++WF+++ EF  NPFFI+GESYAGVYVPTL+ EVV+G
Sbjct  142  YSRNKSDYKTNDSKTASDSYAFLVEWFKMFPEFQSNPFFISGESYAGVYVPTLASEVVKG  201

Query  653  IDAAVKPVLNF  685
                 KPV++ 
Sbjct  202  NKNGTKPVIDL  212



>gb|ABR17809.1| unknown [Picea sitchensis]
Length=494

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +2

Query  146  LVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSF  325
            LV  +PGF+G  PSKHY+GY+T+D+  GKKLFYYF  S+ NP++DP+VLWLNGGPGCSS 
Sbjct  26   LVKSLPGFDGEFPSKHYSGYITVDKARGKKLFYYFATSQGNPAEDPLVLWLNGGPGCSSL  85

Query  326  DGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITG  505
            DGF+YEHGPFNF  G   GS P + LNP+SWTK+++IIYL+SP+GVG SYSD E DYITG
Sbjct  86   DGFIYEHGPFNFRRGDQPGSKPVIELNPFSWTKISSIIYLESPAGVGYSYSDTENDYITG  145

Query  506  DLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            DL TASD++ FLL+WFE Y EF+ NPFFIAGESYAGVYVPTL+ +VV GI+  V+P LNF
Sbjct  146  DLSTASDNYKFLLQWFEEYPEFVHNPFFIAGESYAGVYVPTLAQQVVNGIEVGVEPSLNF  205



>ref|XP_010649232.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Vitis 
vinifera]
Length=490

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 157/203 (77%), Gaps = 6/203 (3%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L  + +C L   +  T++AP G+L+T +PGFNGT PSKHY+GYV I     K LFYYFV 
Sbjct  8    LFTSSLCILFSFVVFTEAAPKGSLITHLPGFNGTFPSKHYSGYVDIGGEPAKNLFYYFVV  67

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNP KDP+VLWLNGGPGCSSFDGFVYEH       GKT  SLPTLHLNPYSW+KV+++
Sbjct  68   SERNPGKDPLVLWLNGGPGCSSFDGFVYEHA------GKTPNSLPTLHLNPYSWSKVSSM  121

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            IYLDSP+GVG S+S N   Y TGDL+TASD+H FLL+WF+ + EF+ NPF+++GESYAGV
Sbjct  122  IYLDSPAGVGFSFSKNTWQYNTGDLQTASDTHEFLLRWFKEFPEFITNPFYVSGESYAGV  181

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVPTLS  +V+GI +  KP +NF
Sbjct  182  YVPTLSAAIVKGIKSGAKPTINF  204



>ref|XP_010466953.1| PREDICTED: serine carboxypeptidase-like 21 isoform X1 [Camelina 
sativa]
Length=508

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            GL +   +   LL     +T+SAP+ AL+T++PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GLLMEAIVASILLSFCFAITESAPESALITKLPGFNGTFPSKHYAGYVAIDKERSKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNF   K +G L  LHLNPYSW+K
Sbjct  62   YFVESERNASTDPVVLWLNGGPGCSSLDGFVYEHGPFNFNPKKKNGDL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS   +DY T D KTASDS+TFL++WF+++ +F  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSKKNSDYTTNDTKTASDSYTFLVEWFKMFPQFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQGIDAAVK  670
            YAG+YVPTL+ +VV+G   A++
Sbjct  180  YAGIYVPTLASQVVKGNKNAMR  201



>ref|XP_002883604.1| hypothetical protein ARALYDRAFT_480041 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59863.1| hypothetical protein ARALYDRAFT_480041 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 159/208 (76%), Gaps = 4/208 (2%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            G  +   +   LL L   +T+SAP  AL+T +PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GWLVEAIVASILLSLCFAITESAPKSALITELPGFNGTFPSKHYAGYVAIDKHRNKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNFE  K +  L  LHLNPYSW+K
Sbjct  62   YFVESERNASVDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPKKRNSHL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS++  DY T D KTA DSH FLL+WF+++ EF  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSNDNADYTTNDTKTAFDSHRFLLEWFKMFPEFRSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQG-IDAAVKPVLNF  685
            YAG+YVPTL+ +VV+G  +   KP++NF
Sbjct  180  YAGIYVPTLAAQVVKGHKNVTTKPLINF  207



>ref|XP_002325905.2| hypothetical protein POPTR_0019s08160g [Populus trichocarpa]
 gb|EEF00287.2| hypothetical protein POPTR_0019s08160g [Populus trichocarpa]
Length=503

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 160/208 (77%), Gaps = 14/208 (7%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            +C LL    + ++AP G+L+T +PGFNG  PS HY+GY+T D+   K LFYYF+ SERNP
Sbjct  12   ICVLLNFASV-EAAPKGSLITGLPGFNGVFPSNHYSGYITFDD---KNLFYYFIVSERNP  67

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS----------WT  421
            SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFE GK  GSLP LHLNP++            
Sbjct  68   SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEEGKPKGSLPILHLNPFNSFNLFLNFILLI  127

Query  422  KVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGE  601
             V+NIIYLDSP GVG+SYS N++ YI  DL+TA+D+H FLL+WF+LY EF+ N F+I+GE
Sbjct  128  IVSNIIYLDSPCGVGMSYSKNQSKYINDDLQTAADTHNFLLQWFQLYPEFVNNQFYISGE  187

Query  602  SYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            SYAG+YVPTLS EVV+GI A   PV+NF
Sbjct  188  SYAGIYVPTLSAEVVKGIQAGQDPVINF  215



>ref|XP_009102414.1| PREDICTED: serine carboxypeptidase-like 21 [Brassica rapa]
Length=500

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +2

Query  113  LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVL  292
              LT+SAP+ ALVT+I GF+GT PSKHYAGYV ID+   K L+YYFVESERN S DPVV+
Sbjct  26   FSLTESAPESALVTKISGFSGTFPSKHYAGYVAIDKERNKNLWYYFVESERNASTDPVVI  85

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLS  472
            WLNGGPGCSS DGF+YEHGPFNFE  KT    P LHLNPYSW+KV+NIIYLDSP GVG S
Sbjct  86   WLNGGPGCSSMDGFIYEHGPFNFERTKTKE--PRLHLNPYSWSKVSNIIYLDSPVGVGYS  143

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            YS N++DY T D KTASDS+ FL++WF+++ EF  N FFI+GESYAGVYVPTL+ EVV+G
Sbjct  144  YSRNKSDYNTNDSKTASDSYAFLVEWFKMFPEFQSNQFFISGESYAGVYVPTLASEVVKG  203

Query  653  IDAAVKPVLNF  685
                 KP +N 
Sbjct  204  NKNGTKPAINL  214



>ref|XP_010466955.1| PREDICTED: serine carboxypeptidase-like 21 isoform X3 [Camelina 
sativa]
Length=489

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            GL +   +   LL     +T+SAP+ AL+T++PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GLLMEAIVASILLSFCFAITESAPESALITKLPGFNGTFPSKHYAGYVAIDKERSKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNF   K +G L  LHLNPYSW+K
Sbjct  62   YFVESERNASTDPVVLWLNGGPGCSSLDGFVYEHGPFNFNPKKKNGDL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS   +DY T D KTASDS+TFL++WF+++ +F  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSKKNSDYTTNDTKTASDSYTFLVEWFKMFPQFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQG  652
            YAG+YVPTL+ +VV+G
Sbjct  180  YAGIYVPTLASQVVKG  195



>ref|XP_010466954.1| PREDICTED: serine carboxypeptidase-like 21 isoform X2 [Camelina 
sativa]
Length=501

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 155/196 (79%), Gaps = 3/196 (2%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            GL +   +   LL     +T+SAP+ AL+T++PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GLLMEAIVASILLSFCFAITESAPESALITKLPGFNGTFPSKHYAGYVAIDKERSKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNF   K +G L  LHLNPYSW+K
Sbjct  62   YFVESERNASTDPVVLWLNGGPGCSSLDGFVYEHGPFNFNPKKKNGDL--LHLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS   +DY T D KTASDS+TFL++WF+++ +F  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSKKNSDYTTNDTKTASDSYTFLVEWFKMFPQFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQG  652
            YAG+YVPTL+ +VV+G
Sbjct  180  YAGIYVPTLASQVVKG  195



>emb|CDP04193.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 148/187 (79%), Gaps = 4/187 (2%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNG  304
            ++AP+ A VT +PGFNG  PSKHY+GYVTID    K LFYYFV SE NPS+DP+VLWLNG
Sbjct  24   EAAPNAAPVTSLPGFNGAFPSKHYSGYVTIDSNPQKNLFYYFVVSEGNPSEDPLVLWLNG  83

Query  305  GPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN  484
            GPGCS FDGFVYEHGPFNFE  K+ G LP LHLNPYSW+KV+NIIYLDSPSGVG SY   
Sbjct  84   GPGCSGFDGFVYEHGPFNFEAPKSQGELPILHLNPYSWSKVSNIIYLDSPSGVGFSYP--  141

Query  485  ETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAA  664
              +  TGD +TASD+H FLLKW E Y EF  NPF+++GESYAGVY+PTL+ EV +GI A 
Sbjct  142  --NLTTGDFQTASDTHAFLLKWLEQYPEFQANPFYMSGESYAGVYIPTLATEVDKGIKAG  199

Query  665  VKPVLNF  685
            V P +NF
Sbjct  200  VTPRINF  206



>ref|XP_010514125.1| PREDICTED: serine carboxypeptidase-like 21 [Camelina sativa]
Length=507

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 160/202 (79%), Gaps = 3/202 (1%)
 Frame = +2

Query  68   GLPLHLTLVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFY  244
            GL +   +   LL L   +T+SAP+ AL+T++PGFNGT PSKHYAGYV ID+   K L+Y
Sbjct  2    GLLMEAIVATILLSLCFAITESAPESALITKLPGFNGTFPSKHYAGYVAIDKERSKNLWY  61

Query  245  YFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTK  424
            YFVESERN S DPVVLWLNGGPGCSS DGFVYEHGPFNF+  K + +L  L LNPYSW+K
Sbjct  62   YFVESERNASTDPVVLWLNGGPGCSSLDGFVYEHGPFNFDPKKKNRNL--LQLNPYSWSK  119

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
            V+NIIYLDSP GVG SYS+ ++DY T D  TASDS+TFL++WF+++ +F  NPFFI+GES
Sbjct  120  VSNIIYLDSPVGVGFSYSEKKSDYTTNDTGTASDSYTFLVEWFKMFPQFQSNPFFISGES  179

Query  605  YAGVYVPTLSYEVVQGIDAAVK  670
            YAG+YVPTL+ ++V+G   A++
Sbjct  180  YAGIYVPTLASQIVKGNKNAMR  201



>gb|KFK39840.1| hypothetical protein AALP_AA3G294800, partial [Arabis alpina]
Length=465

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            SAP  AL+T++PGFN   PSKHYAGYV ID+   K L+YYFVESERN S+DPVVLWLNGG
Sbjct  1    SAPQSALITKLPGFNNNFPSKHYAGYVAIDKEGSKNLWYYFVESERNASEDPVVLWLNGG  60

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSS DGF+YEHGPFNFEL KT  ++P LHLN YSW+KV+NIIYLDSP GVG SYS ++
Sbjct  61   PGCSSMDGFIYEHGPFNFELTKT--NIPRLHLNRYSWSKVSNIIYLDSPVGVGYSYSKDK  118

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVV  646
            +DY T D KTASDSHTFL++WF+++ EF  NPFFI+GESYAG+YVP+L+ E+V
Sbjct  119  SDYTTNDTKTASDSHTFLIEWFKMFPEFQSNPFFISGESYAGIYVPSLASEIV  171



>gb|KFK39839.1| hypothetical protein AALP_AA3G294800, partial [Arabis alpina]
Length=480

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            SAP  AL+T++PGFN   PSKHYAGYV ID+   K L+YYFVESERN S+DPVVLWLNGG
Sbjct  1    SAPQSALITKLPGFNNNFPSKHYAGYVAIDKEGSKNLWYYFVESERNASEDPVVLWLNGG  60

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSS DGF+YEHGPFNFEL KT  ++P LHLN YSW+KV+NIIYLDSP GVG SYS ++
Sbjct  61   PGCSSMDGFIYEHGPFNFELTKT--NIPRLHLNRYSWSKVSNIIYLDSPVGVGYSYSKDK  118

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVV  646
            +DY T D KTASDSHTFL++WF+++ EF  NPFFI+GESYAG+YVP+L+ E+V
Sbjct  119  SDYTTNDTKTASDSHTFLIEWFKMFPEFQSNPFFISGESYAGIYVPSLASEIV  171



>ref|XP_004975272.1| PREDICTED: serine carboxypeptidase 1-like isoform X1 [Setaria 
italica]
Length=523

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 163/235 (69%), Gaps = 31/235 (13%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYF  250
             PL   LV   L L     +AP+  LVT +PGF+G  PS HY+GYVT+DE SG+ LFYY 
Sbjct  5    FPLLFFLVAAAL-LRTPAAAAPEEHLVTGLPGFHGDFPSNHYSGYVTVDEASGRSLFYYL  63

Query  251  VESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVT  430
              SER+P+ DPVVLWLNGGPGCSSFDGFVYE+GPFNFE G   G LP L LNPYSW+KV+
Sbjct  64   ALSERDPAADPVVLWLNGGPGCSSFDGFVYENGPFNFEPGTKPGGLPRLQLNPYSWSKVS  123

Query  431  NIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLK---------------------  547
            NI+YLDSP+GVG+SYS N++DY TGDLKTA+D+H FLLK                     
Sbjct  124  NIMYLDSPAGVGMSYSLNKSDYTTGDLKTAADAHKFLLKVLCFSDSSCSFAIYQALCVCN  183

Query  548  ---------WFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
                     WFE+Y EF  NPF+I+GESYAGVY+PTL+ EVV+GI+  V+P ++F
Sbjct  184  TMLINVLLQWFEIYPEFQSNPFYISGESYAGVYIPTLADEVVKGIEKGVEPRISF  238



>gb|EMS48673.1| Serine carboxypeptidase 1 [Triticum urartu]
Length=538

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 11/186 (6%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +AP+  LVT +PGF+G LPSKHYAGY++++           V SER  + DPVVLWLNGG
Sbjct  24   AAPEKHLVTHLPGFDGALPSKHYAGYISVE-----------VLSERARAADPVVLWLNGG  72

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYE+GPFNFE G T G LP LHLNPYSW+KV++++YLDSP+GVG+SYS N+
Sbjct  73   PGCSSFDGFVYENGPFNFERGSTPGGLPKLHLNPYSWSKVSSMMYLDSPAGVGMSYSLNK  132

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY TGDLKTA+D HTFLLKWFELY EF  NPF+I+GESYAG+Y+PTL+ EVV+G   A+
Sbjct  133  SDYTTGDLKTAADGHTFLLKWFELYPEFQSNPFYISGESYAGIYIPTLADEVVKGAQKAL  192

Query  668  KPVLNF  685
            KP +N 
Sbjct  193  KPRINL  198



>gb|KFK36172.1| hypothetical protein AALP_AA4G087600 [Arabis alpina]
Length=800

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            SAP  AL+T++PGFN +  SKHYAGYV ID+   K L+YYFVESERN SKDPVVLWLNGG
Sbjct  3    SAPQSALITKLPGFNNSFSSKHYAGYVAIDKEGNKNLWYYFVESERNASKDPVVLWLNGG  62

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSS DGF+YEHGPFNF   KT+  +P+LHLN +SW+KV+NIIYLDSP GVG SYS +E
Sbjct  63   PGCSSMDGFIYEHGPFNFRRTKTN--VPSLHLNSHSWSKVSNIIYLDSPVGVGYSYSKHE  120

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            +DY T D +TASDSH FL++WF+++ EF  NPFFI+GESYAG+YVPTL+ E+V+G   A 
Sbjct  121  SDYTTNDTQTASDSHAFLIEWFKMFPEFQSNPFFISGESYAGIYVPTLASEIVKGNKNAK  180

Query  668  K  670
            +
Sbjct  181  R  181



>ref|XP_006418631.1| hypothetical protein EUTSA_v10002940mg [Eutrema salsugineum]
 gb|ESQ37067.1| hypothetical protein EUTSA_v10002940mg [Eutrema salsugineum]
Length=490

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = +2

Query  89   LVCFLLPL-LQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESER  265
            +   LL L  ++T+SAP+ ALVT++PGFNG+ PSKHYAGYV I +   K L+YYFVESER
Sbjct  9    VASILLSLGFEITESAPESALVTKLPGFNGSFPSKHYAGYVAIYKERNKNLWYYFVESER  68

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            N S DPVVLWLNGGPGCSS DGF+YEHGPFNF+  KT   L  LHLN +SW+KV+NIIYL
Sbjct  69   NASGDPVVLWLNGGPGCSSMDGFIYEHGPFNFDPTKTKSQL--LHLNRFSWSKVSNIIYL  126

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP GVG SYS +++DY T D KTASDS+ FL++WF+++ EF  NP FI+GESYAG+YVP
Sbjct  127  DSPVGVGYSYSKDKSDYNTNDTKTASDSYAFLVEWFKMFPEFQSNPLFISGESYAGIYVP  186

Query  626  TLSYEVVQGIDAAVKPVLNF  685
            TL+ EV        KP++N 
Sbjct  187  TLASEVNN--KNVTKPLINL  204



>gb|KCW63274.1| hypothetical protein EUGRSUZ_G00901 [Eucalyptus grandis]
Length=481

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +APD +L+T +PGF+G+LPS HYAGY            ++      + S DPVVLWLNGG
Sbjct  23   AAPDESLITHVPGFDGSLPSSHYAGYK----------IHHCPYCHFDLSLDPVVLWLNGG  72

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFV+EHGPFNF+ GK++GSL  L LNP+SW+KV+NIIYLDSP GVGLSYS+N 
Sbjct  73   PGCSSFDGFVFEHGPFNFQAGKSNGSLAILQLNPFSWSKVSNIIYLDSPCGVGLSYSNNP  132

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
             +Y TGDL+TASD+H FLLKWFELY E+L NPF+I+GESYAGVYVPTL+ +VV+GI    
Sbjct  133  RNYATGDLQTASDTHAFLLKWFELYPEYLSNPFYISGESYAGVYVPTLASDVVKGIKKGE  192

Query  668  KPVLNF  685
            KP++NF
Sbjct  193  KPLINF  198



>ref|XP_006414997.1| hypothetical protein EUTSA_v10027269mg, partial [Eutrema salsugineum]
 gb|ESQ56450.1| hypothetical protein EUTSA_v10027269mg, partial [Eutrema salsugineum]
Length=164

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  56   MVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK  235
            MV   + L +  + F+   +   +SAP+ AL+T+IPGF+GT PSKHY+GYVTID+  GK 
Sbjct  1    MVFITMSLLVKALVFVTFFVVTAESAPESALITKIPGFDGTFPSKHYSGYVTIDKEHGKN  60

Query  236  LFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYS  415
            L+YYF+ESE+NPSKDPVVLWLNGGPGCSS DGFVYEHGPFNFE  K + SLP L LNPYS
Sbjct  61   LWYYFIESEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFEPKKANTSLPLLQLNPYS  120

Query  416  WTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLK  547
            W+KV+NIIYLDSP GVG SYS NE+DY TGD+KTA DSH FLLK
Sbjct  121  WSKVSNIIYLDSPVGVGFSYSKNESDYQTGDIKTAIDSHAFLLK  164



>gb|ABR16352.1| unknown [Picea sitchensis]
Length=505

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 155/220 (70%), Gaps = 3/220 (1%)
 Frame = +2

Query  29   LRTVSSYLNMVKNGLPLHLTLVCFLLPLLQLT-KSAPDGALVTRIPGFNGTLPSKHYAGY  205
            + +   ++  V N    H+  +  L+  +QL    AP  A V   PG++G L S+ YAGY
Sbjct  1    MSSQRKFMKFVVNLFIAHI--IISLISSVQLNCNGAPASARVKYFPGYHGNLNSEIYAGY  58

Query  206  VTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGS  385
            VT+ E +G +LFYYFV+SERNP+KDP++LWL GGPGCSSF GF YE GP +F+L   SG+
Sbjct  59   VTVGEVNGIELFYYFVKSERNPAKDPLLLWLTGGPGCSSFTGFAYELGPMSFDLNNNSGN  118

Query  386  LPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYK  565
            LPTL  NP+SWTKV+NII+LDSP G G SYS+  TDY+TGD K+ SD HTFL+KWFE + 
Sbjct  119  LPTLISNPHSWTKVSNIIFLDSPVGTGFSYSNTTTDYVTGDFKSVSDIHTFLIKWFEAFP  178

Query  566  EFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            EFL NP ++ G+SY+G+ VP + +E+  G +A +KP LN 
Sbjct  179  EFLSNPIYVGGDSYSGMVVPLVVHEIANGNEAGIKPTLNL  218



>ref|XP_002514836.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47390.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  YVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSG  382
            YV+ DE   K LFYYF+ SERNPSKD VVLWLNGGPGCSSFDGFVYEHGPFN++ G+  G
Sbjct  40   YVSFDE---KNLFYYFIVSERNPSKDAVVLWLNGGPGCSSFDGFVYEHGPFNYQEGQQKG  96

Query  383  SLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELY  562
            SLPTLHLNPYSW+KV++IIYLDSP GVGLSYS N + Y   DL+TA+D+HTFLLKWFELY
Sbjct  97   SLPTLHLNPYSWSKVSSIIYLDSPCGVGLSYSKNTSKYTNDDLQTAADTHTFLLKWFELY  156

Query  563  KEFLPNPFFIAGESYAGVYVPTLSYEVVQGI  655
             EF+ NPF+I+GESYAG+YVPTL+ EV +G+
Sbjct  157  PEFVTNPFYISGESYAGIYVPTLASEVAKGM  187



>ref|XP_008366890.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=168

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = +2

Query  83   LTLVCFL-LPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVES  259
            L+L C L + L+ + ++AP  +LVT +PGFN T PSKHY+GY++ID   GK LFYYFV S
Sbjct  10   LSLCCMLFVSLVVIIEAAPQSSLVTHLPGFNATFPSKHYSGYISID---GKNLFYYFVVS  66

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            E NP+ DPVVLWLNGGPGCSSFDGFVYEHGPFNF  GK  G+LP LHLNPYSW+KV+NII
Sbjct  67   EGNPATDPVVLWLNGGPGCSSFDGFVYEHGPFNFAEGKPKGALPVLHLNPYSWSKVSNII  126

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELY  562
            YLDSP+GVG SYS N+T Y TGD++TA D+H FLL+   L+
Sbjct  127  YLDSPAGVGFSYSRNQTKYTTGDIQTALDTHAFLLRVINLF  167



>ref|XP_010520849.1| PREDICTED: serine carboxypeptidase-like 20 [Tarenaya hassleriana]
Length=169

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 9/166 (5%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKS---------APDGALVTRIPGFNGTLPSKHYAGYVTIDETSG  229
            + +  + FL+P L  T +         AP+ ALVT +PGFNGTLPSKHYAGYVTIDE  G
Sbjct  3    VQIIKIFFLIPHLFRTNTKSITPPSLRAPESALVTTLPGFNGTLPSKHYAGYVTIDEKRG  62

Query  230  KKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNP  409
            K L+YYF ESE++PS+DPVVLWLNGGPGCSS DGFVYEHGPF+F+  KT GSLP L  NP
Sbjct  63   KNLWYYFAESEKDPSEDPVVLWLNGGPGCSSMDGFVYEHGPFDFKQAKTDGSLPQLRRNP  122

Query  410  YSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLK  547
            YSW+KV+NIIYLDSP+GVG SYS+ ++DY T D +TA D+H FLLK
Sbjct  123  YSWSKVSNIIYLDSPAGVGFSYSETKSDYSTNDTQTAIDAHAFLLK  168



>ref|XP_002514834.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47388.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            ER+P KDPVVLWLNGGPGCSSFDGFVYEHGPFNF+  K  G+LP LHLNPYSW+KV +II
Sbjct  39   ERSPLKDPVVLWLNGGPGCSSFDGFVYEHGPFNFQEHK-KGTLPILHLNPYSWSKVASII  97

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            YLDSP GVG SYS N T YITGDL+TA+D+HTF+LKWF+LY EFL NPF+I+GESYAG+Y
Sbjct  98   YLDSPCGVGFSYSQNATKYITGDLQTAADTHTFILKWFKLYPEFLDNPFYISGESYAGIY  157

Query  620  VPTLSYEVVQGIDAAVKPVLNF  685
            VPTL+ ++V+G+   VKP +NF
Sbjct  158  VPTLAAKIVKGLKIGVKPRINF  179



>ref|XP_006840207.1| hypothetical protein AMTR_s00089p00129670 [Amborella trichopoda]
 gb|ERN01882.1| hypothetical protein AMTR_s00089p00129670 [Amborella trichopoda]
Length=331

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 136/201 (68%), Gaps = 4/201 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKS----APDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVES  259
            V  LL L+ +T S    A   A V  +PGF G  P   ++GY+++DE +  +LFYYF++S
Sbjct  12   VALLLLLMWVTISDCITADSSARVEFLPGFEGAFPFDFFSGYISVDEVNEYRLFYYFIKS  71

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            E NPSKDP++LWL GGPGCS F G V+E GP  F++ + +G+LP L  NPYSWTKV N+I
Sbjct  72   ENNPSKDPLILWLTGGPGCSGFSGLVFETGPLRFKVEEYNGTLPALQFNPYSWTKVANVI  131

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            Y+DSP G G SYS +  DY T D KT  D H FL  WF  Y EFL NP +IAG+SY+G+ 
Sbjct  132  YVDSPIGTGFSYSKSPPDYATSDSKTVKDLHKFLTNWFIEYPEFLSNPLYIAGDSYSGIT  191

Query  620  VPTLSYEVVQGIDAAVKPVLN  682
            VP L+YE+  GID+  +PV N
Sbjct  192  VPVLTYEIANGIDSGYRPVFN  212



>gb|KFK23485.1| hypothetical protein AALP_AAs46213U000800 [Arabis alpina]
Length=437

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWL  298
            + +SAP+ AL T++PGF+GT PSKHY+GYVTID+   K L+YYFVESE+NPSKDPVVLWL
Sbjct  20   VIESAPESALFTKLPGFDGTFPSKHYSGYVTIDKEHEKNLWYYFVESEKNPSKDPVVLWL  79

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            NGGPGCSS DGFVYEHGP NF+  KT+ +LP L+LNPYSW+KV+NIIYLDSP GVG SYS
Sbjct  80   NGGPGCSSMDGFVYEHGPINFKPAKTNTTLPQLYLNPYSWSKVSNIIYLDSPVGVGFSYS  139

Query  479  DNETDYITGDLKTASDSHTFLLK  547
             N++DY TGD KTA DSH FLLK
Sbjct  140  KNKSDYETGDTKTAVDSHAFLLK  162



>ref|XP_002958371.1| hypothetical protein VOLCADRAFT_108101 [Volvox carteri f. nagariensis]
 gb|EFJ40593.1| hypothetical protein VOLCADRAFT_108101 [Volvox carteri f. nagariensis]
Length=578

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 139/203 (68%), Gaps = 19/203 (9%)
 Frame = +2

Query  134  PDGAL--VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            PD A   +  +PGF   LPS H+AGYV +DE  G++LFYYFVESER+P+ DPVVLWLNGG
Sbjct  42   PDAAADKILSLPGFQNALPSNHFAGYVQVDEQRGRRLFYYFVESERDPANDPVVLWLNGG  101

Query  308  PGCSSFDGFVYEHGPFNFEL----------------GKTSGSLPT-LHLNPYSWTKVTNI  436
            PGCSSFDGFVYEHGPF F L                G  +G L   L  NP++W KV N+
Sbjct  102  PGCSSFDGFVYEHGPFTFNLAVPGPSTTATATSDDAGGVAGGLHVELRSNPFAWNKVANM  161

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP+GVGLSYS+N  DY+  D++TA+D+  FL  WF  + ++L N F+++GESYAG+
Sbjct  162  IFLDSPAGVGLSYSENAADYVVDDVRTAADADRFLRGWFRRFPQYLDNDFYVSGESYAGI  221

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
            YVP L  +V+ G +A  +P +N 
Sbjct  222  YVPNLVRQVLLGNEAGEEPNINI  244



>ref|XP_001703566.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96478.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=475

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            +  +PGF  +LPS+H+AGYVT+DE  G++LFYYFVESER+P+ DPVVLWLNGGPGCSSFD
Sbjct  1    ILALPGFVNSLPSRHFAGYVTVDEARGRRLFYYFVESERDPANDPVVLWLNGGPGCSSFD  60

Query  329  GFVYEHGPFNFEL----GKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDY  496
            GFVYE GPF ++L    G       +L  NP++W+KV N+I+LDSP+GVGLSYS++  DY
Sbjct  61   GFVYEQGPFLYDLIPGPGGRGAQAVSLRRNPHAWSKVANMIFLDSPAGVGLSYSEHAADY  120

Query  497  ITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPV  676
            +  D +TA D+  FL  WF  Y ++  N F+++GESYAG+YVP L  EV+ G +A  +P 
Sbjct  121  VVDDGRTAQDADAFLRGWFARYPQYQANDFYVSGESYAGIYVPNLVREVLIGNEAGEEPN  180

Query  677  LNF  685
            +N 
Sbjct  181  INL  183



>gb|AAA32940.1| carboxypeptidase I precursor, partial [Hordeum vulgare]
Length=412

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  302  GGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSD  481
            GGPGCSSFDGFVYEHGPFNFE G +  SLP LHLNPY+W+KV+ +IYLDSP+GVGLSYS 
Sbjct  1    GGPGCSSFDGFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSYSK  60

Query  482  NETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDA  661
            N +DY TGDLKTA+DSHTFLLKWF+LY EFL NPF+IAGESYAGVYVPTLS+EVV+GI  
Sbjct  61   NVSDYETGDLKTATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGIQG  120

Query  662  AVKPVLNF  685
              KP +NF
Sbjct  121  GAKPTINF  128



>ref|XP_010943621.1| PREDICTED: serine carboxypeptidase 1 [Elaeis guineensis]
Length=348

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 132/197 (67%), Gaps = 2/197 (1%)
 Frame = +2

Query  101  LLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTID-ETSGKKLFYYFVESERNPSK  277
            +L LL L K AP  A V + PGF+G LPSKHYAGY+T+D E   + L+YYF  SERNPSK
Sbjct  18   VLSLLALVKGAPKNAEVKQFPGFDGQLPSKHYAGYITVDNEAYERHLYYYFAISERNPSK  77

Query  278  DPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPT-LHLNPYSWTKVTNIIYLDSP  454
            DP+ +W+NGGPGC+     V   GPF  E  +     P  L  NP+SWTKV++++++DSP
Sbjct  78   DPLTIWINGGPGCAGIGALVQLVGPFKIEYNQYHIKGPAKLKQNPFSWTKVSSVLFMDSP  137

Query  455  SGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLS  634
             GVG SY+D    Y+T D  T SD + F++KWF  Y EFLPNP ++A  SY+GV VP L+
Sbjct  138  VGVGYSYADTSEGYVTNDSDTISDLYEFVIKWFSEYPEFLPNPLYLAACSYSGVIVPVLA  197

Query  635  YEVVQGIDAAVKPVLNF  685
             ++V GI+A   P +NF
Sbjct  198  QKMVNGIEAGRGPTINF  214



>ref|XP_006855958.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
 gb|ERN17425.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
Length=521

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 133/202 (66%), Gaps = 4/202 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKS----APDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVES  259
            +  LL L+ +T S    A   A V  +PGF G LP   ++GY+++DE +  +LFYY ++S
Sbjct  12   IALLLLLMWVTISECITADSSARVEFLPGFEGALPFDFFSGYISVDEVNEYRLFYYLIKS  71

Query  260  ERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNII  439
            E NPSKDP++LWL GGPGCS F G V E GP   ++ + +G+LP L  NPYSWTKV N+I
Sbjct  72   ENNPSKDPLLLWLTGGPGCSGFSGLVIETGPLRIKVEEYNGTLPALRYNPYSWTKVANVI  131

Query  440  YLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVY  619
            Y+DSP G G SYS +  DY T D KT  D H FL  WF  Y EFL NP +IAG+SY+G+ 
Sbjct  132  YVDSPIGTGFSYSKSPPDYATSDSKTVKDLHKFLTNWFIEYPEFLSNPLYIAGDSYSGIT  191

Query  620  VPTLSYEVVQGIDAAVKPVLNF  685
            VP L+ E+  GID+  +PV N 
Sbjct  192  VPVLTSEIANGIDSGYRPVFNL  213



>ref|XP_006840227.1| hypothetical protein AMTR_s00089p00168750 [Amborella trichopoda]
 gb|ERN01902.1| hypothetical protein AMTR_s00089p00168750 [Amborella trichopoda]
Length=495

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 135/193 (70%), Gaps = 6/193 (3%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTI-DETSGKKLFYYFVESERNPSKDPVVLW  295
            + + APDGA V R PGF+G LPSKHYAGY+T+ ++ + + L+YYF  SER+P  DPV +W
Sbjct  24   IVECAPDGAEVLRFPGFDGDLPSKHYAGYITVGNQLNKRHLYYYFATSERDPENDPVAIW  83

Query  296  LNGGPGCSSFDGFVYEHGPFNFELGK---TSGSLPTLHLNPYSWTKVTNIIYLDSPSGVG  466
            LNGGPGCS  +  VY  GPF  +  +    +G+   + LNPYSW+KV+N+IY+D+P+G G
Sbjct  84   LNGGPGCSGLNAVVYLLGPFKVDDNEDYLINGA--RVKLNPYSWSKVSNMIYIDAPAGTG  141

Query  467  LSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVV  646
             SY+DN  DYI  D +  +D + F+LKWF  Y EFLPNPF++ G SY G+ VP +S  + 
Sbjct  142  FSYADNTDDYIVDDPEINADIYEFILKWFLEYPEFLPNPFYVIGSSYGGMLVPVVSLLID  201

Query  647  QGIDAAVKPVLNF  685
            +G++A  KP +NF
Sbjct  202  EGLEAGTKPRINF  214



>gb|KCW58761.1| hypothetical protein EUGRSUZ_H01398 [Eucalyptus grandis]
Length=449

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 136/206 (66%), Gaps = 40/206 (19%)
 Frame = +2

Query  83   LTLVCFLLPLLQLT----KSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYY  247
            L  +C +   L LT    ++AP  +L+T +PGF+GTLPS+HYAGYVTID   GKK LFYY
Sbjct  4    LKFICSITLALLLTVSSVRAAPKESLITSLPGFDGTLPSEHYAGYVTIDGIPGKKNLFYY  63

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
            F+ SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPF F +GK  GSLP LHLNP+SW+KV
Sbjct  64   FIASERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFKFHVGKPKGSLPLLHLNPFSWSKV  123

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
                                     G+L       +F L+      +FL NPF+I+GESY
Sbjct  124  ------------------------IGNL-------SFQLQ----LSKFLSNPFYISGESY  148

Query  608  AGVYVPTLSYEVVQGIDAAVKPVLNF  685
            AG+YVPTL+ EVV+GI     P++NF
Sbjct  149  AGIYVPTLASEVVKGIQIGETPLINF  174



>gb|AFW71417.1| hypothetical protein ZEAMMB73_152983 [Zea mays]
Length=286

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK--LFYYFVESERNPSKDPVVL  292
            L ++AP GA V   PGF G LPSKHYAGYVT+ +   +K  L+YY   SERNPS DPVV+
Sbjct  31   LGRAAPPGAEVAEFPGFTGKLPSKHYAGYVTVGQHEQRKRHLYYYLAVSERNPSLDPVVI  90

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTS-GSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            W+NGGP CS F  F++  GPF  E  +      P + +NPYSWTK+ +++ +DSP+GVG 
Sbjct  91   WINGGPACSGFSAFLHSFGPFRMEGSQVHINDGPRVAVNPYSWTKMASLLLVDSPAGVGY  150

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SY+D+E DY T D    +D + FL KWF  Y EFL NPF++AG SY+GV VP L++E+++
Sbjct  151  SYADHEDDYTTDDTSRVADLYDFLSKWFAEYAEFLSNPFYVAGCSYSGVIVPVLAHEIIK  210

Query  650  GIDAAVKPVLNF  685
              + +    +NF
Sbjct  211  RNEESGGVKINF  222



>gb|KDD76124.1| serine carboxypeptidase, partial [Helicosporidium sp. ATCC 50920]
Length=377

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 121/185 (65%), Gaps = 6/185 (3%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            +  +PG+NG     HY GY+T+DE  G+ L+YY VES  +P KDP++LWLNGGPGCSSFD
Sbjct  46   ILHMPGYNGGELKGHYGGYITVDEQRGRNLYYYLVESANSPQKDPLILWLNGGPGCSSFD  105

Query  329  GFVYEHGPF--NFELGKTSGSLPTLHL----NPYSWTKVTNIIYLDSPSGVGLSYSDNET  490
            GFV EHGPF   FE GK    +    L    N + W K  +I+Y+DSP+GVG+SYSD + 
Sbjct  106  GFVQEHGPFKMEFEGGKDGEGVNAQRLYLRDNVFGWHKAASIVYVDSPAGVGMSYSDADE  165

Query  491  DYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVK  670
            DY T D KT +D H FL  + E + +F    F++AGESYAGVYVP  +  V+ G DA  K
Sbjct  166  DYHTNDEKTIADMHRFLRLFVERHPQFQDVDFYVAGESYAGVYVPLTAQAVLHGNDAGAK  225

Query  671  PVLNF  685
            P LN 
Sbjct  226  PRLNL  230



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            V  L  L  L+KS    ++V  +PGF+G LP K   GYV++ E +  +LFYYF+ESER+P
Sbjct  29   VLLLFALFGLSKSQ---SIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDP  85

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            ++DP++LWL GGPGCS F G VYE GP  F     +GSLP+L LNPYSWTKV +II+LD+
Sbjct  86   ARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDA  145

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P G G SY+ N  DY   D  +A D++ F+ KW   +  FL NP +I G+SY+G+ VP L
Sbjct  146  PVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPIL  205

Query  632  SYEVVQGIDAAVKPVLNF  685
            + E+  GI   +KP++  
Sbjct  206  TLEIANGIQMGLKPLMTL  223



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            V  L  L  L+KS    ++V  +PGF+G LP K   GYV++ E +  +LFYYF+ESER+P
Sbjct  45   VLLLFALFGLSKSQ---SIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDP  101

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            ++DP++LWL GGPGCS F G VYE GP  F     +GSLP+L LNPYSWTKV +II+LD+
Sbjct  102  ARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDA  161

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P G G SY+ N  DY   D  +A D++ F+ KW   +  FL NP +I G+SY+G+ VP L
Sbjct  162  PVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPIL  221

Query  632  SYEVVQGIDAAVKPVLNF  685
            + E+  GI   +KP++  
Sbjct  222  TLEIANGIQMGLKPLMTL  239



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   202 bits (513),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 3/198 (2%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNP  271
            V  L  L  L+KS    ++V  +PGF+G LP K   GYV++ E +  +LFYYF+ESER+P
Sbjct  29   VLLLFALFGLSKSQ---SIVDTLPGFSGELPFKLETGYVSVGELNDVELFYYFIESERDP  85

Query  272  SKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDS  451
            ++DP++LWL GGPGCS F G VYE GP  F     +GSLP+L LNPYSWTKV +II+LD+
Sbjct  86   ARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNPYSWTKVASIIFLDA  145

Query  452  PSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTL  631
            P G G SY+ N  DY   D  +A D++ F+ KW   +  FL NP +I G+SY+G+ VP L
Sbjct  146  PVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLYIGGDSYSGIIVPIL  205

Query  632  SYEVVQGIDAAVKPVLNF  685
            + E+  GI   +KP++  
Sbjct  206  TLEIANGIQMGLKPLMTL  223



>ref|XP_008777952.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Phoenix 
dactylifera]
Length=221

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G+LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGSLPFYLETGYVSVDEENGLELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWTKV +I
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTKVASI  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y TGD+  +  ++ FL KWF  + +FL NP +I+G+SYAG 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYATGDIAWSMHAYKFLRKWFVDHAKFLSNPLYISGDSYAGK  177

Query  617  YVPTLSYEVVQG  652
             VP ++  + +G
Sbjct  178  VVPVVTKAISEG  189



>ref|XP_008790305.1| PREDICTED: serine carboxypeptidase-like 18 [Phoenix dactylifera]
Length=884

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 127/179 (71%), Gaps = 0/179 (0%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            V+R+PGF G LP     GY T+DE +  +LFYYF++SE NP +DP++LWL+GGPGCSSF 
Sbjct  448  VSRLPGFRGALPFYLETGYATVDEVNDSQLFYYFIKSEGNPEEDPLLLWLSGGPGCSSFS  507

Query  329  GFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGD  508
               +E GP  FE+ + +GSLPTL LNPYSWTKV+NII+LDSP G G S+S +   Y  GD
Sbjct  508  ALAFEIGPVQFEIAEHNGSLPTLVLNPYSWTKVSNIIFLDSPIGTGFSFSRSTKGYEVGD  567

Query  509  LKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            + ++   +TFL KWF+ +  FL NP +IAG+SY G  VP ++ E+ QGI+   +P+LN 
Sbjct  568  VISSKQIYTFLRKWFKDHPRFLSNPLYIAGDSYGGKIVPVVAQEISQGIETGQQPLLNL  626


 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 125/211 (59%), Gaps = 7/211 (3%)
 Frame = +2

Query  20   SQSLRTVSSYLNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYA  199
            ++  R +SS L M+         L   LLP    +        +T +PGF+GTLP     
Sbjct  4    AKEARKLSSSLAMLS-------ILFVLLLPTFSCSSIVSALNTITHLPGFHGTLPFHLET  56

Query  200  GYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTS  379
            GYV +DE +  +LFYYF++SER P +DP+++WL GGPGCS     V+E GP  F++   +
Sbjct  57   GYVKVDEVNDAQLFYYFIKSERKPEEDPLIVWLTGGPGCSGLSALVFEIGPLKFDVAGYT  116

Query  380  GSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFEL  559
              LPTL  NPY+WTKV NII LDSP G G SYS     Y TGD K     HTFL KWF  
Sbjct  117  EGLPTLVYNPYTWTKVCNIIILDSPVGTGFSYSSVGKSYETGDTKAVRQVHTFLRKWFID  176

Query  560  YKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            + EFL NP +I G+SY+G+ VP  + E+ +G
Sbjct  177  HPEFLSNPLYIGGDSYSGIVVPVAAQEIAKG  207



>gb|AFW71416.1| hypothetical protein ZEAMMB73_152983 [Zea mays]
Length=477

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK--LFYYFVESERNPSKDPVVL  292
            L ++AP GA V   PGF G LPSKHYAGYVT+ +   +K  L+YY   SERNPS DPVV+
Sbjct  31   LGRAAPPGAEVAEFPGFTGKLPSKHYAGYVTVGQHEQRKRHLYYYLAVSERNPSLDPVVI  90

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTS-GSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            W+NGGP CS F  F++  GPF  E  +      P + +NPYSWTK+ +++ +DSP+GVG 
Sbjct  91   WINGGPACSGFSAFLHSFGPFRMEGSQVHINDGPRVAVNPYSWTKMASLLLVDSPAGVGY  150

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SY+D+E DY T D    +D + FL KWF  Y EFL NPF++AG SY+GV VP L++E+++
Sbjct  151  SYADHEDDYTTDDTSRVADLYDFLSKWFAEYAEFLSNPFYVAGCSYSGVIVPVLAHEIIK  210

Query  650  GIDAAVKPVLNF  685
              + +    +NF
Sbjct  211  SNEESGGVKINF  222



>ref|NP_001132320.1| uncharacterized protein LOC100193762 precursor [Zea mays]
 gb|ACF81119.1| unknown [Zea mays]
 gb|AFW71418.1| hypothetical protein ZEAMMB73_152983 [Zea mays]
Length=477

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKK--LFYYFVESERNPSKDPVVL  292
            L ++AP GA V   PGF G LPSKHYAGYVT+ +   +K  L+YY   SERNPS DPVV+
Sbjct  31   LGRAAPPGAEVAEFPGFTGKLPSKHYAGYVTVGQHEQRKRHLYYYLAVSERNPSLDPVVI  90

Query  293  WLNGGPGCSSFDGFVYEHGPFNFELGKTS-GSLPTLHLNPYSWTKVTNIIYLDSPSGVGL  469
            W+NGGP CS F  F++  GPF  E  +      P + +NPYSWTK+ +++ +DSP+GVG 
Sbjct  91   WINGGPACSGFSAFLHSFGPFRMEGSQVHINDGPRVAVNPYSWTKMASLLLVDSPAGVGY  150

Query  470  SYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQ  649
            SY+D+E DY T D    +D + FL KWF  Y EFL NPF++AG SY+GV VP L++E+++
Sbjct  151  SYADHEDDYTTDDTSRVADLYDFLSKWFAEYAEFLSNPFYVAGCSYSGVIVPVLAHEIIK  210

Query  650  GIDAAVKPVLNF  685
              + +    +NF
Sbjct  211  RNEESGGVKINF  222



>ref|XP_008443686.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Cucumis 
melo]
Length=458

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 121/186 (65%), Gaps = 43/186 (23%)
 Frame = +2

Query  134  PDGALVTRIPGF-NGTLPSKHYAGYVTIDE-TSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            P G+LVT +PGF N   PSKH++GY+ IDE  SGKKLFYYFV SER+P++DPVVLWLNGG
Sbjct  25   PQGSLVTHLPGFTNNNFPSKHHSGYINIDEIESGKKLFYYFVTSERSPAEDPVVLWLNGG  84

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGCSSFDGFVYEHGPFNFE G   G+LPTLHLNPYSW+                      
Sbjct  85   PGCSSFDGFVYEHGPFNFEEGNPKGTLPTLHLNPYSWS----------------------  122

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
                               KWF+ + EF+ NPF+IAGESYAG+YVPTL+ +VV+G+    
Sbjct  123  -------------------KWFKEFPEFVKNPFYIAGESYAGIYVPTLASQVVKGLKDGA  163

Query  668  KPVLNF  685
             P++N 
Sbjct  164  LPIINL  169



>ref|XP_010936153.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=438

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  86   TLVCFLLPLLQL-TKSAPDGAL--VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
             L    +PLL + +  +P  AL  +T +PGF+GTLP     GYV +DE +  +LFYYF++
Sbjct  16   ALSILFVPLLTIFSCPSPVSALNTITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIK  75

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE  P +DP+++WL GGPGCS+F G VYE GP  F++   +  LPTL  NPYSWTKV NI
Sbjct  76   SESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNI  135

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G SYS  E  Y TGD K A   HTFL KW   + EFL NP +I G+SY+G+
Sbjct  136  IFLDSPVGTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGI  195

Query  617  YVPTLSYEVVQG  652
             VP ++ E+ +G
Sbjct  196  VVPVVAQEIAKG  207



>ref|XP_008777951.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Phoenix 
dactylifera]
Length=248

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 3/191 (2%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G+LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGSLPFYLETGYVSVDEENGLELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWTKV +I
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTKVASI  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y TGD+  +  ++ FL KWF  + +FL NP +I+G+SYAG 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYATGDIAWSMHAYKFLRKWFVDHAKFLSNPLYISGDSYAGK  177

Query  617  YVPTLSYEVVQ  649
             VP ++  + +
Sbjct  178  VVPVVTKAISE  188



>ref|XP_010936152.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  86   TLVCFLLPLLQL-TKSAPDGAL--VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
             L    +PLL + +  +P  AL  +T +PGF+GTLP     GYV +DE +  +LFYYF++
Sbjct  16   ALSILFVPLLTIFSCPSPVSALNTITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIK  75

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE  P +DP+++WL GGPGCS+F G VYE GP  F++   +  LPTL  NPYSWTKV NI
Sbjct  76   SESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNI  135

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G SYS  E  Y TGD K A   HTFL KW   + EFL NP +I G+SY+G+
Sbjct  136  IFLDSPVGTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGI  195

Query  617  YVPTLSYEVVQG  652
             VP ++ E+ +G
Sbjct  196  VVPVVAQEIAKG  207



>emb|CCW28854.1| putative serine carboxypeptidase [Arachis duranensis]
Length=447

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKV  427
             V  E +P KDPVVLWLNGGPGCSSFDGFVYEHGPFNFE  K  G LP L LN YSW+KV
Sbjct  17   LVNQESDPKKDPVVLWLNGGPGCSSFDGFVYEHGPFNFEKPKAKGVLPKLTLNKYSWSKV  76

Query  428  TNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESY  607
            +NIIYLDSP+GVG SY+ NE+ Y TGD++ A D+H     WF+LY EF  N FF+AGES+
Sbjct  77   SNIIYLDSPAGVGFSYAKNESAYETGDIRVAHDTH-----WFQLYPEFQHNQFFLAGESF  131

Query  608  AGVYVPTLSYEVVQGI---DAAVKPVLNF  685
            AG+YVPTL+  +V+GI   DA ++  +NF
Sbjct  132  AGIYVPTLANNIVKGIIDEDARMQSKINF  160



>ref|XP_004952450.1| PREDICTED: serine carboxypeptidase 1-like [Setaria italica]
Length=475

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 126/189 (67%), Gaps = 2/189 (1%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTI-DETSGKKLFYYFVESERNPSKDPVVLWLN  301
            ++AP GA VT  PGF+G LPSKHYAGY+T+  E   + L+YY   SERNP+ DPVV+W+N
Sbjct  32   RAAPAGAEVTEFPGFHGVLPSKHYAGYITVGHEQQNRHLYYYLATSERNPTLDPVVIWIN  91

Query  302  GGPGCSSFDGFVYEHGPFNFELGKTS-GSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYS  478
            GGP CS F  F +  GPF  E  +      P    NPYSWTK+ +++ +DSP+GVG SY+
Sbjct  92   GGPACSGFSAFHHSIGPFKIEYSQVHVKDDPRATKNPYSWTKMASLLLVDSPAGVGYSYA  151

Query  479  DNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID  658
            +N+ DYIT D    +D + FL KWF  Y EF+ NPF++AG SY+GV VP L+ E+++  +
Sbjct  152  ENDDDYITNDTSRVADLYDFLSKWFAEYTEFMSNPFYVAGCSYSGVIVPVLAQEILKRNE  211

Query  659  AAVKPVLNF  685
               +  +NF
Sbjct  212  EPYRMKINF  220



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 127/192 (66%), Gaps = 3/192 (2%)
 Frame = +2

Query  86   TLVCFLLPLLQL-TKSAPDGAL--VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
             L    +PLL + +  +P  AL  +T +PGF+GTLP     GYV +DE +  +LFYYF++
Sbjct  16   ALSILFVPLLTIFSCPSPVSALNTITHLPGFHGTLPFYLETGYVKVDEVNDAQLFYYFIK  75

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SE  P +DP+++WL GGPGCS+F G VYE GP  F++   +  LPTL  NPYSWTKV NI
Sbjct  76   SESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNI  135

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G SYS  E  Y TGD K A   HTFL KW   + EFL NP +I G+SY+G+
Sbjct  136  IFLDSPVGTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGI  195

Query  617  YVPTLSYEVVQG  652
             VP ++ E+ +G
Sbjct  196  VVPVVAQEIAKG  207



>gb|ACG26067.1| hypothetical protein [Zea mays]
Length=477

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 126/190 (66%), Gaps = 3/190 (2%)
 Frame = +2

Query  125  KSAPDGALVTRIPGFNGTLPSKHYAGYVTI--DETSGKKLFYYFVESERNPSKDPVVLWL  298
            ++AP GA V   PGF G LPSKHYAGYVT+   E   K L+YY   SERNPS DPVV+W+
Sbjct  33   RAAPPGAEVAEFPGFTGKLPSKHYAGYVTVGRHEQRKKHLYYYLAVSERNPSLDPVVIWI  92

Query  299  NGGPGCSSFDGFVYEHGPFNFELGKTS-GSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSY  475
            NGGP CS F  F++  GPF  E  +      P + LN YSWTK+ +++ +DSP+GVG SY
Sbjct  93   NGGPACSGFSAFLHSFGPFRMEDSQVHINDDPRVALNTYSWTKMASLLLVDSPAGVGYSY  152

Query  476  SDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGI  655
            +D+E DY T D    +D + FL KWF  Y EFL NPF++AG SY+GV VP L++E+++  
Sbjct  153  ADHEDDYTTDDTSRVADLYDFLSKWFAEYAEFLSNPFYVAGCSYSGVIVPVLAHEIIKRN  212

Query  656  DAAVKPVLNF  685
            + +    +NF
Sbjct  213  EESGGVKINF  222



>ref|XP_009395245.1| PREDICTED: serine carboxypeptidase-like 12 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 129/186 (69%), Gaps = 1/186 (1%)
 Frame = +2

Query  131  APDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGP  310
            A  G +V R+PGF G LP     GYV +DE +G + FYYF+ESE NPS+DP++LWL GGP
Sbjct  25   ARSGTVVPRLPGFRGPLPFHLETGYVEVDEVNGTEFFYYFIESEGNPSEDPLLLWLTGGP  84

Query  311  GCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDN-E  487
             CS+F G V+E GP  F   K +GSLP+L   PYSWTKV+N+I+LDSP G G S+S + E
Sbjct  85   RCSAFCGLVFEVGPLKFVSAKYNGSLPSLVYRPYSWTKVSNMIFLDSPVGSGFSFSRHVE  144

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAV  667
            + Y  GD+  +   +TFL+KW   + +FL NP +IAG+SYAG  VP ++ EV+ GI+A  
Sbjct  145  SYYDAGDISWSQHVYTFLIKWLVDHPKFLSNPLYIAGDSYAGKIVPIVAQEVLNGIEAEK  204

Query  668  KPVLNF  685
            +P+LN 
Sbjct  205  RPLLNL  210



>ref|XP_010939018.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=381

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 130/201 (65%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  +  L  L  L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+ESE
Sbjct  42   LMALTVLFFLYYLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIESE  101

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            RNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWTKV N+I+
Sbjct  102  RNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTKVANVIF  161

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP G G S+S     Y  GD+ ++   + FL KWF  +  FL N  +I+G+SYAG  V
Sbjct  162  LDSPVGTGFSFSRKPKGYAVGDISSSMQVYKFLRKWFVDHARFLSNSLYISGDSYAGKVV  221

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            P ++  + + I+A  +  LN 
Sbjct  222  PVIAKAISEDIEADQQSSLNL  242



>ref|XP_002604286.1| hypothetical protein BRAFLDRAFT_88575 [Branchiostoma floridae]
 gb|EEN60297.1| hypothetical protein BRAFLDRAFT_88575 [Branchiostoma floridae]
Length=476

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 132/194 (68%), Gaps = 9/194 (5%)
 Frame = +2

Query  74   PLHLTLVCFLL--PLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYY  247
            P    LV F++  P   L++   D   +  +PG N TLP   YAGY+T++E+ G++LFY+
Sbjct  3    PYVCLLVVFIVICPGQSLSRPETDSDKIESLPGLNATLPFSQYAGYITVNESHGRRLFYW  62

Query  248  FVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFN-FELGKTSGSLPTLHLNPYSWTK  424
            FVES+ +P +DP+VLWLNGGPGCSSF+G   E+GPF+  + GK      TL LNP SW +
Sbjct  63   FVESQSDPERDPLVLWLNGGPGCSSFNGLFEENGPFSPNKDGK------TLDLNPNSWNR  116

Query  425  VTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGES  604
              ++I+L+SPSGVG SYSD  +DY TGD +TA DS  F+LK+ E Y +F  N F+I GES
Sbjct  117  NASVIFLESPSGVGFSYSDTTSDYTTGDWQTAQDSLNFMLKFLEKYPQFKKNKFWITGES  176

Query  605  YAGVYVPTLSYEVV  646
            YAG YVP L+  +V
Sbjct  177  YAGHYVPNLASHIV  190



>ref|XP_008799202.1| PREDICTED: serine carboxypeptidase 1 [Phoenix dactylifera]
Length=454

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 126/191 (66%), Gaps = 2/191 (1%)
 Frame = +2

Query  119  LTKSAPDGALVTRIPGFNGTLPSKHYAGYVTI-DETSGKKLFYYFVESERNPSKDPVVLW  295
            L + A   A V R PGF+G LPSKHYAGY+T+ ++   + L+YYF  SERNP +DP+ +W
Sbjct  9    LHEGASTNAEVKRFPGFDGQLPSKHYAGYITVGNQADERHLYYYFASSERNPLEDPLTIW  68

Query  296  LNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPT-LHLNPYSWTKVTNIIYLDSPSGVGLS  472
            +NGGPGC+     V   GPF  +  +     P  L  NP+SWTKV++++++DSP GVG S
Sbjct  69   INGGPGCAGIGALVQLVGPFKIDYNQFHIKGPAKLKQNPFSWTKVSSVLFVDSPVGVGYS  128

Query  473  YSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            Y+D    Y+T D  T SD + F++KWF  Y EFLPNP ++A  SY+GV VP L+ E+V G
Sbjct  129  YADTSEGYVTNDSDTISDLYEFVIKWFSEYPEFLPNPLYLAACSYSGVIVPVLAQEIVNG  188

Query  653  IDAAVKPVLNF  685
            I+A   P +NF
Sbjct  189  IEAGRGPTINF  199



>tpg|DAA39922.1| TPA: hypothetical protein ZEAMMB73_827985 [Zea mays]
Length=320

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 123/187 (66%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +A +  +VT +PGF G LP +   GYV +DE +G +LFYYF  SE + + DPV+LWL+GG
Sbjct  71   AAAEERVVTHLPGFQGPLPFQLRTGYVEVDEDNGVRLFYYFTLSEGSSADDPVMLWLSGG  130

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGC+SF G VY+ GP +F+L    G LP L   P SWTKV+NII+LDSP G G SYS  E
Sbjct  131  PGCTSFTGLVYQIGPLSFDLDSYMGGLPKLVYRPESWTKVSNIIFLDSPVGAGFSYSVKE  190

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID-AA  664
              Y + D K  S    FL KWF+ + EFL NP +I G+SYAG+ VPT++ E+ +G+    
Sbjct  191  QGYNSSDTKAVSHILVFLKKWFDEHPEFLSNPLYIGGDSYAGMIVPTVTSEIAKGLKIVG  250

Query  665  VKPVLNF  685
             KP +N 
Sbjct  251  SKPTMNL  257



>ref|XP_009393004.1| PREDICTED: serine carboxypeptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 131/200 (66%), Gaps = 0/200 (0%)
 Frame = +2

Query  86   TLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESER  265
            + V FL+ L   +  A   + V R+PG+ G LP     GYVT+DE +G +LFYYF  SE 
Sbjct  11   SFVLFLVLLFARSSPALSASAVARLPGYPGPLPFYMETGYVTVDEVNGAELFYYFTASEG  70

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
            +PS+DP++LWL GG  CS F G  +E GP  F + + +GS+PTL  NPYSWTKV++II++
Sbjct  71   DPSQDPLLLWLTGGDRCSVFSGLAFELGPVKFVISEYNGSIPTLTYNPYSWTKVSSIIFV  130

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP G G S+S ++  Y   D   +   H FL+KWF  + ++LPNP +IAG+SYAG+YVP
Sbjct  131  DSPVGAGFSFSRDDEGYDIDDTAASMQVHKFLVKWFIDHPQYLPNPLYIAGDSYAGIYVP  190

Query  626  TLSYEVVQGIDAAVKPVLNF  685
             ++  + Q  +A ++P LN 
Sbjct  191  LVAQAISQDNEAGLQPHLNL  210



>ref|XP_006648620.1| PREDICTED: serine carboxypeptidase 1-like [Oryza brachyantha]
Length=295

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 123/181 (68%), Gaps = 2/181 (1%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTI-DETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSF  325
            V   PGF+G LPSKHYAGY+T+  +   + ++YYF  SERNP+ DPV++W+NGGP CS F
Sbjct  31   VAEFPGFHGELPSKHYAGYITVGHQEQNRHMYYYFATSERNPTTDPVIIWINGGPACSGF  90

Query  326  DGFVYEHGPFNFELGKTSGS-LPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYIT  502
              F++  GPF  E      S  P   LNP+SWTK+++++ +DSP+GVG SYS+NE DY++
Sbjct  91   SAFLHSIGPFKIEGPMIHASDEPRAKLNPFSWTKMSSLLLVDSPAGVGYSYSENEDDYVS  150

Query  503  GDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLN  682
             D     D + FL KWF  Y EFL NPF+IAG SY+GV VP L+ E+++  + + +  +N
Sbjct  151  NDTSRVLDLYEFLSKWFNEYPEFLSNPFYIAGCSYSGVIVPVLAQEILERNEDSGRIKIN  210

Query  683  F  685
            F
Sbjct  211  F  211



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 2/189 (1%)
 Frame = +2

Query  92   VCFLLPLLQLTKSAPDGAL--VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESER  265
            + F+L L   +  +P  AL  +T +PGF+G LP     GYV +DE +  +LFYYF++SE 
Sbjct  19   ILFVLLLTIYSCPSPVSALNTITHLPGFHGALPFYLETGYVKVDEVNDAQLFYYFIKSES  78

Query  266  NPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYL  445
             P +DP+++WL GGPGCS+F G VYE GP  F++   +  LPTL  +PYSWTKV NII+L
Sbjct  79   KPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYHPYSWTKVCNIIFL  138

Query  446  DSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVP  625
            DSP G G SYS  E  Y TGD K A   HTFL KW   + EFL NP +I G+SY+G+ VP
Sbjct  139  DSPVGTGFSYSSVEKSYETGDTKAARQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVP  198

Query  626  TLSYEVVQG  652
             ++ E+ +G
Sbjct  199  VVAQEIAKG  207



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = +2

Query  149  VTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFD  328
            V  +PGF G LP +   GYV + ++   +LFYYFV+SERNP +DP++LWL GGPGCS+F 
Sbjct  30   VKFLPGFEGPLPFELETGYVGVGDSEDVQLFYYFVKSERNPEEDPLLLWLTGGPGCSAFS  89

Query  329  GFVYEHGPFNFELG-KTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITG  505
            G V+E GP NF+   + +GSLPTL LNPYSWTKV+NII++DSP G G SY+ N    +TG
Sbjct  90   GLVFEIGPLNFKADVEYNGSLPTLVLNPYSWTKVSNIIFVDSPVGTGFSYARNNLAALTG  149

Query  506  DLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            D K A+  H FL KW + + +F+ +P +++G+SY+G+ +P L+ E++ G +  ++P+++ 
Sbjct  150  DFKQANQLHQFLRKWLKDHPDFISSPVYVSGDSYSGIPIPVLAQEILNGNEEGIRPIISL  209



>ref|XP_011457835.1| PREDICTED: serine carboxypeptidase-like 7 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 126/185 (68%), Gaps = 1/185 (1%)
 Frame = +2

Query  131  APDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGP  310
            A    +V  +PG+NGTLP K   GY+++D+     LFYYFVES+RNP +DP+VLWL GGP
Sbjct  20   ATSRTIVETLPGWNGTLPFKLETGYISVDDLDEVNLFYYFVESDRNPIEDPLVLWLTGGP  79

Query  311  GCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNET  490
            GCS F  F YE GPF F+L   +GS+PT+ +NPYSWTKV NII++D+P G G SYS +  
Sbjct  80   GCSGFSAFAYEIGPFTFDL-HYNGSIPTIVMNPYSWTKVANIIFIDAPVGAGFSYSTSSE  138

Query  491  DYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVK  670
             + T D K A+ ++TFL KW   + E+  N  ++ G+SY+G+ VP L   +++G++A ++
Sbjct  139  GWYTSDTKQAAQTYTFLRKWLYTHPEYQGNQLYVGGDSYSGLIVPILLKNILEGLEAGLR  198

Query  671  PVLNF  685
            P +  
Sbjct  199  PRMQL  203



>ref|XP_010939016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=498

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 130/201 (65%), Gaps = 0/201 (0%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            L  +  L  L  L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+ESE
Sbjct  42   LMALTVLFFLYYLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIESE  101

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
            RNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWTKV N+I+
Sbjct  102  RNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTKVANVIF  161

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            LDSP G G S+S     Y  GD+ ++   + FL KWF  +  FL N  +I+G+SYAG  V
Sbjct  162  LDSPVGTGFSFSRKPKGYAVGDISSSMQVYKFLRKWFVDHARFLSNSLYISGDSYAGKVV  221

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            P ++  + + I+A  +  LN 
Sbjct  222  PVIAKAISEDIEADQQSSLNL  242



>ref|XP_004960851.1| PREDICTED: serine carboxypeptidase-like 19-like [Setaria italica]
Length=465

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 128/204 (63%), Gaps = 1/204 (0%)
 Frame = +2

Query  74   PLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFV  253
            PL   L+ FLL L  +  SA +  LV  +PG+ G LP +   GYV +DE +G +LFYYF+
Sbjct  4    PLMAILLVFLLCLFNIA-SAAERNLVDSLPGYEGALPFRLETGYVNVDEKNGAELFYYFI  62

Query  254  ESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTN  433
            ESE +P +DP++LWL GG  C+ F G  +E GP  F     +GS+P L  NPYSWTK  N
Sbjct  63   ESEDDPRRDPLLLWLTGGDHCTVFSGLAFEIGPVKFIREPYNGSVPRLKYNPYSWTKAAN  122

Query  434  IIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAG  613
            II++DSP G G S+S +   Y  GD+ ++     FL KWFE + +FL NPF++ G+SY G
Sbjct  123  IIFVDSPVGAGFSFSQDTKGYAVGDVSSSLQLKIFLYKWFEGHPDFLANPFYVGGDSYGG  182

Query  614  VYVPTLSYEVVQGIDAAVKPVLNF  685
              VP L  ++ + I+A V+P LN 
Sbjct  183  KIVPYLVQKITEDIEAQVRPALNL  206



>ref|XP_005646632.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22088.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
Length=467

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  194  YAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGK  373
            +AGY+T+D   G+KLF+YFV SER+P+ DPVVLWLNGGPGCSSFDGF++EHGP  F+L  
Sbjct  13   HAGYITVDHQRGRKLFFYFVTSERDPAYDPVVLWLNGGPGCSSFDGFLFEHGPLRFKLNN  72

Query  374  TSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWF  553
             S  L ++  N  +W++V N++YLDSP+GVGLSYS    DY T D  TA DS+ FL  +F
Sbjct  73   ASNGL-SITRNVGAWSQVANMLYLDSPAGVGLSYSATPEDYTTNDTHTAHDSNIFLRSFF  131

Query  554  ELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            + + EF   PF+I+GESYAGVYVPTL  EV++G      P ++ 
Sbjct  132  QEFDEFAKLPFYISGESYAGVYVPTLVKEVLEGNANGQHPKIDL  175



>gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 135/203 (67%), Gaps = 3/203 (1%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L +TLV   + ++ L  +    + +  +PGF+G LP K   GYV + +    +LFYYF+E
Sbjct  13   LQITLV---IVMVFLKSTVASFSTIKNLPGFSGPLPFKLETGYVEVGKKGDVQLFYYFIE  69

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNP +DP++LWL GGPGCSS  G ++E GP  F + + +GSLPTL LNP+SWTKV++I
Sbjct  70   SERNPREDPLLLWLTGGPGCSSLSGLIFEIGPLQFNIVEYNGSLPTLKLNPHSWTKVSSI  129

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LD+P G G SYS +     TGD   A  ++TFL KW   + EF+ NP +IAG+SY+G+
Sbjct  130  IFLDAPVGTGFSYSRSYHSSETGDTIQAIHTYTFLKKWLLSHPEFIKNPLYIAGDSYSGM  189

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP ++ ++  GI+  V+P +N 
Sbjct  190  VVPVITKQISIGIELGVQPQINL  212



>ref|XP_010939014.1| PREDICTED: serine carboxypeptidase-like 17 isoform X3 [Elaeis 
guineensis]
Length=451

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWT+V N+
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTRVANV  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y  GD+ ++   + FL KWF  + +FL N  +I+G+SY G 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYAVGDISSSMQVYKFLRKWFVDHAQFLSNSLYISGDSYGGK  177

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP ++  + + I+A  +  LN 
Sbjct  178  VVPVVADAISKDIEADQQSRLNL  200



>ref|XP_010939015.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Elaeis 
guineensis]
Length=432

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWT+V N+
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTRVANV  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y  GD+ ++   + FL KWF  + +FL N  +I+G+SY G 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYAVGDISSSMQVYKFLRKWFVDHAQFLSNSLYISGDSYGGK  177

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP ++  + + I+A  +  LN 
Sbjct  178  VVPVVADAISKDIEADQQSRLNL  200



>ref|XP_010040883.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW44821.1| hypothetical protein EUGRSUZ_L01608 [Eucalyptus grandis]
Length=418

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 116/181 (64%), Gaps = 0/181 (0%)
 Frame = +2

Query  143  ALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSS  322
            A+V  IPGF G LP K   GYV + E    +LFYYF+ESER+P  DP++LWL GGPGCSS
Sbjct  21   AIVESIPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSS  80

Query  323  FDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYIT  502
              G +YE GP  F+   +SG+ P L  NPYSWTKV NII+LD+P G G SY+   T Y  
Sbjct  81   LSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKVANIIFLDAPVGTGFSYATTSTAYDI  140

Query  503  GDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLN  682
             D  +A+ ++ FL KW   +  FL NP ++ G+SY+GV +P +   +  GI+A  +P +N
Sbjct  141  SDTSSAAQTYEFLRKWLVSHPSFLANPLYVTGDSYSGVVIPIIVKNIQDGIEAGRQPQMN  200

Query  683  F  685
             
Sbjct  201  L  201



>ref|XP_010939013.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=456

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWT+V N+
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTRVANV  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y  GD+ ++   + FL KWF  + +FL N  +I+G+SY G 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYAVGDISSSMQVYKFLRKWFVDHAQFLSNSLYISGDSYGGK  177

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP ++  + + I+A  +  LN 
Sbjct  178  VVPVVADAISKDIEADQQSRLNL  200



>ref|XP_007201135.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
 gb|EMJ02334.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
Length=450

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 121/181 (67%), Gaps = 0/181 (0%)
 Frame = +2

Query  143  ALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSS  322
            + +  +PGF+G LP K   GYV + +    +LFYYF+ESER+P +DP+VLWL GGPGCS 
Sbjct  8    STIDTLPGFSGELPFKLETGYVGVGDLDDVQLFYYFIESERSPKEDPLVLWLTGGPGCSG  67

Query  323  FDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYIT  502
            F G  Y+ GP  F    +SG+ PTL LNPYSWTKV NII+LD P G G SY+ +   Y T
Sbjct  68   FSGLAYQIGPIMFNYANSSGNEPTLMLNPYSWTKVANIIFLDQPVGSGFSYAKSWQGYET  127

Query  503  GDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPVLN  682
            GD+ +AS ++ FL KW + + EFL NP +IAG+SY+G+ VP +  EV  G +   +P LN
Sbjct  128  GDISSASHTYEFLRKWLKDHPEFLKNPLYIAGDSYSGITVPIVVQEVSNGNEVGHEPPLN  187

Query  683  F  685
             
Sbjct  188  L  188



>ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=470

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 131/203 (65%), Gaps = 4/203 (2%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            L L ++C +L ++ L+ S     ++T +PGF+G LP K   GY+ + +    +LFYYF+E
Sbjct  4    LQLFILCVVLNMV-LSSSQ---QIITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIE  59

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SER+P  DP+VLWL+GGPGCS F G V+E GP +F+  K+  +LP   LNPYSWTKV NI
Sbjct  60   SERSPEDDPLVLWLSGGPGCSGFSGLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANI  119

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LD+P G G SY++    YI  D  +A+ ++ FL KW   +  FL NP +I G+SY+G+
Sbjct  120  IFLDAPVGTGFSYANTWQGYIMNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGI  179

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP +   +  GID   +P +N 
Sbjct  180  IVPMIVQHISDGIDVGHRPRMNL  202



>ref|XP_010939012.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Elaeis 
guineensis]
Length=475

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = +2

Query  77   LHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVE  256
            + LT++ FL     L+ +A   +++T +PGF G LP     GYV++DE +G +LFYYF+E
Sbjct  1    MALTILFFLY---YLSSTALSASIITHLPGFQGPLPFYLETGYVSVDEENGVELFYYFIE  57

Query  257  SERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNI  436
            SERNPS+DP++LWL GGPGCS+F G V+E GP  F   + +GSLP L  +PYSWT+V N+
Sbjct  58   SERNPSEDPLLLWLTGGPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTRVANV  117

Query  437  IYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGV  616
            I+LDSP G G S+S     Y  GD+ ++   + FL KWF  + +FL N  +I+G+SY G 
Sbjct  118  IFLDSPVGTGFSFSRKPEGYAVGDISSSMQVYKFLRKWFVDHAQFLSNSLYISGDSYGGK  177

Query  617  YVPTLSYEVVQGIDAAVKPVLNF  685
             VP ++  + + I+A  +  LN 
Sbjct  178  VVPVVADAISKDIEADQQSRLNL  200



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  20   SQSLRTVSSYLNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYA  199
            ++  R +SS L M+         L   LLP    +        +T +PGF+GTLP     
Sbjct  489  AKEARKLSSSLAMLS-------ILFVLLLPTFSCSSIVSALNTITHLPGFHGTLPFHLET  541

Query  200  GYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTS  379
            GYV +DE +  +LFYYF++SERNP +DP+++WL GGPGCS       + GP  F++   +
Sbjct  542  GYVEVDEVNDAQLFYYFIKSERNPEEDPLIVWLTGGPGCSGLSALAIQIGPLKFDVASYT  601

Query  380  GSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFEL  559
            G LPTL  NPY+WTKV NII+LDSP G G SYS     Y TGD K A   HTFL KWF  
Sbjct  602  GGLPTLVYNPYTWTKVCNIIFLDSPVGTGFSYSSVGKSYKTGDTKAARQVHTFLRKWFID  661

Query  560  YKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            + EFL NP ++ G+SY+G+ VP  + E+ +G
Sbjct  662  HPEFLSNPLYVGGDSYSGIVVPVAAQEIAKG  692


 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  20   SQSLRTVSSYLNMVKNGLPLHLTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYA  199
            ++  R +SS L M+         L   LLP    +        +T +PGF+GTLP     
Sbjct  4    AEEARILSSSLAMLS-------ILFVLLLPTFSCSSIVSALNTITHLPGFHGTLPFYLET  56

Query  200  GYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTS  379
            GYV +DE +  +LFYYF++SER P +DP+++WL GGPGCS F   V+E GP  F++   +
Sbjct  57   GYVKVDEVNDAQLFYYFIKSERKPEEDPLIVWLTGGPGCSGFSALVFEIGPLKFDVAGYT  116

Query  380  GSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFEL  559
              LP L  NP++WTKV NII+LDSP G G SYS     Y  GD K A   HTFL KWF  
Sbjct  117  EGLPALVYNPHTWTKVCNIIFLDSPVGTGFSYSSMGKSYEMGDTKAARQVHTFLRKWFID  176

Query  560  YKEFLPNPFFIAGESYAGVYVPTLSYEVVQG  652
            + EFL NP +I G+SY+G+ VP ++ E+ +G
Sbjct  177  HLEFLSNPLYIGGDSYSGIVVPVVAQEIAKG  207



>gb|KJB58678.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=398

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 2/201 (1%)
 Frame = +2

Query  83   LTLVCFLLPLLQLTKSAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESE  262
            + L+ F   L QL  +   G+ V  +PGF G LP +   GYV + ++   +LFYYFV+SE
Sbjct  1    MALLLFFFYLSQLALA--HGSAVKFLPGFEGPLPFELETGYVGVGDSEEAQLFYYFVKSE  58

Query  263  RNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIY  442
              P  DP++ WL GGPGCS+F G V+E GP  F++   +GSLPTL  NPY+WTKV+NII+
Sbjct  59   GKPEDDPLLFWLTGGPGCSAFSGLVFEIGPLKFKVDVYNGSLPTLVYNPYAWTKVSNIIF  118

Query  443  LDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYV  622
            +DSP G G SY+ N     TGDLK     H FL KW   + +F+ NP +++G+SY+G+ V
Sbjct  119  IDSPVGTGFSYATNNRAAQTGDLKQVHHLHQFLRKWLMAHPDFISNPVYVSGDSYSGIPV  178

Query  623  PTLSYEVVQGIDAAVKPVLNF  685
            P L+ E+  G +  +KPV++ 
Sbjct  179  PVLAQEISNGNEEGIKPVIHL  199



>ref|XP_010028345.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55077.1| hypothetical protein EUGRSUZ_I01042 [Eucalyptus grandis]
Length=464

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 117/183 (64%), Gaps = 0/183 (0%)
 Frame = +2

Query  137  DGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGC  316
              A+V  +PGF G LP K   GYV + E    +LFYYF+ESER+P  DP++LWL GGPGC
Sbjct  19   QSAIVESLPGFPGELPFKLETGYVGVGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGC  78

Query  317  SSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDY  496
            SS  G +YE GP  F+   +SG+ P L  NPYSWTK+ NII+LD+P G G SY+   T Y
Sbjct  79   SSLSGLIYEIGPMQFDFSSSSGTKPILKYNPYSWTKIANIIFLDAPVGTGFSYATTPTAY  138

Query  497  ITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPV  676
               D  +A+ ++ FL KW   Y  FL NP +++G+SY+GV +P +   +  GI+A  +P 
Sbjct  139  NISDTSSAAQTYEFLRKWLVSYPSFLANPLYVSGDSYSGVVIPIVVKNIQDGIEAGRQPQ  198

Query  677  LNF  685
            +N 
Sbjct  199  MNL  201



>dbj|BAD19824.1| putative carboxypeptidase C precursor [Oryza sativa Japonica 
Group]
Length=331

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = +2

Query  140  GALVTRIPGFNGTLPSKHYAGYVTIDETSGKK-LFYYFVESERNPSKDPVVLWLNGGPGC  316
            GA V+  PGF+G LPSKHYAGY+T+     K+ ++YYF  SERN + DPV++W+NGGP C
Sbjct  64   GAEVSEFPGFDGDLPSKHYAGYITVGHQPLKRHMYYYFATSERNSTTDPVIIWINGGPAC  123

Query  317  SSFDGFVYEHGPFNFELGKT-SGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETD  493
            S F  F++  GP   E     +   P   LNP+SWTK+++++ +DSP+GVG SYS+NE D
Sbjct  124  SGFSAFLHSIGPLKIEGPMIHARDEPRTKLNPFSWTKMSSVLLVDSPAGVGYSYSENEDD  183

Query  494  YITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKP  673
            Y+T D     D + FL KWF  Y EFL NPF+IAG SY+GV VP L+ E+++  +   + 
Sbjct  184  YVTNDTSRVLDLYDFLSKWFSEYLEFLSNPFYIAGCSYSGVIVPVLAQEILKRNEDNGRI  243

Query  674  VLNF  685
             +NF
Sbjct  244  KINF  247



>gb|AAX92980.1| Serine carboxypeptidase [Oryza sativa Japonica Group]
Length=236

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 128/209 (61%), Gaps = 7/209 (3%)
 Frame = +2

Query  71   LPLHLTLVCFLLPLLQLTKSAPDGAL----VTRIPGFNGTLPSKHYAGYVTIDETSGKKL  238
            + + L   CFLL    +T +A  G+L    V  +PGF+G LPS+   GYVT+DE +G +L
Sbjct  1    MAVRLCCCCFLL---FVTIAAAGGSLTRTNVATLPGFDGALPSRLETGYVTVDEENGAEL  57

Query  239  FYYFVESERNPSKDPVVLWLNGGPGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSW  418
            FYYF+ESE +PS DPV+LW+ GG  CS      +E GP    +   +GSLP LH +PYSW
Sbjct  58   FYYFIESEGDPSTDPVLLWITGGDRCSVLSALFFEIGPLKLVIEPYNGSLPRLHYHPYSW  117

Query  419  TKVTNIIYLDSPSGVGLSYSDNETDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAG  598
            TKV +I+++DSP G G S+S +   Y  GD+  +      L +WF  Y  +L NPF++ G
Sbjct  118  TKVASILFVDSPVGAGFSFSRDPKGYDVGDVSASMQLIKLLREWFTEYPHYLSNPFYVGG  177

Query  599  ESYAGVYVPTLSYEVVQGIDAAVKPVLNF  685
            +SYAG  VP +  ++ + I+A V+P  N 
Sbjct  178  DSYAGKIVPFIVQKISEDIEAGVRPTFNL  206



>ref|XP_011399295.1| Serine carboxypeptidase 1 [Auxenochlorella protothecoides]
 gb|KFM26399.1| Serine carboxypeptidase 1 [Auxenochlorella protothecoides]
Length=458

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 120/183 (66%), Gaps = 7/183 (4%)
 Frame = +2

Query  158  IPGFNGT-LPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGGPGCSSFDGF  334
            +PG+  T  PS+HY GY+ +D + G++LFYY+VESE + S  P+VLWLNGGPGCSSFDGF
Sbjct  1    MPGYPHTPFPSRHYGGYINVDASRGRRLFYYYVESEDDSSSTPLVLWLNGGPGCSSFDGF  60

Query  335  VYEHGPFNFELG---KTSGSLPT---LHLNPYSWTKVTNIIYLDSPSGVGLSYSDNETDY  496
            V EHGPF          +G L     L  NP+SW+K  +++Y+DSP+GVG+SYSD   DY
Sbjct  61   VKEHGPFKVSFNGRPDATGELKQDIRLDDNPFSWSKSAHMLYVDSPAGVGMSYSDTRQDY  120

Query  497  ITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGIDAAVKPV  676
            +T D  T +D H FL  W + Y E    PF++AGESYAGV+VP L   V+ G   + +  
Sbjct  121  VTNDTATTADLHHFLRLWLQEYPEHRETPFYVAGESYAGVFVPLLVQAVLNGNQESGRAP  180

Query  677  LNF  685
            +N 
Sbjct  181  INI  183



>ref|NP_001151152.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG41791.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACN35614.1| unknown [Zea mays]
Length=477

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 123/187 (66%), Gaps = 1/187 (1%)
 Frame = +2

Query  128  SAPDGALVTRIPGFNGTLPSKHYAGYVTIDETSGKKLFYYFVESERNPSKDPVVLWLNGG  307
            +A +  +VT +PGF G LP +   GYV +DE +G +LFYYF  SE + + DPV+LWL+GG
Sbjct  26   AAAEERVVTHLPGFQGPLPFQLRTGYVEVDEDNGVRLFYYFTLSEGSSADDPVMLWLSGG  85

Query  308  PGCSSFDGFVYEHGPFNFELGKTSGSLPTLHLNPYSWTKVTNIIYLDSPSGVGLSYSDNE  487
            PGC+SF G VY+ GP +F+L    G LP L   P SWTKV+NII+LDSP G G SYS  E
Sbjct  86   PGCTSFTGLVYQIGPLSFDLDSYMGGLPKLVYRPESWTKVSNIIFLDSPVGAGFSYSVKE  145

Query  488  TDYITGDLKTASDSHTFLLKWFELYKEFLPNPFFIAGESYAGVYVPTLSYEVVQGID-AA  664
              Y + D K  S    FL KWF+ + EFL NP +I G+SYAG+ VPT++ E+ +G+    
Sbjct  146  QGYNSSDTKAVSHILVFLKKWFDEHPEFLSNPLYIGGDSYAGMIVPTVTSEIAKGLKIVG  205

Query  665  VKPVLNF  685
             KP +N 
Sbjct  206  SKPTMNL  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700