BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020N03

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365590.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    143   3e-37   Solanum tuberosum [potatoes]
ref|XP_004231468.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    140   2e-36   Solanum lycopersicum
ref|XP_009775151.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    132   2e-33   Nicotiana sylvestris
ref|XP_009622651.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    129   7e-32   Nicotiana tomentosiformis
ref|XP_008243095.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   6e-26   Prunus mume [ume]
ref|XP_007202272.1|  hypothetical protein PRUPE_ppa008876mg             111   2e-25   Prunus persica
gb|KJB12379.1|  hypothetical protein B456_002G015500                    107   5e-25   Gossypium raimondii
ref|XP_004287200.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    109   7e-25   Fragaria vesca subsp. vesca
gb|KJB12380.1|  hypothetical protein B456_002G015500                    107   1e-24   Gossypium raimondii
ref|XP_008371199.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   1e-24   
gb|KJB12378.1|  hypothetical protein B456_002G015500                    108   2e-24   Gossypium raimondii
ref|XP_008394237.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   6e-24   
ref|XP_009366273.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_009366271.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_010261280.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   3e-23   Nelumbo nucifera [Indian lotus]
gb|EYU35575.1|  hypothetical protein MIMGU_mgv1a010240mg                105   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_006851962.1|  hypothetical protein AMTR_s00041p00192380          104   3e-23   Amborella trichopoda
ref|XP_008383698.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   4e-23   
ref|XP_008383690.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   5e-23   
ref|XP_003555846.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   6e-23   Glycine max [soybeans]
gb|KDP37529.1|  hypothetical protein JCGZ_05968                         104   7e-23   Jatropha curcas
ref|XP_003555845.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   7e-23   Glycine max [soybeans]
ref|XP_008383707.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    103   7e-23   
ref|XP_010112544.1|  E3 ubiquitin ligase BIG BROTHER-related protein    103   9e-23   
gb|KHN23096.1|  E3 ubiquitin ligase BIG BROTHER-related                 103   1e-22   Glycine soja [wild soybean]
gb|ACU14657.1|  unknown                                                 101   3e-22   Glycine max [soybeans]
ref|XP_010655907.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   3e-22   Vitis vinifera
ref|XP_010655908.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   3e-22   Vitis vinifera
gb|EPS70975.1|  hypothetical protein M569_03787                       98.6    4e-22   Genlisea aurea
ref|XP_007142774.1|  hypothetical protein PHAVU_007G015800g             101   6e-22   Phaseolus vulgaris [French bean]
ref|XP_004497226.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   8e-22   Cicer arietinum [garbanzo]
ref|XP_003536731.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   8e-22   Glycine max [soybeans]
ref|XP_004497227.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   8e-22   Cicer arietinum [garbanzo]
ref|XP_002310069.1|  zinc finger family protein                         100   1e-21   
ref|XP_008445883.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    100   2e-21   Cucumis melo [Oriental melon]
ref|XP_011002252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.4    4e-21   Populus euphratica
ref|XP_011002254.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.4    4e-21   Populus euphratica
ref|XP_011002253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.4    4e-21   Populus euphratica
gb|AFK47989.1|  unknown                                               97.1    7e-21   Lotus japonicus
ref|XP_011022026.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    8e-21   Populus euphratica
ref|XP_011022025.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    9e-21   Populus euphratica
ref|XP_004143619.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    1e-20   Cucumis sativus [cucumbers]
ref|XP_010688664.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  96.7    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688665.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  96.3    4e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP14406.1|  unnamed protein product                              94.0    2e-19   Coffea canephora [robusta coffee]
ref|XP_011070448.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  93.6    3e-19   Sesamum indicum [beniseed]
ref|XP_010541856.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  92.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010067008.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  91.3    3e-18   Eucalyptus grandis [rose gum]
gb|KCW65071.1|  hypothetical protein EUGRSUZ_G02582                   90.1    6e-18   Eucalyptus grandis [rose gum]
gb|KCW65072.1|  hypothetical protein EUGRSUZ_G02582                   89.7    7e-18   Eucalyptus grandis [rose gum]
ref|XP_007043263.1|  RING/U-box superfamily protein                   89.0    3e-17   
ref|XP_006406443.1|  hypothetical protein EUTSA_v10021098mg           86.7    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006298094.1|  hypothetical protein CARUB_v10014137mg           85.5    2e-16   Capsella rubella
ref|XP_002883210.1|  zinc finger family protein                       85.1    3e-16   
ref|NP_566651.1|  E3 ubiquitin ligase BIG BROTHER-like protein        85.1    4e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61025.1|  unknown                                               85.1    4e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39312.1|  hypothetical protein AALP_AA3G228600                  83.6    1e-15   Arabis alpina [alpine rockcress]
ref|XP_009145730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.6    1e-15   Brassica rapa
ref|XP_010487948.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008789252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.2    1e-15   
ref|XP_010487949.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008789253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.2    1e-15   Phoenix dactylifera
ref|XP_010466157.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  83.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009111410.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  82.4    3e-15   Brassica rapa
ref|XP_010932524.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  81.6    4e-15   Elaeis guineensis
ref|XP_010508204.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  81.6    6e-15   Camelina sativa [gold-of-pleasure]
emb|CDY24595.1|  BnaC05g32790D                                        81.3    6e-15   Brassica napus [oilseed rape]
emb|CDY42218.1|  BnaA01g25770D                                        78.6    6e-14   Brassica napus [oilseed rape]
ref|XP_006437610.1|  hypothetical protein CICLE_v10032094mg           77.4    8e-14   
emb|CDY25357.1|  BnaA05g19270D                                        78.2    8e-14   Brassica napus [oilseed rape]
ref|XP_006382945.1|  hypothetical protein POPTR_0005s09300g           77.8    9e-14   
ref|XP_006382946.1|  hypothetical protein POPTR_0005s09300g           77.8    9e-14   
ref|XP_006437609.1|  hypothetical protein CICLE_v10032094mg           77.8    1e-13   Citrus clementina [clementine]
emb|CDY33429.1|  BnaC01g32960D                                        75.1    1e-12   Brassica napus [oilseed rape]
ref|XP_008795341.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  72.4    6e-12   Phoenix dactylifera
ref|XP_003592713.1|  RING finger protein                              72.8    8e-12   Medicago truncatula
ref|XP_003592714.1|  RING finger protein                              72.8    9e-12   Medicago truncatula
ref|XP_004974139.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  72.0    9e-12   Setaria italica
ref|XP_009395387.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  72.0    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ86011.1|  unknown                                               72.4    9e-12   Medicago truncatula
ref|XP_006659662.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  71.6    2e-11   Oryza brachyantha
gb|ADE77661.1|  unknown                                               70.9    2e-11   Picea sitchensis
ref|XP_002445744.1|  hypothetical protein SORBIDRAFT_07g024950        70.9    3e-11   Sorghum bicolor [broomcorn]
gb|ABK26080.1|  unknown                                               70.5    3e-11   Picea sitchensis
gb|ACJ85919.1|  unknown                                               70.9    4e-11   Medicago truncatula
gb|KJB31862.1|  hypothetical protein B456_005G211500                  69.7    4e-11   Gossypium raimondii
ref|XP_009392890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  70.1    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB31861.1|  hypothetical protein B456_005G211500                  70.5    5e-11   Gossypium raimondii
gb|KJB31859.1|  hypothetical protein B456_005G211500                  70.1    7e-11   Gossypium raimondii
ref|XP_010906327.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  68.9    1e-10   Elaeis guineensis
dbj|BAK04753.1|  predicted protein                                    68.9    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002521533.1|  ring finger protein, putative                    68.9    1e-10   Ricinus communis
gb|KDO52708.1|  hypothetical protein CISIN_1g019980mg                 67.8    2e-10   Citrus sinensis [apfelsine]
gb|KDO52709.1|  hypothetical protein CISIN_1g019980mg                 67.4    2e-10   Citrus sinensis [apfelsine]
gb|KDO52707.1|  hypothetical protein CISIN_1g019980mg                 67.8    2e-10   Citrus sinensis [apfelsine]
gb|KDO52706.1|  hypothetical protein CISIN_1g019980mg                 67.8    4e-10   Citrus sinensis [apfelsine]
gb|KDO52705.1|  hypothetical protein CISIN_1g019980mg                 67.8    4e-10   Citrus sinensis [apfelsine]
ref|XP_009395284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  66.6    8e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT04037.1|  RING-H2 finger protein ATL3F                          66.2    1e-09   
ref|NP_001063778.1|  Os09g0535100                                     62.8    2e-08   
gb|EEC84951.1|  hypothetical protein OsI_32172                        62.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006661480.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  61.6    4e-08   Oryza brachyantha
ref|XP_003578515.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  62.0    4e-08   Brachypodium distachyon [annual false brome]
dbj|BAJ88925.1|  predicted protein                                    62.0    5e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009418697.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  61.2    5e-08   
ref|XP_010235389.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  58.9    4e-07   Brachypodium distachyon [annual false brome]
ref|XP_003574899.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  58.9    4e-07   Brachypodium distachyon [annual false brome]
tpg|DAA40634.1|  TPA: putative RING zinc finger domain superfamil...  58.5    8e-07   
ref|NP_001149296.1|  LOC100282919                                     58.2    9e-07   Zea mays [maize]
tpg|DAA40635.1|  TPA: putative RING zinc finger domain superfamil...  57.4    9e-07   
gb|EYU20483.1|  hypothetical protein MIMGU_mgv1a013375mg              56.6    1e-06   Erythranthe guttata [common monkey flower]
emb|CAC10211.1|  E3 ubiquitin ligase BIG BROTHER-related protein      56.6    1e-06   Cicer arietinum [garbanzo]
ref|XP_008679088.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  55.1    2e-06   
ref|XP_009376874.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  55.1    6e-06   Pyrus x bretschneideri [bai li]
gb|AFW65659.1|  putative RING zinc finger domain superfamily protein  55.5    6e-06   
ref|NP_001150748.1|  protein binding protein                          55.8    6e-06   Zea mays [maize]
tpg|DAA62493.1|  TPA: putative RING zinc finger domain superfamil...  55.8    6e-06   
ref|NP_001131853.1|  uncharacterized LOC100193231                     55.5    6e-06   Zea mays [maize]
gb|ACG31571.1|  hypothetical protein                                  55.5    7e-06   Zea mays [maize]
ref|XP_008651502.1|  PREDICTED: protein binding protein isoform X2    55.5    7e-06   
ref|XP_004957470.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  55.5    7e-06   Setaria italica
ref|XP_002460573.1|  hypothetical protein SORBIDRAFT_02g031050        55.5    7e-06   Sorghum bicolor [broomcorn]
ref|XP_001769627.1|  predicted protein                                55.1    9e-06   
ref|XP_008651501.1|  PREDICTED: protein binding protein isoform X1    55.5    9e-06   Zea mays [maize]
gb|KHG07975.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  53.9    1e-05   Gossypium arboreum [tree cotton]
ref|XP_008674938.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.4    2e-05   
ref|XP_008673640.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.4    2e-05   
ref|XP_006859208.1|  hypothetical protein AMTR_s00070p00189230        53.9    2e-05   
gb|KHG29072.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...  52.4    6e-05   Gossypium arboreum [tree cotton]
ref|NP_001062434.1|  Os08g0548300                                     52.4    8e-05   
gb|EAZ07897.1|  hypothetical protein OsI_30152                        52.4    8e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_007019133.1|  RING/U-box superfamily protein, putative         51.6    8e-05   
ref|XP_008666504.1|  PREDICTED: uncharacterized protein LOC103645175  51.2    1e-04   
ref|XP_008646568.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  52.0    1e-04   
ref|XP_007226705.1|  hypothetical protein PRUPE_ppa020151mg           50.4    2e-04   
ref|XP_008219608.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  50.4    2e-04   Prunus mume [ume]
ref|XP_008338661.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  50.1    3e-04   Malus domestica [apple tree]



>ref|XP_006365590.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=313

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 6/122 (5%)
 Frame = +1

Query  313  QP--SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD----Asdyvsedeygydyd  474
            QP  SRRTPFTDLSQ+DADLALARTLQ+QERAYMML+MN D     S       +  D D
Sbjct  54   QPGASRRTPFTDLSQVDADLALARTLQDQERAYMMLSMNDDGIDYGSWDAGSYGHDEDED  113

Query  475  dddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            +D +     E+DGS+VDE+DEDAFDVHAH+EASEDEN G+ELDPSAF SDEAYARALQ+A
Sbjct  114  EDFDDPSEEEDDGSNVDEDDEDAFDVHAHEEASEDENQGVELDPSAFSSDEAYARALQDA  173

Query  655  EE  660
            EE
Sbjct  174  EE  175



>ref|XP_004231468.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum lycopersicum]
Length=314

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedey----gydyddddn  486
            SRRTPFTDLSQ+DADLALARTLQ+QERAYMML+MN D  DY S D        D D+D +
Sbjct  59   SRRTPFTDLSQVDADLALARTLQDQERAYMMLSMNDDGIDYGSWDAGNYGHDEDEDEDFD  118

Query  487  fddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
                 E+DGS V E+DEDAFDVHAHDEASEDEN G+ELDPSAF SDEAYARALQ+AEE
Sbjct  119  DPSEEEDDGSDVGEDDEDAFDVHAHDEASEDENQGVELDPSAFSSDEAYARALQDAEE  176



>ref|XP_009775151.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
sylvestris]
Length=319

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA---sdyvsedeygydyddddnfdd  495
            RTPFT+LSQ DADLALARTLQEQERAYMML+MN D      +        + DD+D  D 
Sbjct  67   RTPFTNLSQEDADLALARTLQEQERAYMMLSMNSDGIDFGSWDGGSYDHDEEDDEDFDDP  126

Query  496  pseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              EED S+VDE++EDAFDVHAHDEA EDEN GIELDPSAF SDEAYARALQ+AEE
Sbjct  127  SEEEDDSNVDEDEEDAFDVHAHDEAGEDENQGIELDPSAFSSDEAYARALQDAEE  181



>ref|XP_009622651.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
tomentosiformis]
Length=331

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 110/160 (69%), Gaps = 14/160 (9%)
 Frame = +1

Query  202  NLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALART  381
            N P  ++S+    V E +  GE G S  V+  + GG   SRRTPFT+LSQ DADLALART
Sbjct  41   NWPYGDSSS---QVVEINANGESGVSAAVD--SNGG--ASRRTPFTNLSQEDADLALART  93

Query  382  LQEQERAYMMLTMNGD----AsdyvsedeygydyddddnfddpseedGSHV---DEEDED  540
            LQEQERAYMML+MNGD     S      ++  + D+D +     +ED S+V   +E+ ED
Sbjct  94   LQEQERAYMMLSMNGDGIDFGSWDGGSYDHDEEDDEDFDDPSEEDEDDSNVDEDEEDGED  153

Query  541  AFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            AFDVHAHDEA EDEN GIELDPSAF SDEAYARALQ+AEE
Sbjct  154  AFDVHAHDEAGEDENQGIELDPSAFSSDEAYARALQDAEE  193



>ref|XP_008243095.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=316

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 11/122 (9%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD----------Asdyvsedeygydyd  474
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN +          +  +  ED++   +D
Sbjct  61   RTPFTNLSQVDADLALARTLQEQERAYMMLRMNNEDSDYGSWEAGSYVHEDEDDFNDFHD  120

Query  475  dddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            D D+ DD  + DG+ VD  DEDAFDVHAHD+A ED+N  +E DP+ F SDEAYARALQ+A
Sbjct  121  DTDDNDDEEQYDGTEVD-NDEDAFDVHAHDDAGEDDNPRVEYDPAVFSSDEAYARALQDA  179

Query  655  EE  660
            E+
Sbjct  180  ED  181



>ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
 gb|EMJ03471.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
Length=316

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 11/122 (9%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGD----------Asdyvsedeygydyd  474
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN +          +  +  ED++   +D
Sbjct  61   RTPFTNLSQVDADLALARTLQEQERAYMMLRMNNEDSDYGSWEAGSYVHEDEDDFNDFHD  120

Query  475  dddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            D D+ DD  + DG+ VD  DEDAFDVH HD+A ED+N  +E DP+ F SDEAYARALQ+A
Sbjct  121  DTDDNDDEEQYDGTEVD-NDEDAFDVHGHDDAGEDDNPRVEYDPAVFSSDEAYARALQDA  179

Query  655  EE  660
            E+
Sbjct  180  ED  181



>gb|KJB12379.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=172

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygy------dy  471
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D SDY S +   Y      + 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDGSDYGSWEGGSYLNDDDFND  88

Query  472  ddddnfddpseedGSH--VDEEDEDAFDVHAHDEASEDEN-LGIELDPSAFPSDEAYARA  642
              D +  D  +++G +   D  D DAFD H H E  ED+N   +ELDP+ F SDEAYARA
Sbjct  89   LHDHDDTDDDDDEGEYDGTDAGDVDAFDFHDHSEDGEDDNDASVELDPADFSSDEAYARA  148

Query  643  LQEAEE  660
            LQ+AEE
Sbjct  149  LQDAEE  154



>ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN + SDY S +   Y +DD+D+F D 
Sbjct  51   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHDDEDDFHDD  110

Query  499  seed-------GSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
            ++ +       G+  D ++EDAFDVHAH++A +D N  +  DP+ F SDEAYARALQ+AE
Sbjct  111  TDGNDDDEHYDGTDADNDEEDAFDVHAHEDAGDDHNPSVVYDPAVFSSDEAYARALQDAE  170

Query  658  E  660
            +
Sbjct  171  D  171



>gb|KJB12380.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
 gb|KJB12381.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=240

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygy------dy  471
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D SDY S +   Y      + 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDGSDYGSWEGGSYLNDDDFND  88

Query  472  ddddnfddpseedGSH--VDEEDEDAFDVHAHDEASEDEN-LGIELDPSAFPSDEAYARA  642
              D +  D  +++G +   D  D DAFD H H E  ED+N   +ELDP+ F SDEAYARA
Sbjct  89   LHDHDDTDDDDDEGEYDGTDAGDVDAFDFHDHSEDGEDDNDASVELDPADFSSDEAYARA  148

Query  643  LQEAEE  660
            LQ+AEE
Sbjct  149  LQDAEE  154



>ref|XP_008371199.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Malus domestica]
Length=218

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydyddddn  486
            RTPF++LSQ+DADLALARTLQEQERAYMML MN      G         E   D+++ D+
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDNDFNEFDD  123

Query  487  fddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              D  + DG+ VD  DEDAFD+HA D+A ED+N  +E  P+ F SDEAYARALQ+AE+
Sbjct  124  DADEEQYDGTEVD-SDEDAFDLHAQDDAGEDDNPSVEYGPAVFSSDEAYARALQDAED  180



>gb|KJB12378.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=287

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygy------dy  471
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML+MN D SDY S +   Y      + 
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLSMNNDGSDYGSWEGGSYLNDDDFND  88

Query  472  ddddnfddpseedGSH--VDEEDEDAFDVHAHDEASEDEN-LGIELDPSAFPSDEAYARA  642
              D +  D  +++G +   D  D DAFD H H E  ED+N   +ELDP+ F SDEAYARA
Sbjct  89   LHDHDDTDDDDDEGEYDGTDAGDVDAFDFHDHSEDGEDDNDASVELDPADFSSDEAYARA  148

Query  643  LQEAEE  660
            LQ+AEE
Sbjct  149  LQDAEE  154



>ref|XP_008394237.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=319

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN--------GDAsdyvsedeygydyddd  480
            RTPF++LSQ+DADLALARTLQEQERAYMML MN         +A  YV EDE  ++  DD
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNVDSDYGSWEAGSYVHEDEDDFNEFDD  124

Query  481  dnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            D  D+  E+D     + DEDAFDVHAHD+A E++N  +E DP+ F SDEAYARALQ+AE+
Sbjct  125  DTDDNDEEQDDETEVDNDEDAFDVHAHDDAGENDNPSVEYDPAVFSSDEAYARALQDAED  184



>ref|XP_009366273.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Pyrus x bretschneideri]
Length=317

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 11/122 (9%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------ydyd  474
            RTPF++LSQ+DADLALARTLQEQERAYMML MN + SDY S +                D
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDDDFNEFDD  124

Query  475  dddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            D D+ DD  + DG+ VD  DEDAF++HAHD+A ED+N  +E  P+ F SDEAYARALQ+A
Sbjct  125  DADDNDDEEQYDGTEVDN-DEDAFNLHAHDDAGEDDNPIVEYGPAVFSSDEAYARALQDA  183

Query  655  EE  660
            E+
Sbjct  184  ED  185



>ref|XP_009366271.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Pyrus x bretschneideri]
Length=320

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 11/122 (9%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------ydyd  474
            RTPF++LSQ+DADLALARTLQEQERAYMML MN + SDY S +                D
Sbjct  65   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDDDFNEFDD  124

Query  475  dddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            D D+ DD  + DG+ VD  DEDAF++HAHD+A ED+N  +E  P+ F SDEAYARALQ+A
Sbjct  125  DADDNDDEEQYDGTEVDN-DEDAFNLHAHDDAGEDDNPIVEYGPAVFSSDEAYARALQDA  183

Query  655  EE  660
            E+
Sbjct  184  ED  185



>ref|XP_010261280.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nelumbo nucifera]
Length=278

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 88/163 (54%), Gaps = 45/163 (28%)
 Frame = +1

Query  247  EESREGEFGASTN------VNQG-----AQGGRQPSRRTPFTDLSQIDADLALARTLQEQ  393
            E SREG  GA  N      V +          RQ SR TPFT LSQ+DADLALARTLQEQ
Sbjct  2    ENSREGCDGAKKNEESPNSVTEAEPESNLAASRQTSR-TPFTSLSQVDADLALARTLQEQ  60

Query  394  ERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedGSHVDEE--------------  531
            ERAYMML MN                   +  D  S E+GS+V E+              
Sbjct  61   ERAYMMLRMNS-----------------GEGSDYGSSENGSYVYEDDVDDQNEEENAETD  103

Query  532  -DEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
             DEDAFDVHA  +A  D N   ELDPSAF SDEAYARALQEAE
Sbjct  104  ADEDAFDVHARVDAG-DNNQATELDPSAFDSDEAYARALQEAE  145



>gb|EYU35575.1| hypothetical protein MIMGU_mgv1a010240mg [Erythranthe guttata]
Length=318

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 94/174 (54%), Gaps = 25/174 (14%)
 Frame = +1

Query  157  VAKTTADDHQENPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPF  336
            V  T   D ++NP NN PT                   G             +P RRTPF
Sbjct  11   VDTTVRADEEQNPTNNPPTE------------------GDGAAAATAVAAANRP-RRTPF  51

Query  337  TDLSQIDADLALARTLQEQERAYMMLTMN----GDAsdyvsedeygydyddddnfddpse  504
            T+LSQ+DADLALARTLQEQERAYMML M+     D   + +E     D  D  +     +
Sbjct  52   TNLSQVDADLALARTLQEQERAYMMLRMDMGEGSDYGSWEAESYEDEDEVDAYDDASEED  111

Query  505  edGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
             DGS   VD+E EDAFDVHA     E ++   E+DPSAF SDEAYARALQ+AEE
Sbjct  112  YDGSDVEVDDEAEDAFDVHARAGGVESDSQNDEVDPSAFSSDEAYARALQDAEE  165



>ref|XP_006851962.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
 gb|ERN13429.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
Length=279

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 92/142 (65%), Gaps = 11/142 (8%)
 Frame = +1

Query  247  EESREGEFGASTN--VNQGAQGGR--QPSRRTPFTDLSQIDADLALARTLQEQERAYMML  414
            +E   GE GA     ++ G    R  QPSR TPFT LSQ+DADLALARTLQEQERAYM+L
Sbjct  5    KEGSVGEKGADETPVMDDGGSNSRPSQPSR-TPFTSLSQVDADLALARTLQEQERAYMVL  63

Query  415  TMNGDAsdyvsedeygydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGI  594
             MNG+       +       D +   D  +E+G +  ++DEDAFDV A  +A+++EN   
Sbjct  64   RMNGEL---HEYESSASGSYDYEEDGDDLDENGGNERDDDEDAFDVIARADAADEEN---  117

Query  595  ELDPSAFPSDEAYARALQEAEE  660
            E+DPSAF SDEAYARALQ+ EE
Sbjct  118  EIDPSAFDSDEAYARALQDVEE  139



>ref|XP_008383698.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Malus domestica]
Length=312

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydyddddn  486
            RTPF++LSQ+DADLALARTLQEQERAYMML MN      G         E   D+++ D+
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDNDFNEFDD  123

Query  487  fddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              D  + DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+
Sbjct  124  DADEEQYDGTEVD-SDEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAED  180



>ref|XP_008383690.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Malus domestica]
Length=315

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydyddddn  486
            RTPF++LSQ+DADLALARTLQEQERAYMML MN      G         E   D+++ D+
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDNDFNEFDD  123

Query  487  fddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              D  + DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+
Sbjct  124  DADEEQYDGTEVD-SDEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAED  180



>ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
2 [Glycine max]
Length=341

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 79/150 (53%), Gaps = 50/150 (33%)
 Frame = +1

Query  304  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydydddd  483
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN +                  
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNEG-----------------  110

Query  484  nfddpseedGSHVDEEDED-------------------------------AFDVHAHDEA  570
              D  S E GS++ +E +D                               AFDVHAH  A
Sbjct  111  -SDYGSWEGGSYLHDEGDDFDDLHDGTDVDEDEDDDDDEDDDDEEDEDEDAFDVHAHASA  169

Query  571  SEDENLGIELDPSAFPSDEAYARALQEAEE  660
             E +N  IE DP  F SDEAYARALQEAEE
Sbjct  170  GEHDNPTIEFDPDVFSSDEAYARALQEAEE  199



>gb|KDP37529.1| hypothetical protein JCGZ_05968 [Jatropha curcas]
Length=314

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 84/134 (63%), Gaps = 11/134 (8%)
 Frame = +1

Query  292  QGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN-----------GDAsd  438
            Q AQ  RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML              G    
Sbjct  49   QEAQPPRQSSRRTPFTNLSQVDADLALARTLQEQERAYMMLRFGNEGSDYGSWEAGSYFP  108

Query  439  yvsedeygydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFP  618
               +D    D D D + DD  EE+     ++  DAFDVHAH +A  D N  ++LDP+ F 
Sbjct  109  DDEDDFGDPDDDSDGDDDDEEEEEDGTDVDDSMDAFDVHAHTDADVDNNPAVDLDPAMFS  168

Query  619  SDEAYARALQEAEE  660
            SDEAYARALQ+AEE
Sbjct  169  SDEAYARALQDAEE  182



>ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
1 [Glycine max]
Length=335

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 79/150 (53%), Gaps = 50/150 (33%)
 Frame = +1

Query  304  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydydddd  483
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN +                  
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNEG-----------------  110

Query  484  nfddpseedGSHVDEEDED-------------------------------AFDVHAHDEA  570
              D  S E GS++ +E +D                               AFDVHAH  A
Sbjct  111  -SDYGSWEGGSYLHDEGDDFDDLHDGTDVDEDEDDDDDEDDDDEEDEDEDAFDVHAHASA  169

Query  571  SEDENLGIELDPSAFPSDEAYARALQEAEE  660
             E +N  IE DP  F SDEAYARALQEAEE
Sbjct  170  GEHDNPTIEFDPDVFSSDEAYARALQEAEE  199



>ref|XP_008383707.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Malus domestica]
Length=302

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydyddddn  486
            RTPF++LSQ+DADLALARTLQEQERAYMML MN      G         E   D+++ D+
Sbjct  64   RTPFSNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEAGSYVHEDDNDFNEFDD  123

Query  487  fddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              D  + DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+
Sbjct  124  DADEEQYDGTEVD-SDEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAED  180



>ref|XP_010112544.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
 gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
Length=342

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 87/128 (68%), Gaps = 15/128 (12%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg------------  462
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +N D SDY S +               
Sbjct  62   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRLNNDGSDYGSWEAGSYLHDDEDDFNDF  121

Query  463  -ydyddddnfddpseedGSHVDEEDEDAFDVHA-HDEASEDENLGIELDPSAFPSDEAYA  636
              + D DD+ D+  E +G+ V E DEDAFD HA HD+  ED ++ +E DP+ F SDEAYA
Sbjct  122  HDETDADDDGDEEDEYEGTDV-ENDEDAFDAHAHHDDDGEDNSISVEYDPAVFSSDEAYA  180

Query  637  RALQEAEE  660
            RALQ+AEE
Sbjct  181  RALQDAEE  188



>gb|KHN23096.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=335

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 89/132 (67%), Gaps = 14/132 (11%)
 Frame = +1

Query  304  GGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydydddd  483
            G RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN + SDY S +   Y +DD D
Sbjct  69   GSRQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEGGSYLHDDGD  127

Query  484  nfddpseed-------------GSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSD  624
            +FDD  +                   ++EDEDAFDVHAH  A E +N  IE DP  F SD
Sbjct  128  DFDDLHDGTDVDEDEDDDDDEDDDDEEDEDEDAFDVHAHASAGEHDNPTIEFDPDVFSSD  187

Query  625  EAYARALQEAEE  660
            EAYARALQEAEE
Sbjct  188  EAYARALQEAEE  199



>gb|ACU14657.1| unknown [Glycine max]
Length=222

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 86/130 (66%), Gaps = 14/130 (11%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg---------  462
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +            
Sbjct  80   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEGGSYLHDDGDDF  138

Query  463  ----ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEA  630
                   D D++ D+  +ED  + + EDEDAFD HAH  A E +N  IE DP  F SDEA
Sbjct  139  DDLHDGTDVDEDEDEDDDEDDENEEYEDEDAFDAHAHASAGEHDNPSIEFDPDLFSSDEA  198

Query  631  YARALQEAEE  660
            YARALQEAEE
Sbjct  199  YARALQEAEE  208



>ref|XP_010655907.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=314

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 76/142 (54%), Gaps = 46/142 (32%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +NG+                    D  
Sbjct  52   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRINGEG------------------SDYG  93

Query  499  seedGSHVDEE----------------------------DEDAFDVHAHDEASEDENLGI  594
            S E GS+ +EE                            DEDAFDVHA  +  ED+N  I
Sbjct  94   SWEAGSYFNEEEFDDPNDGTDVDDGVDDEDEDEGEYDGTDEDAFDVHAQADDGEDDNPTI  153

Query  595  ELDPSAFPSDEAYARALQEAEE  660
            E DP+ F SDEAYARALQ  EE
Sbjct  154  EFDPAVFSSDEAYARALQHIEE  175



>ref|XP_010655908.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
 emb|CBI29028.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 76/142 (54%), Gaps = 46/142 (32%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S RTPFT+LSQ+DADLALARTLQEQERAYMML +NG+                    D  
Sbjct  52   SSRTPFTNLSQVDADLALARTLQEQERAYMMLRINGEG------------------SDYG  93

Query  499  seedGSHVDEE----------------------------DEDAFDVHAHDEASEDENLGI  594
            S E GS+ +EE                            DEDAFDVHA  +  ED+N  I
Sbjct  94   SWEAGSYFNEEEFDDPNDGTDVDDGVDDEDEDEGEYDGTDEDAFDVHAQADDGEDDNPTI  153

Query  595  ELDPSAFPSDEAYARALQEAEE  660
            E DP+ F SDEAYARALQ  EE
Sbjct  154  EFDPAVFSSDEAYARALQHIEE  175



>gb|EPS70975.1| hypothetical protein M569_03787, partial [Genlisea aurea]
Length=136

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 10/122 (8%)
 Frame = +1

Query  322  RRTPFTDLSQIDADLALARTLQEQERAYMMLTMN-------GDAsdyvsedeygydyddd  480
            RRTPFTDLSQ+DADL LARTLQEQERAYMML M+       G+  +   E EY    D+ 
Sbjct  1    RRTPFTDLSQVDADLVLARTLQEQERAYMMLRMDAAEGSDLGNWENDSYELEYENGDDEY  60

Query  481  dnfddpseedGSHV--DEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            D+  +  + DGS V  D+E EDAFDV A  +  E+++  I+LDPSA+  DEAYARALQ+A
Sbjct  61   DDVSEEEDLDGSDVELDDEAEDAFDVQAQADGGENDD-QIDLDPSAYSGDEAYARALQDA  119

Query  655  EE  660
            E+
Sbjct  120  ED  121



>ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
 gb|AGV54364.1| RING-finger protein [Phaseolus vulgaris]
 gb|ESW14768.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
Length=347

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 89/131 (68%), Gaps = 15/131 (11%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg---------  462
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN + SDY S +            
Sbjct  82   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNEGSDYGSWEGASYLHDGDDFD  140

Query  463  -----ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDE  627
                  D D+DD+ DD  +ED  + + EDEDAFDVHAH  A E +N  IE DP  F SDE
Sbjct  141  DLHDGTDVDEDDDEDDDDDEDDDNDEYEDEDAFDVHAHASAGEHDNPSIEFDPDVFSSDE  200

Query  628  AYARALQEAEE  660
            AYARALQEAEE
Sbjct  201  AYARALQEAEE  211



>ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
Length=342

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN----------GDAsdyvsedey  459
             QPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN          G +  +   D++
Sbjct  74   HQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEGGSYLHDDGDDF  132

Query  460  gydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYAR  639
               +D  D  +D  E+D +  + E+EDAFDVHAH  A E +N  IE DP  F SDEAYAR
Sbjct  133  DDLHDGTDVDEDDDEDDDNEDEYENEDAFDVHAHASAGEHDNPIIEFDPELFSSDEAYAR  192

Query  640  ALQEAEE  660
            ALQEAEE
Sbjct  193  ALQEAEE  199



>ref|XP_003536731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform 1 
[Glycine max]
Length=344

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 86/130 (66%), Gaps = 14/130 (11%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg---------  462
            RQPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +            
Sbjct  80   RQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEGGSYLHDDGDDF  138

Query  463  ----ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEA  630
                   D D++ D+  +ED  + + EDEDAFD HAH  A E +N  IE DP  F SDEA
Sbjct  139  DDLHDGTDVDEDEDEDDDEDDENEEYEDEDAFDAHAHASAGEHDNPSIEFDPDLFSSDEA  198

Query  631  YARALQEAEE  660
            YARALQEAEE
Sbjct  199  YARALQEAEE  208



>ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
Length=336

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg---------  462
             QPSR TPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +            
Sbjct  74   HQPSR-TPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEGGSYLHDDGDDF  132

Query  463  -ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYAR  639
               +D  D  +D  E+D +  + E+EDAFDVHAH  A E +N  IE DP  F SDEAYAR
Sbjct  133  DDLHDGTDVDEDDDEDDDNEDEYENEDAFDVHAHASAGEHDNPIIEFDPELFSSDEAYAR  192

Query  640  ALQEAEE  660
            ALQEAEE
Sbjct  193  ALQEAEE  199



>ref|XP_002310069.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE90519.1| zinc finger family protein [Populus trichocarpa]
Length=320

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 82/126 (65%), Gaps = 11/126 (9%)
 Frame = +1

Query  313  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------  462
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +             
Sbjct  60   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLLDYGDDFG  119

Query  463  ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARA  642
               D+ D  DD  E DG      D DA DVHAH + + D+N  +E+DPS + SDEAYARA
Sbjct  120  DPDDETDGDDDDDETDGDDDTNVDGDAIDVHAHAD-NRDDNTEVEIDPSVYSSDEAYARA  178

Query  643  LQEAEE  660
            LQEAEE
Sbjct  179  LQEAEE  184



>ref|XP_008445883.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Cucumis melo]
Length=328

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 86/130 (66%), Gaps = 14/130 (11%)
 Frame = +1

Query  310  RQPSR---RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydydd-  477
            + PSR   RTPFT+L+Q+DADLALARTLQEQERAY+ML M  + SD+ S +   Y  DD 
Sbjct  64   QTPSRHSSRTPFTNLTQVDADLALARTLQEQERAYLMLRMTSEGSDFGSWEAGSYVLDDE  123

Query  478  ---------ddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEA  630
                      ++  D  E DG+ V++ED D FDVHAH++  E  N   ELDP  F SDEA
Sbjct  124  DGFGDPHDHTESDGDDDEFDGTDVNDED-DVFDVHAHEDGGEHNNSNFELDPGNFSSDEA  182

Query  631  YARALQEAEE  660
            YARALQ+AE+
Sbjct  183  YARALQDAED  192



>ref|XP_011002252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Populus euphratica]
Length=329

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 85/128 (66%), Gaps = 13/128 (10%)
 Frame = +1

Query  313  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------  462
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +             
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDYGDDFG  123

Query  463  --ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYA  636
               D  D D+ DD  +E     D+ D DAFDVHAH + + D+N  +E+DPS + SDEAYA
Sbjct  124  DPDDETDGDDNDDDDDETDGDDDDVDGDAFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYA  182

Query  637  RALQEAEE  660
            RALQEAEE
Sbjct  183  RALQEAEE  190



>ref|XP_011002254.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X3 
[Populus euphratica]
Length=326

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 85/128 (66%), Gaps = 13/128 (10%)
 Frame = +1

Query  313  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------  462
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +             
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDYGDDFG  123

Query  463  --ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYA  636
               D  D D+ DD  +E     D+ D DAFDVHAH + + D+N  +E+DPS + SDEAYA
Sbjct  124  DPDDETDGDDNDDDDDETDGDDDDVDGDAFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYA  182

Query  637  RALQEAEE  660
            RALQEAEE
Sbjct  183  RALQEAEE  190



>ref|XP_011002253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Populus euphratica]
Length=327

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 85/128 (66%), Gaps = 13/128 (10%)
 Frame = +1

Query  313  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg----------  462
            Q S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +             
Sbjct  64   QTSGRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDYGDDFG  123

Query  463  --ydyddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYA  636
               D  D D+ DD  +E     D+ D DAFDVHAH + + D+N  +E+DPS + SDEAYA
Sbjct  124  DPDDETDGDDNDDDDDETDGDDDDVDGDAFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYA  182

Query  637  RALQEAEE  660
            RALQEAEE
Sbjct  183  RALQEAEE  190



>gb|AFK47989.1| unknown [Lotus japonicus]
Length=206

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 78/129 (60%), Gaps = 19/129 (15%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            RQPSR TPF++LSQ+DADLALARTLQEQERAYMML MN D          G  Y  D+  
Sbjct  83   RQPSR-TPFSNLSQVDADLALARTLQEQERAYMMLRMNNDG--SDYGSWEGGSYLHDEGD  139

Query  490  ddpseedGSHVDE--------------EDEDAFDVHAHDEASEDENLGIELDPSAFPSDE  627
            D     DGS VDE              E EDAFDVHAH  A   E+  IE DP  F SDE
Sbjct  140  DFDDLHDGSDVDEDEDGDEDDGDEEGYETEDAFDVHAH--AGAGEHPIIEFDPDVFSSDE  197

Query  628  AYARALQEA  654
            AYARALQ+A
Sbjct  198  AYARALQKA  206



>ref|XP_011022026.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Populus euphratica]
Length=309

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg--ydydddd  483
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +     +D +DD 
Sbjct  54   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDDEDDF  113

Query  484  nfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               D   +     D +D DAFDVHAH +A + ++   E+DPS + SDEAYARALQEAEE
Sbjct  114  GDPDDETDGDDDTDVDDADAFDVHAHADAGDHDSTEGEIDPSVYSSDEAYARALQEAEE  172



>ref|XP_011022025.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Populus euphratica]
Length=311

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg--ydydddd  483
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +     +D +DD 
Sbjct  54   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDDEDDF  113

Query  484  nfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               D   +     D +D DAFDVHAH +A + ++   E+DPS + SDEAYARALQEAEE
Sbjct  114  GDPDDETDGDDDTDVDDADAFDVHAHADAGDHDSTEGEIDPSVYSSDEAYARALQEAEE  172



>ref|XP_004143619.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 ref|XP_004165268.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 gb|KGN50445.1| hypothetical protein Csa_5G175690 [Cucumis sativus]
Length=323

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = +1

Query  310  RQPSR---RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddd  480
            + PSR   RTPFT+L+Q+DADLALARTLQEQERAY+ML M  + SD+ S +   Y  DD+
Sbjct  60   QTPSRHSSRTPFTNLTQVDADLALARTLQEQERAYLMLRMTSEGSDFGSWEAGSYVLDDE  119

Query  481  d--------nfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYA  636
            D           D  +++      +DED FDVHAH++  E  N   ELDP  F SDEAYA
Sbjct  120  DGFGDPHDHTESDGDDDEDGTDVNDDEDVFDVHAHEDGGEHNNSNFELDPGNFSSDEAYA  179

Query  637  RALQEAEE  660
            RALQ+AE+
Sbjct  180  RALQDAED  187



>ref|XP_010688664.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=336

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 105/207 (51%), Gaps = 62/207 (30%)
 Frame = +1

Query  160  AKTTADDHQE---NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRT  330
            AKTTA+D      NP +++ T+N++++    A  +       +T     A    + S RT
Sbjct  14   AKTTAEDSATTNPNPNSDVATSNSNSVVDAAAAANLA----VATEAGSDADSRSRNSSRT  69

Query  331  PFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseed  510
            PFT+LSQ+DADLALARTLQEQERAYMML++NG  + Y   D                   
Sbjct  70   PFTNLSQVDADLALARTLQEQERAYMMLSINGGVAGYGMWDT------------------  111

Query  511  GSHVDEEDEDAF-------------------------------------DVHAHDEASED  579
            G +V ++++D F                                     D+HAH+++ +D
Sbjct  112  GIYVHDDEDDEFGDSHDHEYDDDDDDDEEEEEENVDDIGNYDDDDEDAFDIHAHEDSGDD  171

Query  580  ENLGIELDPSAFPSDEAYARALQEAEE  660
            +   +ELDPSAFP DEAYARALQ+AEE
Sbjct  172  DAPEVELDPSAFPDDEAYARALQDAEE  198



>ref|XP_010688665.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=333

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 105/207 (51%), Gaps = 62/207 (30%)
 Frame = +1

Query  160  AKTTADDHQE---NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRT  330
            AKTTA+D      NP +++ T+N++++    A  +       +T     A    + S RT
Sbjct  14   AKTTAEDSATTNPNPNSDVATSNSNSVVDAAAAANLA----VATEAGSDADSRSRNSSRT  69

Query  331  PFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseed  510
            PFT+LSQ+DADLALARTLQEQERAYMML++NG  + Y   D                   
Sbjct  70   PFTNLSQVDADLALARTLQEQERAYMMLSINGGVAGYGMWDT------------------  111

Query  511  GSHVDEEDEDAF-------------------------------------DVHAHDEASED  579
            G +V ++++D F                                     D+HAH+++ +D
Sbjct  112  GIYVHDDEDDEFGDSHDHEYDDDDDDDEEEEEENVDDIGNYDDDDEDAFDIHAHEDSGDD  171

Query  580  ENLGIELDPSAFPSDEAYARALQEAEE  660
            +   +ELDPSAFP DEAYARALQ+AEE
Sbjct  172  DAPEVELDPSAFPDDEAYARALQDAEE  198



>emb|CDP14406.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 77/120 (64%), Gaps = 9/120 (8%)
 Frame = +1

Query  328  TPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpsee  507
            TPFTDLSQ DADLALARTLQEQERAYMML MN          E G     DD  DD  + 
Sbjct  45   TPFTDLSQEDADLALARTLQEQERAYMMLRMNVGEGSDYGSWEGGSYGHVDDEDDDFDDP  104

Query  508  dGSHVD---------EEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
                 D         EE+EDAFDV+A DE  ED++  +E+DPSA+ SDEAYARALQ+AEE
Sbjct  105  SEEEYDGSEVEEDENEEEEDAFDVNAQDEEEEDDSQNVEIDPSAYSSDEAYARALQDAEE  164



>ref|XP_011070448.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Sesamum indicum]
Length=303

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 104/191 (54%), Gaps = 36/191 (19%)
 Frame = +1

Query  112  MENAKAnngtnnggEVAKTTADDHQENPINNLPTNNTSAIPAPVAEESREGEFGASTNVN  291
            MEN+ A    +N      TTA D Q+NP +N                          N  
Sbjct  1    MENSNAKADADNTTTTTTTTAADAQQNPTDN------------------------PQNAG  36

Query  292  QGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTM---NGD---Asdyvsed  453
             GA   RQ   RTPFTDLSQ+DADLALARTLQEQERAYMML M   NG    + +  S  
Sbjct  37   DGAGNRRQ---RTPFTDLSQVDADLALARTLQEQERAYMMLRMDIANGSDYGSWEADSYG  93

Query  454  eygydyddddnfddpseedGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDE  627
                  DDD +     + DGS   VD++ EDAFDVHAH E +ED     ELDPSAF SDE
Sbjct  94   HEDEADDDDFDDASEEDYDGSDVEVDDDAEDAFDVHAHAEEAEDTQ-NAELDPSAFSSDE  152

Query  628  AYARALQEAEE  660
            AYARALQ+AEE
Sbjct  153  AYARALQDAEE  163



>ref|XP_010541856.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
Length=352

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 78/127 (61%), Gaps = 13/127 (10%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S R PFT+LSQIDADLALARTLQEQERAYMML+MN +  DY S     Y  D+D+  D  
Sbjct  91   SARVPFTNLSQIDADLALARTLQEQERAYMMLSMNNEVRDYGSWQTGSYLSDEDEFDDPE  150

Query  499  seedGSHVDEE-------------DEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYAR  639
             ++   + D +             DEDA DVHAH++  E+     E D  A+  DEAYAR
Sbjct  151  DDDRDIYEDGDEDDEEDDETDVYVDEDASDVHAHEDGQENYGENSEFDMGAYSDDEAYAR  210

Query  640  ALQEAEE  660
            ALQEAEE
Sbjct  211  ALQEAEE  217



>ref|XP_010067008.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Eucalyptus 
grandis]
Length=357

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = +1

Query  313  QPS-RRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg--------y  465
            QPS  RTPFT LSQ+DAD ALAR LQEQERAYMML  N D SDY S +           +
Sbjct  91   QPSASRTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDGSDYGSWEGGSYIPDEDDDF  150

Query  466  dyddddnfddpseedGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYAR  639
            +  DD+  D+  E +GS    D +  DAFDVHA ++A    N  +EL+P  F SDEAYAR
Sbjct  151  EDLDDETDDEDDEVEGSPDGTDLDAGDAFDVHAAEDAHGGSNQAVELEPENFSSDEAYAR  210

Query  640  ALQEAEE  660
            ALQ+AEE
Sbjct  211  ALQDAEE  217



>gb|KCW65071.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=310

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 78/122 (64%), Gaps = 10/122 (8%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg--------ydyddd  480
            RTPFT LSQ+DAD ALAR LQEQERAYMML  N D SDY S +           ++  DD
Sbjct  49   RTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDGSDYGSWEGGSYIPDEDDDFEDLDD  108

Query  481  dnfddpseedGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            +  D+  E +GS    D +  DAFDVHA ++A    N  +EL+P  F SDEAYARALQ+A
Sbjct  109  ETDDEDDEVEGSPDGTDLDAGDAFDVHAAEDAHGGSNQAVELEPENFSSDEAYARALQDA  168

Query  655  EE  660
            EE
Sbjct  169  EE  170



>gb|KCW65072.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=296

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 78/122 (64%), Gaps = 10/122 (8%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg--------ydyddd  480
            RTPFT LSQ+DAD ALAR LQEQERAYMML  N D SDY S +           ++  DD
Sbjct  49   RTPFTVLSQVDADFALARRLQEQERAYMMLRFNNDGSDYGSWEGGSYIPDEDDDFEDLDD  108

Query  481  dnfddpseedGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEA  654
            +  D+  E +GS    D +  DAFDVHA ++A    N  +EL+P  F SDEAYARALQ+A
Sbjct  109  ETDDEDDEVEGSPDGTDLDAGDAFDVHAAEDAHGGSNQAVELEPENFSSDEAYARALQDA  168

Query  655  EE  660
            EE
Sbjct  169  EE  170



>ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX99094.1| RING/U-box superfamily protein [Theobroma cacao]
Length=392

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 83/131 (63%), Gaps = 14/131 (11%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeyg---------  462
            RQ S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D SDY S +            
Sbjct  129  RQSSTRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDGSDYGSWEAGSYLHDDDDDF  188

Query  463  ----ydyddddnfddpseedGSHVDEEDEDAFDVHAHDE-ASEDENLGIELDPSAFPSDE  627
                   D D + ++  EE      ++D DAFDVHAH E   ED N  +E +P+ F SDE
Sbjct  189  GDPHDHDDTDGDEEEDEEEYDGTAADDDVDAFDVHAHAENGEEDYNPNVEFNPAVFSSDE  248

Query  628  AYARALQEAEE  660
            AYARALQ+AEE
Sbjct  249  AYARALQDAEE  259



>ref|XP_006406443.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
 gb|ESQ47896.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
Length=335

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 88/170 (52%), Gaps = 18/170 (11%)
 Frame = +1

Query  205  LPTNNTSAIPAPVAEESREGEFGASTNVNQ------------GAQGGRQPSRRTPFTDLS  348
            LP N  S + +     S +GE G  T V              G    R  S R PFT+LS
Sbjct  30   LPENRPSGVVSDTGSGSEKGEEGVETAVAVAVAADESGSNSVGELPPRSSSARVPFTNLS  89

Query  349  QIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydyddddnfddpseed  510
            Q+DADLALARTLQEQERAYMMLTMN      G         +     D ++  +D  E++
Sbjct  90   QMDADLALARTLQEQERAYMMLTMNTEISDYGSWETGSYVYDEDEFDDPENEDEDDDEDE  149

Query  511  GSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
                ++   DA DVHAH++  ED+    + +  A   DEAYARALQEA+E
Sbjct  150  YETDEDPQVDAPDVHAHEDDQEDDGRNSDTEEVANSDDEAYARALQEADE  199



>ref|XP_006298094.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
 gb|EOA30992.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
Length=335

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 76/123 (62%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydy  471
            R  S R PF++LSQIDADLALARTLQEQERAYMMLTMN      G         +     
Sbjct  78   RSSSARVPFSNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  137

Query  472  ddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQE  651
            D ++  +D  E++    ++  EDA DVHA++   ED+    +++  A+  DEAYARALQE
Sbjct  138  DPENEDEDDDEDEYETDNDPQEDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQE  196

Query  652  AEE  660
            AEE
Sbjct  197  AEE  199



>ref|XP_002883210.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59469.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 83/125 (66%), Gaps = 9/125 (7%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN + SDY S +   Y YD+D+  
Sbjct  77   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  136

Query  490  ddpseedGSHVD--------EEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARAL  645
            D  +E++    D        +ED    DVHA+++  ED+    +++  A+  DEAYARAL
Sbjct  137  DPENEDEDDDEDEYETDDDPQEDAPVVDVHANEDDQEDDG-NSDIEEVAYSDDEAYARAL  195

Query  646  QEAEE  660
            QEAEE
Sbjct  196  QEAEE  200



>ref|NP_566651.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
 sp|Q9LT17.1|BBR_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER-related; Short=AtBBR 
[Arabidopsis thaliana]
 dbj|BAB01306.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK73948.1| AT3g19910/MPN9_15 [Arabidopsis thaliana]
 gb|AAK76658.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85084.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76307.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
Length=340

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 74/126 (59%), Gaps = 11/126 (9%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydy  471
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN      G         +     
Sbjct  80   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  139

Query  472  ddddnfddpseedGSHVDEEDEDAFDVHAH---DEASEDENLGIELDPSAFPSDEAYARA  642
            D ++  +D  E++    D+  ED  DV+ H   D+  +D N  IE    A+  DEAYARA
Sbjct  140  DPENEDEDDDEDEYETDDDPQEDGLDVNVHANEDDQEDDGNSDIE--EVAYTDDEAYARA  197

Query  643  LQEAEE  660
            LQEAEE
Sbjct  198  LQEAEE  203



>gb|AAM61025.1| unknown [Arabidopsis thaliana]
Length=340

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 74/126 (59%), Gaps = 11/126 (9%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydy  471
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN      G         +     
Sbjct  80   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  139

Query  472  ddddnfddpseedGSHVDEEDEDAFDVHAH---DEASEDENLGIELDPSAFPSDEAYARA  642
            D ++  +D  E++    D+  ED  DV+ H   D+  +D N  IE    A+  DEAYARA
Sbjct  140  DPENEDEDDDEDEYETDDDPQEDGLDVNVHANEDDQEDDGNSDIE--EVAYTDDEAYARA  197

Query  643  LQEAEE  660
            LQEAEE
Sbjct  198  LQEAEE  203



>gb|KFK39312.1| hypothetical protein AALP_AA3G228600 [Arabis alpina]
Length=316

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN---GDAsdyvsedeygydyddd  480
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN   G         E     D +
Sbjct  64   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSDYGSWETGSYVYEEDEFDDPE  123

Query  481  dnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            D+ DD  E +    ++  EDA  V AH+   +D+    + +  AF  DEAYARALQEAEE
Sbjct  124  DDDDDDDESEYETDNDPQEDAPAVDAHENEQQDD---ADTEQVAFSDDEAYARALQEAEE  180



>ref|XP_009145730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=324

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 96/164 (59%), Gaps = 19/164 (12%)
 Frame = +1

Query  202  NLPTNNTS-----------AIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLS  348
            NLPT   S           A+   VAE+  E   G++T   +G    R  S R PFT+LS
Sbjct  33   NLPTGVVSESGGGSEKGEEAVETAVAEDVDES--GSNT---EGELPPRSSSARVPFTNLS  87

Query  349  QIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedGSHVDE  528
            QIDADLALARTLQEQERAYMMLTMN + SDY S +   Y Y++D++ D+   E       
Sbjct  88   QIDADLALARTLQEQERAYMMLTMNSEVSDYGSWETGSYVYEEDEDDDEDEYETDDD---  144

Query  529  EDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               DA +V+AH++  EDE    + +   +  DEA+ARA+QEAEE
Sbjct  145  PQGDAPNVNAHEDDQEDEGRNADEEEVGYSDDEAFARAIQEAEE  188



>ref|XP_010487948.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Camelina sativa]
Length=339

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 76/123 (62%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydy  471
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN      G         +     
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  140

Query  472  ddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQE  651
            D ++  +D  E++    ++  EDA DVHA++   ED+    +++  A+  DEAYARALQ+
Sbjct  141  DPENEDEDDDEDEYETDNDLQEDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQD  199

Query  652  AEE  660
            AEE
Sbjct  200  AEE  202



>ref|XP_008789252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Phoenix dactylifera]
Length=300

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 79/145 (54%), Gaps = 16/145 (11%)
 Frame = +1

Query  232  PAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMM  411
            P+P      EGE G +  V   A     P  R PFT LSQ+DADLALAR LQEQERAYMM
Sbjct  18   PSPNPPLPAEGEAGPAVGV---APPPAMPPSRMPFTSLSQVDADLALARALQEQERAYMM  74

Query  412  LTMNGDAsdyvsedeygydyddddnfddpseedGSHVDEED--EDAFDVHAHDEASEDEN  585
            L MNG         + G    +D +  +   ++G   +  D  EDAFD  A+D +     
Sbjct  75   LRMNGGHGSDFESSDAGSYEYEDGDEPEHPIDEGGSAEGSDYGEDAFD--ANDRS-----  127

Query  586  LGIELDPSAFPSDEAYARALQEAEE  660
                +DP+ F SDEA+ARALQ AEE
Sbjct  128  ----VDPAEFESDEAFARALQNAEE  148



>ref|XP_010487949.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Camelina sativa]
Length=338

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 76/123 (62%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN------GDAsdyvsedeygydy  471
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN      G         +     
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  140

Query  472  ddddnfddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQE  651
            D ++  +D  E++    ++  EDA DVHA++   ED+    +++  A+  DEAYARALQ+
Sbjct  141  DPENEDEDDDEDEYETDNDLQEDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQD  199

Query  652  AEE  660
            AEE
Sbjct  200  AEE  202



>ref|XP_008789253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Phoenix dactylifera]
Length=285

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 79/145 (54%), Gaps = 16/145 (11%)
 Frame = +1

Query  232  PAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMM  411
            P+P      EGE G +  V   A     P  R PFT LSQ+DADLALAR LQEQERAYMM
Sbjct  18   PSPNPPLPAEGEAGPAVGV---APPPAMPPSRMPFTSLSQVDADLALARALQEQERAYMM  74

Query  412  LTMNGDAsdyvsedeygydyddddnfddpseedGSHVDEED--EDAFDVHAHDEASEDEN  585
            L MNG         + G    +D +  +   ++G   +  D  EDAFD  A+D +     
Sbjct  75   LRMNGGHGSDFESSDAGSYEYEDGDEPEHPIDEGGSAEGSDYGEDAFD--ANDRS-----  127

Query  586  LGIELDPSAFPSDEAYARALQEAEE  660
                +DP+ F SDEA+ARALQ AEE
Sbjct  128  ----VDPAEFESDEAFARALQNAEE  148



>ref|XP_010466157.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Camelina 
sativa]
Length=336

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 83/121 (69%), Gaps = 5/121 (4%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PFT+L+QIDADLALARTLQEQERAYMMLTMN + SDY S +   Y YD+D+  
Sbjct  81   RSSSARVPFTNLNQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  140

Query  490  ddpseedGSHVDEED----EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
            D  +E+D     E D    EDA DVHA++   ED+    +++  A+  DEAYARALQ+AE
Sbjct  141  DPENEDDDEDEYETDNDPQEDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAE  199

Query  658  E  660
            E
Sbjct  200  E  200



>ref|XP_009111410.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=333

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S R PFT+LSQID+DLALARTLQEQERAYMMLTMN + SDY S +   Y Y++D+  D  
Sbjct  83   SARVPFTNLSQIDSDLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYEEDEFDDPE  142

Query  499  seedGSHVDEE-DEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
             E+D    D++  EDA DV+A+ +  ED     E + + +  DEA+ARA+QEAE
Sbjct  143  DEDDEYGTDDDPQEDAPDVNANGDDQEDGGRNAETEEAGYSDDEAFARAIQEAE  196



>ref|XP_010932524.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=285

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 72/119 (61%), Gaps = 14/119 (12%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R PSR  PFT LSQ+DADLALAR LQEQERAYMML MNG         + G    +D + 
Sbjct  42   RLPSR-MPFTSLSQVDADLALARALQEQERAYMMLRMNGGQGSDFESSDAGSYEYEDGDD  100

Query  490  ddpseedGSHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
             D   ++G   +  D  EDAFD  A+D +         +DP+ F SDEA+ARALQ+AEE
Sbjct  101  PDHPIDEGGSAEGSDYGEDAFD--ANDRS---------VDPAEFESDEAFARALQDAEE  148



>ref|XP_010508204.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=337

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PF +L+QIDADLALARTLQEQERAYMMLTMN + SDY S +   Y YD+D+  
Sbjct  82   RSSSARVPFINLNQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFD  141

Query  490  ddpseedGSHVDEED----EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
            D  +E+D     E D    EDA DVHA++   ED+    +++  A+  DEAYARALQ+AE
Sbjct  142  DPENEDDDEDEYETDNDPQEDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAE  200

Query  658  E  660
            E
Sbjct  201  E  201



>emb|CDY24595.1| BnaC05g32790D [Brassica napus]
Length=315

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 12/117 (10%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PFT+LSQIDADLALARTLQEQERAYMML MN + SDY S +   Y Y+DDD +
Sbjct  75   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLAMNSEVSDYGSWETGSYVYEDDDEY  134

Query  490  ddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            +   +  G        DA DV+AH    EDE    + +   +  DEA+ARA+QEAEE
Sbjct  135  ETDDDPQG--------DAPDVNAH----EDEGRIADEEEVGYSDDEAFARAIQEAEE  179



>emb|CDY42218.1| BnaA01g25770D [Brassica napus]
Length=334

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S R PFT+LSQID+DLALARTLQEQERAYMMLTMN + SDY S +   Y Y++D+  D  
Sbjct  83   SARVPFTNLSQIDSDLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYEEDEFDDPE  142

Query  499  seedGSHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAE  657
             E++  +  ++D  EDA DV+A+ +  ED     E + + +  DEA+ARA+QEAE
Sbjct  143  DEDEDEYETDDDPQEDAPDVNANGDDQEDGGRNAETEEAGYSDDEAFARAIQEAE  197



>ref|XP_006437610.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 gb|ESR50850.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=242

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            TN+ Q   G RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQHGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>emb|CDY25357.1| BnaA05g19270D [Brassica napus]
Length=320

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PFT+LSQIDADLALARTLQEQERAYMMLTMN + SDY S +   Y Y++D++ 
Sbjct  75   RSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEVSDYGSWETGSYVYEEDEDD  134

Query  490  ddpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            D+   E          DA DV+AH    EDE    + +   +  DEA+ARA+QEAEE
Sbjct  135  DEDEYETDDD---PQGDAPDVNAH----EDEVRIADEEEVGYSDDEAFARAIQEAEE  184



>ref|XP_006382945.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60742.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=314

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  432
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  56   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  96



>ref|XP_006382946.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60743.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=316

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  432
            RQ SRRTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  56   RQTSRRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  96



>ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 ref|XP_006484518.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus 
sinensis]
 gb|ESR50849.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=328

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            TN+ Q   G RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQHGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>emb|CDY33429.1| BnaC01g32960D [Brassica napus]
Length=330

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnf  489
            R  S R PFT+LSQI++DLALARTLQEQERAYMMLTMN + SDY S +   Y Y++D+  
Sbjct  75   RSSSARVPFTNLSQIESDLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYEEDEFD  134

Query  490  ddpseedGSHVDEE-DEDAFDVHAHDEASED--ENLGIELDPSAFPSDEAYARALQEAE  657
            D   E+D    D++  EDA DV+A+ +  ED   N   E   + +  DEA+ARA+QEAE
Sbjct  135  DPEDEDDEYETDDDPQEDAPDVNANGDDQEDGGRNADTEEAEAGYSDDEAFARAIQEAE  193



>ref|XP_008795341.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Phoenix 
dactylifera]
Length=285

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 66/111 (59%), Gaps = 13/111 (12%)
 Frame = +1

Query  334  FTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedG  513
            FT LSQ+DADLALAR LQEQERAYMML MNG         +   D +DD +  D   ++ 
Sbjct  49   FTGLSQVDADLALARALQEQERAYMMLRMNGGEGSDYESSDGASDENDDGDDPDHRIQEA  108

Query  514  SHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               +  D  EDAFD  A+D +         +D + F SDEA+ARALQ+AEE
Sbjct  109  GSAEGSDYGEDAFD--ANDRS---------IDSAEFESDEAFARALQDAEE  148



>ref|XP_003592713.1| RING finger protein [Medicago truncatula]
 gb|AES62964.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=333

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  190  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  369
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  370  LARTLQEQERAYMMLTMNGDA  432
            LARTLQEQERAYMML MN D 
Sbjct  87   LARTLQEQERAYMMLRMNNDG  107



>ref|XP_003592714.1| RING finger protein [Medicago truncatula]
 gb|AES62965.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=339

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  190  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  369
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  370  LARTLQEQERAYMMLTMNGDA  432
            LARTLQEQERAYMML MN D 
Sbjct  87   LARTLQEQERAYMMLRMNNDG  107



>ref|XP_004974139.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=301

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 68/114 (60%), Gaps = 13/114 (11%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMMLT + D+               D    D  E
Sbjct  54   RRPFTSLSQEEADLALARVLQEQERAYMMLTAHHDS---------SEYASSDAGSYDYDE  104

Query  505  edGSHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            ++GS  + ED   DA DV   +E ++ E    +LDP+ +  DEA+ARALQ+AEE
Sbjct  105  DEGSDYEVEDGEGDALDV--DEEVADAEGDAADLDPARYEDDEAFARALQDAEE  156



>ref|XP_009395387.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = +1

Query  334  FTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedG  513
            FT LSQ+DADLALAR LQEQERAY ML MNG         + G    D +  +D   ++ 
Sbjct  55   FTSLSQVDADLALARALQEQERAYAMLRMNGVDDSDYESSDAGSYDYDGEEDEDGVGDEP  114

Query  514  SHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              V EED+ + +   +DE + D N   + DP+ F  DEA+ARALQ+AEE
Sbjct  115  ERVVEEDDGSIEGSDYDEDAFDAN-DSDADPAEFEDDEAFARALQDAEE  162



>gb|ACJ86011.1| unknown [Medicago truncatula]
Length=332

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  190  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  369
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  38   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  85

Query  370  LARTLQEQERAYMMLTMNGDA  432
            LARTLQEQERAYMML MN D 
Sbjct  86   LARTLQEQERAYMMLRMNNDG  106



>ref|XP_006659662.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Oryza 
brachyantha]
Length=301

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 70/119 (59%), Gaps = 5/119 (4%)
 Frame = +1

Query  316  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfdd  495
            P+ R PFT L+Q +ADLALAR LQEQERAYMMLT           +     Y+ D+  + 
Sbjct  31   PTGRRPFTSLTQEEADLALARLLQEQERAYMMLTGQ-HGGGGEYAESDAGSYEFDEEGEG  89

Query  496  pseedGSHVDEEDEDAFDVHAHDE---ASEDENLG-IELDPSAFPSDEAYARALQEAEE  660
               E+GS  +EED D   +   DE   A  D + G  ELDP+ +  DEA+ARALQ+AEE
Sbjct  90   LQAEEGSDYEEEDGDGEALDEDDEVGDADADSDSGAAELDPAQYEDDEAFARALQDAEE  148



>gb|ADE77661.1| unknown [Picea sitchensis]
Length=282

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 68/118 (58%), Gaps = 17/118 (14%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddp  498
            S R PFT LSQ D+DLALAR LQEQE AYM+L  N ++              D +     
Sbjct  43   SSRQPFTALSQEDSDLALARALQEQEMAYMLLRRNAES-------------SDYETSGSG  89

Query  499  seedGSHVDE--EDEDAFDVHAHDEASE--DENLGIELDPSAFPSDEAYARALQEAEE  660
            + + G ++D+  E+ED  D +A D   E  D+    E+D S F SDEAYARALQEAE+
Sbjct  90   NYDHGYYIDDSGENEDEVDANADDFEREALDDGDHEEVDASLFESDEAYARALQEAED  147



>ref|XP_002445744.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
 gb|EES15239.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
Length=314

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 4/112 (4%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMMLT    A       +Y  +  +DD+     E
Sbjct  58   RRPFTSLSQEEADLALARVLQEQERAYMMLTGGEYAISDAGSYDYDEEEGEDDDDGSDYE  117

Query  505  edGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            E+G  +D EDE   D  A   A  D++L  +LDP+ +  DEA+ARALQ+AEE
Sbjct  118  EEGEALD-EDEQVGDAEAEG-AEGDQDL--DLDPAQYEDDEAFARALQDAEE  165



>gb|ABK26080.1| unknown [Picea sitchensis]
Length=282

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 67/116 (58%), Gaps = 9/116 (8%)
 Frame = +1

Query  313  QPSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfd  492
            + S R PFT LSQ D+DLALAR LQEQERAYMML  N ++       +Y      + + +
Sbjct  41   EQSSRQPFTALSQEDSDLALARALQEQERAYMMLRRNAES------SDYETSGSGNYDHE  94

Query  493  dpseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               ++ G + DE D +A D      A  D     E+D S F SDEAYARALQEAE+
Sbjct  95   YYIDDSGENEDEVDANADDFEREALADGDHE---EVDASLFESDEAYARALQEAED  147



>gb|ACJ85919.1| unknown [Medicago truncatula]
 gb|AFK45820.1| unknown [Medicago truncatula]
Length=339

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 12/81 (15%)
 Frame = +1

Query  190  NPINNLPTNNTSAIPAPVAEESREGEFGASTNVNQGAQGGRQPSRRTPFTDLSQIDADLA  369
            N + NLP      I      E+ + + G+ TN        +QPSR TPFT+LSQ+DADLA
Sbjct  39   NSVENLP----EKIEENDEHEAEQQQTGSETNT-------QQPSR-TPFTNLSQVDADLA  86

Query  370  LARTLQEQERAYMMLTMNGDA  432
            LARTLQE+ERAYMML MN D 
Sbjct  87   LARTLQERERAYMMLRMNNDG  107



>gb|KJB31862.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=256

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  432
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>ref|XP_009392890.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=292

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 72/123 (59%), Gaps = 19/123 (15%)
 Frame = +1

Query  316  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNG------DAsdyvsedeygydydd  477
            PS RTPFT LSQ+DADLALAR LQEQERAY ML MNG      ++SD  + D+   D + 
Sbjct  44   PSARTPFTSLSQVDADLALARALQEQERAYAMLRMNGADDSDYESSDAWTYDDDEEDEEG  103

Query  478  ddnfddpseedGSHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQE  651
              +  D   EDG  ++  D  EDAFD +  +           LD     ++EA+ARALQ+
Sbjct  104  VGDEPDHVVEDGGSIEGSDYGEDAFDANNPN-----------LDQPEVENNEAFARALQD  152

Query  652  AEE  660
            AEE
Sbjct  153  AEE  155



>gb|KJB31861.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=326

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  432
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>gb|KJB31859.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=332

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDA  432
            S RTPFT+LSQ+DADLALARTLQEQERAYMML MN D 
Sbjct  58   STRTPFTNLSQVDADLALARTLQEQERAYMMLRMNNDG  95



>ref|XP_010906327.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=280

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 63/111 (57%), Gaps = 13/111 (12%)
 Frame = +1

Query  334  FTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedG  513
            FT LSQ++ADLALAR LQEQERAYMML MNG         +      +  +  D   E+ 
Sbjct  45   FTSLSQVEADLALARALQEQERAYMMLRMNGGEGSDYESSDAASYECEGGDDPDHPIEEA  104

Query  514  SHVDEED--EDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               +  D  EDAFD  A+D +         +D + F SDEA+ARALQEAEE
Sbjct  105  GSAEGSDYGEDAFD--ANDGS---------IDHAEFESDEAFARALQEAEE  144



>dbj|BAK04753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (59%), Gaps = 4/112 (4%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMML+ +G         + G     D+  +    
Sbjct  43   RRPFTALSQEEADLALARVLQEQERAYMMLSAHGGDGSEYDASDAGSYDYYDEEEEGIEG  102

Query  505  edGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            ++GS  D E+E        +E  + E  G ELDP+ +  DEAYARALQ+AEE
Sbjct  103  DEGS--DYEEEGVLPNDDDEEVGDAE--GAELDPARYEDDEAYARALQDAEE  150



>ref|XP_002521533.1| ring finger protein, putative [Ricinus communis]
 gb|EEF40804.1| ring finger protein, putative [Ricinus communis]
Length=316

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  319  SRRTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            SRRTPFT+LSQ+DADLALARTLQEQERAYMML  N
Sbjct  57   SRRTPFTNLSQVDADLALARTLQEQERAYMMLRFN  91



>gb|KDO52708.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=233

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KDO52709.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
 gb|KDO52710.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=242

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KDO52707.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=257

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  TNVNQGAQGGRQPSR-RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            TN+ Q  QG RQ SR RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  41   TNLEQQQQGQRQDSRTRTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KDO52706.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=328

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  57   RTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>gb|KDO52705.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=333

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            RTPFT+LSQ+DADLALARTLQEQERAYMML MN
Sbjct  57   RTPFTNLSQVDADLALARTLQEQERAYMMLRMN  89



>ref|XP_009395284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = +1

Query  316  PSRRTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfdd  495
            PS R PFT LSQ+DADLALAR LQEQERAY +L MNG         +      +++  ++
Sbjct  40   PSARRPFTSLSQVDADLALARALQEQERAYALLRMNGVDGSDYESSDADSYDYEEEEVEE  99

Query  496  pseedGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
               ++  HV EED    +   +D  + D N     DP     DEA+  ALQ++EE
Sbjct  100  GVGDEPDHVIEEDAGNIEGSDYDHDAFDAN-----DPDV--DDEAFTMALQDSEE  147



>gb|EMT04037.1| RING-H2 finger protein ATL3F [Aegilops tauschii]
Length=285

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 62/130 (48%), Gaps = 44/130 (34%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMML+ +G                          
Sbjct  42   RRPFTALSQEEADLALARVLQEQERAYMMLSAHG--------------------------  75

Query  505  edGSHVDEEDEDAFDVHAHDEASEDENL------------------GIELDPSAFPSDEA  630
             DGS  D  D  ++D +  +E   + +                   G ELDP+ +  DEA
Sbjct  76   GDGSEYDASDAGSYDYYDEEEEGIEGDEGSDYEEEGDEDEEVGEAEGPELDPARYEDDEA  135

Query  631  YARALQEAEE  660
            YARALQ+AEE
Sbjct  136  YARALQDAEE  145



>ref|NP_001063778.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAD34213.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25692.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAG91659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=325

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ+DADLALAR LQEQERAYMML M G
Sbjct  54   RRPFTALSQVDADLALARVLQEQERAYMMLRMGG  87



>gb|EEC84951.1| hypothetical protein OsI_32172 [Oryza sativa Indica Group]
Length=325

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ+DADLALAR LQEQERAYMML M G
Sbjct  54   RRPFTALSQVDADLALARVLQEQERAYMMLRMGG  87



>ref|XP_006661480.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Oryza brachyantha]
Length=269

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  331  PFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            PFT+LSQ+DADLALAR LQEQERAYMML M G
Sbjct  1    PFTELSQVDADLALARVLQEQERAYMMLRMGG  32



>ref|XP_003578515.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brachypodium 
distachyon]
Length=337

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ+DADLALAR LQEQERAYMML MN
Sbjct  55   RRPFTALSQVDADLALARVLQEQERAYMMLRMN  87



>dbj|BAJ88925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ+DADLALAR LQEQERAYMML MN
Sbjct  55   RRPFTALSQVDADLALARVLQEQERAYMMLRMN  87



>ref|XP_009418697.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=264

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 57/109 (52%), Gaps = 22/109 (20%)
 Frame = +1

Query  334  FTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpseedG  513
            FT LSQIDADLALAR LQEQ  AY ML M+GD              +D  + D   E  G
Sbjct  43   FTSLSQIDADLALARILQEQGTAYAMLMMDGD-------------DNDYWSSDYDEEGGG  89

Query  514  SHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
              +D   E    +   D+         E+D + F +DEAY+RALQ+AEE
Sbjct  90   DELDHVAEGGGSIEGSDD---------EVDAAYFENDEAYSRALQDAEE  129



>ref|XP_010235389.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Brachypodium distachyon]
Length=301

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 59/118 (50%), Gaps = 26/118 (22%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMML+                             
Sbjct  59   RRPFTALSQEEADLALARVLQEQERAYMMLSGY--------------------GSGYSGS  98

Query  505  edGSHVDEEDEDAFDVHAHDEA------SEDENLGIELDPSAFPSDEAYARALQEAEE  660
            + GS+ D +DE +      + A       ++     E+DP+ +  DEAYARALQ+AEE
Sbjct  99   DAGSYDDYDDEGSDYEEEEEGALPGGGDGDEVVGDAEVDPAQYEDDEAYARALQDAEE  156



>ref|XP_003574899.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 59/118 (50%), Gaps = 26/118 (22%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNGDAsdyvsedeygydyddddnfddpse  504
            R PFT LSQ +ADLALAR LQEQERAYMML+                             
Sbjct  59   RRPFTALSQEEADLALARVLQEQERAYMMLSGY--------------------GSGYSGS  98

Query  505  edGSHVDEEDEDAFDVHAHDEA------SEDENLGIELDPSAFPSDEAYARALQEAEE  660
            + GS+ D +DE +      + A       ++     E+DP+ +  DEAYARALQ+AEE
Sbjct  99   DAGSYDDYDDEGSDYEEEEEGALPGGGDGDEVVGDAEVDPAQYEDDEAYARALQDAEE  156



>tpg|DAA40634.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=323

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>ref|NP_001149296.1| LOC100282919 [Zea mays]
 gb|ACG34901.1| protein binding protein [Zea mays]
Length=323

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>tpg|DAA40635.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=244

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ +ADLALAR LQEQERAYM+L MNG
Sbjct  57   RRPFTALSQEEADLALARVLQEQERAYMLLRMNG  90



>gb|EYU20483.1| hypothetical protein MIMGU_mgv1a013375mg [Erythranthe guttata]
Length=222

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  520  VDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            VD+E EDAFDVHA     E ++   E+DPSAF SDEAYARALQ+AEE
Sbjct  45   VDDEAEDAFDVHARAAGLESDSQNDEVDPSAFSSDEAYARALQDAEE  91



>emb|CAC10211.1| E3 ubiquitin ligase BIG BROTHER-related protein, partial [Cicer 
arietinum]
Length=233

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  541  AFDVHAHDEASEDENLGIELDPSAFPSDEAYARALQEAEE  660
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEE
Sbjct  51   AFDVHAHASAGEHDNPIIEFDPELFSSDEAYARALQEAEE  90



>ref|XP_008679088.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=144

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  55   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  87



>ref|XP_009376874.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
Length=215

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  307  GRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML-TMNGDA  432
            G+Q SRRTPFT+L+Q+ AD  LA  +QEQE+AY ML T+  D+
Sbjct  8    GKQSSRRTPFTELNQVSADFILAMAMQEQEQAYTMLETIESDS  50



>gb|AFW65659.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=271

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLT  417
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>ref|NP_001150748.1| protein binding protein [Zea mays]
 gb|ACG40201.1| protein binding protein [Zea mays]
Length=322

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>tpg|DAA62493.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=322

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>ref|NP_001131853.1| uncharacterized LOC100193231 [Zea mays]
 gb|ACF80448.1| unknown [Zea mays]
 gb|AFW65658.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=287

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLT  417
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>gb|ACG31571.1| hypothetical protein [Zea mays]
Length=288

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLT  417
            R PFT LSQ +ADLALAR LQEQERAYMMLT
Sbjct  50   RRPFTSLSQEEADLALARVLQEQERAYMMLT  80



>ref|XP_008651502.1| PREDICTED: protein binding protein isoform X2 [Zea mays]
Length=307

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>ref|XP_004957470.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=323

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  52   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  84



>ref|XP_002460573.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
 gb|EER97094.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
Length=324

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  55   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  87



>ref|XP_001769627.1| predicted protein [Physcomitrella patens]
 gb|EDQ65620.1| predicted protein [Physcomitrella patens]
Length=306

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTM  420
            R PFT LSQ+D+D+ALAR LQEQERAY +L M
Sbjct  37   RVPFTSLSQVDSDMALARALQEQERAYFLLQM  68



>ref|XP_008651501.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 tpg|DAA62491.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62492.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=322

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQERAYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRMN  85



>gb|KHG07975.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=193

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQ-----ERAYMMLTMNG  426
            RQ S RTPFT+LSQ+DADLALARTLQEQ     E A  +L + G
Sbjct  29   RQSSTRTPFTNLSQVDADLALARTLQEQDAEEREVAARLLALAG  72



>ref|XP_008674938.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=142

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +ADLALAR LQEQE AYM+L MN
Sbjct  53   RRPFTALSQEEADLALARVLQEQEWAYMLLWMN  85



>ref|XP_008673640.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=142

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTM  420
            R PFT LSQ +ADLALAR LQEQERAYM+L M
Sbjct  53   RRPFTALSQEEADLALARVLQEQERAYMLLRM  84



>ref|XP_006859208.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
 gb|ERN20675.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
Length=261

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  286  VNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  414
            VN  A  G   + R PFT+LSQ+++D A+A+TLQ+QERAYMM 
Sbjct  18   VNSDADFGSPINARVPFTNLSQVESDRAIAKTLQQQERAYMMF  60



>gb|KHG29072.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=243

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQE  396
            RQ S RTPFT+LSQ+DADLALARTLQEQ+
Sbjct  49   RQSSTRTPFTNLSQVDADLALARTLQEQD  77



>ref|NP_001062434.1| Os08g0548300 [Oryza sativa Japonica Group]
 dbj|BAD10755.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAD09949.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAF24348.1| Os08g0548300 [Oryza sativa Japonica Group]
 gb|EAZ43565.1| hypothetical protein OsJ_28186 [Oryza sativa Japonica Group]
 dbj|BAG93370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLT  417
            R PFT L+Q +ADLALAR LQEQERAYMML+
Sbjct  38   RRPFTSLTQEEADLALARVLQEQERAYMMLS  68



>gb|EAZ07897.1| hypothetical protein OsI_30152 [Oryza sativa Indica Group]
Length=300

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLT  417
            R PFT L+Q +ADLALAR LQEQERAYMML+
Sbjct  38   RRPFTSLTQEEADLALARVLQEQERAYMMLS  68



>ref|XP_007019133.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY16358.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=205

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  310  RQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  414
            +Q S+R PFT L Q+D+D A+A  LQEQERA+ ML
Sbjct  7    KQSSKRVPFTQLDQVDSDFAMAMALQEQERAFSML  41



>ref|XP_008666504.1| PREDICTED: uncharacterized protein LOC103645175 [Zea mays]
Length=208

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMN  423
            R PFT LSQ +A LALAR LQEQERAYM+L MN
Sbjct  113  RRPFTALSQEEAYLALARVLQEQERAYMLLRMN  145



>ref|XP_008646568.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Zea 
mays]
Length=310

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  325  RTPFTDLSQIDADLALARTLQEQERAYMMLTMNG  426
            R PFT LSQ +ADLALAR LQEQ  AYM+L MNG
Sbjct  137  RRPFTALSQEEADLALARVLQEQRDAYMLLRMNG  170



>ref|XP_007226705.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
 gb|EMJ27904.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
Length=211

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  286  VNQGAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  414
            ++ G    +Q +RRTPFT+L+Q+ +D  LA  +QEQE+AY ML
Sbjct  1    MDGGEDQSKQSTRRTPFTELNQVSSDFILAMAMQEQEQAYTML  43



>ref|XP_008219608.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=211

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  295  GAQGGRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML  414
            G    +Q +RRTPFT+L+Q+ +D  LA  +QEQE+AY ML
Sbjct  4    GEDQSKQSTRRTPFTELNQVSSDFILAMAMQEQEQAYTML  43



>ref|XP_008338661.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Malus domestica]
 ref|XP_008352622.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=217

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +1

Query  307  GRQPSRRTPFTDLSQIDADLALARTLQEQERAYMML-TMNGDA  432
             +Q S+RTPFT+L+Q+ AD  LA  +QEQE+AY ML T+  D+
Sbjct  8    AKQSSQRTPFTELNQVSADFILAMAMQEQEQAYTMLETIESDS  50



Lambda      K        H        a         alpha
   0.307    0.124    0.343    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320