BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020M02

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339420.1|  PREDICTED: uncharacterized protein LOC102603324    283   3e-88   Solanum tuberosum [potatoes]
ref|XP_009614536.1|  PREDICTED: uncharacterized protein LOC104107438    276   4e-88   Nicotiana tomentosiformis
ref|XP_009775161.1|  PREDICTED: uncharacterized protein LOC104225093    279   8e-87   Nicotiana sylvestris
gb|KHN03032.1|  Hypothetical protein glysoja_009898                     279   1e-86   Glycine soja [wild soybean]
ref|XP_006600321.1|  PREDICTED: uncharacterized protein LOC100807...    280   1e-86   Glycine max [soybeans]
ref|XP_006600322.1|  PREDICTED: uncharacterized protein LOC100807...    279   2e-86   Glycine max [soybeans]
gb|KHN03427.1|  Hypothetical protein glysoja_004453                     279   2e-86   Glycine soja [wild soybean]
ref|XP_006584056.1|  PREDICTED: uncharacterized protein LOC100798...    279   2e-86   Glycine max [soybeans]
ref|XP_003529600.1|  PREDICTED: uncharacterized protein LOC100798...    279   2e-86   
ref|XP_006584055.1|  PREDICTED: uncharacterized protein LOC100798...    279   3e-86   
ref|XP_004229458.1|  PREDICTED: uncharacterized protein LOC101262...    278   3e-86   Solanum lycopersicum
ref|XP_008223032.1|  PREDICTED: uncharacterized protein LOC103322864    278   3e-86   Prunus mume [ume]
ref|XP_007222369.1|  hypothetical protein PRUPE_ppa003420mg             278   3e-86   
gb|KDP40084.1|  hypothetical protein JCGZ_02082                         278   3e-86   Jatropha curcas
ref|XP_010322788.1|  PREDICTED: uncharacterized protein LOC101262...    277   4e-86   Solanum lycopersicum
ref|XP_004508352.1|  PREDICTED: uncharacterized protein LOC101492...    278   6e-86   Cicer arietinum [garbanzo]
ref|XP_004508353.1|  PREDICTED: uncharacterized protein LOC101492...    277   1e-85   Cicer arietinum [garbanzo]
gb|KJB72268.1|  hypothetical protein B456_011G168000                    274   1e-85   Gossypium raimondii
ref|XP_007154171.1|  hypothetical protein PHAVU_003G096200g             277   2e-85   Phaseolus vulgaris [French bean]
ref|XP_007154170.1|  hypothetical protein PHAVU_003G096200g             277   2e-85   Phaseolus vulgaris [French bean]
gb|KJB72266.1|  hypothetical protein B456_011G168000                    276   2e-85   Gossypium raimondii
ref|XP_002516800.1|  catalytic, putative                                280   2e-85   
ref|XP_009365782.1|  PREDICTED: uncharacterized protein LOC103955607    276   3e-85   Pyrus x bretschneideri [bai li]
ref|XP_007034567.1|  Alpha/beta-Hydrolases superfamily protein          275   4e-85   
emb|CBI26166.3|  unnamed protein product                                275   5e-85   Vitis vinifera
ref|XP_010649852.1|  PREDICTED: uncharacterized protein LOC100257995    275   5e-85   Vitis vinifera
ref|XP_010512570.1|  PREDICTED: uncharacterized protein LOC104788495    274   6e-85   Camelina sativa [gold-of-pleasure]
ref|XP_004296971.1|  PREDICTED: uncharacterized protein LOC101299950    275   6e-85   Fragaria vesca subsp. vesca
ref|XP_008340898.1|  PREDICTED: uncharacterized protein LOC103403829    275   7e-85   
ref|XP_010466700.1|  PREDICTED: uncharacterized protein LOC104746856    274   7e-85   Camelina sativa [gold-of-pleasure]
ref|XP_011090819.1|  PREDICTED: uncharacterized protein LOC105171...    275   8e-85   Sesamum indicum [beniseed]
ref|XP_011090820.1|  PREDICTED: uncharacterized protein LOC105171...    275   9e-85   Sesamum indicum [beniseed]
ref|XP_011090818.1|  PREDICTED: uncharacterized protein LOC105171...    275   1e-84   Sesamum indicum [beniseed]
ref|XP_011090816.1|  PREDICTED: uncharacterized protein LOC105171...    275   1e-84   Sesamum indicum [beniseed]
ref|XP_011090817.1|  PREDICTED: uncharacterized protein LOC105171...    275   1e-84   Sesamum indicum [beniseed]
ref|XP_006299834.1|  hypothetical protein CARUB_v10016036mg             273   1e-84   Capsella rubella
ref|XP_011071522.1|  PREDICTED: uncharacterized protein LOC105156947    274   2e-84   
gb|KDO74880.1|  hypothetical protein CISIN_1g007812mg                   273   3e-84   Citrus sinensis [apfelsine]
ref|XP_008390806.1|  PREDICTED: uncharacterized protein LOC103453051    273   3e-84   
ref|XP_010488424.1|  PREDICTED: uncharacterized protein LOC104766...    272   3e-84   Camelina sativa [gold-of-pleasure]
gb|KDO74878.1|  hypothetical protein CISIN_1g007812mg                   273   3e-84   Citrus sinensis [apfelsine]
ref|XP_010105703.1|  hypothetical protein L484_011315                   272   3e-84   
ref|XP_006489238.1|  PREDICTED: uncharacterized protein LOC102610023    273   3e-84   Citrus sinensis [apfelsine]
gb|KDO74879.1|  hypothetical protein CISIN_1g007812mg                   272   6e-84   Citrus sinensis [apfelsine]
emb|CDX85110.1|  BnaC07g07960D                                          271   7e-84   
ref|XP_009102606.1|  PREDICTED: uncharacterized protein LOC103828728    271   7e-84   Brassica rapa
emb|CDX77500.1|  BnaA07g06380D                                          271   8e-84   
ref|XP_010532691.1|  PREDICTED: uncharacterized protein LOC104808...    270   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_010532690.1|  PREDICTED: uncharacterized protein LOC104808...    270   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_009339931.1|  PREDICTED: uncharacterized protein LOC103932104    271   2e-83   Pyrus x bretschneideri [bai li]
ref|NP_188996.2|  alpha/beta-Hydrolases superfamily protein             270   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458538.1|  PREDICTED: uncharacterized protein LOC103497...    271   2e-83   
ref|XP_004154381.1|  PREDICTED: uncharacterized protein LOC101218432    271   3e-83   
ref|XP_004145038.1|  PREDICTED: uncharacterized protein LOC101215845    270   3e-83   
ref|XP_006283452.1|  hypothetical protein CARUB_v10004497mg             270   3e-83   Capsella rubella
ref|XP_008458537.1|  PREDICTED: uncharacterized protein LOC103497...    270   3e-83   Cucumis melo [Oriental melon]
ref|XP_006283451.1|  hypothetical protein CARUB_v10004497mg             270   3e-83   Capsella rubella
ref|XP_006419777.1|  hypothetical protein CICLE_v10004606mg             270   5e-83   Citrus clementina [clementine]
gb|KEH32227.1|  alpha/beta-hydrolase superfamily protein                270   6e-83   Medicago truncatula
ref|XP_006597567.1|  PREDICTED: uncharacterized protein LOC100781...    269   6e-83   Glycine max [soybeans]
ref|XP_006597568.1|  PREDICTED: uncharacterized protein LOC100781...    269   7e-83   Glycine max [soybeans]
ref|XP_010450069.1|  PREDICTED: uncharacterized protein LOC104732228    268   9e-83   Camelina sativa [gold-of-pleasure]
ref|XP_007147795.1|  hypothetical protein PHAVU_006G155700g             269   9e-83   Phaseolus vulgaris [French bean]
ref|XP_007147794.1|  hypothetical protein PHAVU_006G155700g             269   9e-83   Phaseolus vulgaris [French bean]
ref|XP_002315536.2|  hypothetical protein POPTR_0010s03020g             268   1e-82   
gb|KHN37552.1|  Hypothetical protein glysoja_007255                     269   1e-82   Glycine soja [wild soybean]
ref|XP_002883434.1|  hypothetical protein ARALYDRAFT_898866             268   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_006414745.1|  hypothetical protein EUTSA_v10024836mg             267   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_006406019.1|  hypothetical protein EUTSA_v10020399mg             267   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_011014506.1|  PREDICTED: uncharacterized protein LOC105118291    268   3e-82   Populus euphratica
ref|XP_009107962.1|  PREDICTED: uncharacterized protein LOC103833638    266   3e-82   Brassica rapa
gb|ACJ85572.1|  unknown                                                 264   3e-82   Medicago truncatula
emb|CDY09027.1|  BnaC01g30640D                                          266   5e-82   Brassica napus [oilseed rape]
ref|XP_010440497.1|  PREDICTED: uncharacterized protein LOC104723788    266   9e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010435158.1|  PREDICTED: uncharacterized protein LOC104719...    265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010435157.1|  PREDICTED: uncharacterized protein LOC104719...    265   3e-81   Camelina sativa [gold-of-pleasure]
ref|NP_193165.7|  alpha/beta-hydrolase family protein                   264   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669834.1|  PREDICTED: uncharacterized protein LOC104886965    264   5e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002868296.1|  predicted protein                                  262   2e-80   Arabidopsis lyrata subsp. lyrata
emb|CDY12752.1|  BnaC04g28890D                                          261   2e-80   Brassica napus [oilseed rape]
emb|CDY49406.1|  BnaCnng17160D                                          260   3e-80   Brassica napus [oilseed rape]
ref|XP_009139528.1|  PREDICTED: uncharacterized protein LOC103863...    261   5e-80   Brassica rapa
ref|XP_009139529.1|  PREDICTED: uncharacterized protein LOC103863...    261   5e-80   Brassica rapa
ref|XP_010035885.1|  PREDICTED: uncharacterized protein LOC104425...    262   6e-80   Eucalyptus grandis [rose gum]
ref|XP_010035879.1|  PREDICTED: uncharacterized protein LOC104425...    262   6e-80   Eucalyptus grandis [rose gum]
gb|AES64344.2|  alpha/beta hydrolase family protein                     260   8e-80   Medicago truncatula
ref|XP_009139530.1|  PREDICTED: uncharacterized protein LOC103863...    260   8e-80   Brassica rapa
gb|EPS65169.1|  hypothetical protein M569_09610                         257   1e-79   Genlisea aurea
ref|XP_011009032.1|  PREDICTED: uncharacterized protein LOC105114...    260   2e-79   Populus euphratica
ref|XP_011009029.1|  PREDICTED: uncharacterized protein LOC105114...    260   2e-79   Populus euphratica
ref|XP_004486108.1|  PREDICTED: HBS1-like protein-like                  264   2e-78   
ref|XP_009109570.1|  PREDICTED: uncharacterized protein LOC103835198    255   6e-78   Brassica rapa
emb|CDY12069.1|  BnaC03g59850D                                          253   3e-77   Brassica napus [oilseed rape]
ref|XP_010942429.1|  PREDICTED: uncharacterized protein LOC105060...    253   6e-77   
ref|XP_010942428.1|  PREDICTED: uncharacterized protein LOC105060...    252   4e-76   Elaeis guineensis
ref|XP_009393893.1|  PREDICTED: uncharacterized protein LOC103979459    251   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88870.1|  predicted protein                                      247   6e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO98976.1|  unnamed protein product                                250   1e-75   Coffea canephora [robusta coffee]
gb|EMS48134.1|  hypothetical protein TRIUR3_10822                       244   2e-75   Triticum urartu
gb|EMT30875.1|  hypothetical protein F775_08510                         244   2e-75   
ref|XP_003557834.1|  PREDICTED: uncharacterized protein LOC100838212    249   2e-75   Brachypodium distachyon [annual false brome]
ref|XP_004984312.1|  PREDICTED: uncharacterized protein LOC101769...    249   2e-75   Setaria italica
emb|CDX90263.1|  BnaA08g17210D                                          248   2e-75   
ref|NP_001141958.1|  hypothetical protein                               249   3e-75   Zea mays [maize]
ref|XP_008668219.1|  PREDICTED: hypothetical protein isoform X1         249   3e-75   Zea mays [maize]
gb|ABF96061.1|  expressed protein                                       249   3e-75   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90076.1|  hypothetical protein OsI_11646                          249   3e-75   Oryza sativa Indica Group [Indian rice]
dbj|BAB02772.1|  unnamed protein product                                249   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850814.1|  hypothetical protein AMTR_s00025p00118390          248   5e-75   Amborella trichopoda
ref|XP_008797057.1|  PREDICTED: uncharacterized protein LOC103712341    248   7e-75   Phoenix dactylifera
ref|XP_006650100.1|  PREDICTED: uncharacterized protein LOC102716943    248   1e-74   Oryza brachyantha
gb|ACF83402.1|  unknown                                                 246   4e-74   Zea mays [maize]
ref|XP_010255853.1|  PREDICTED: uncharacterized protein LOC104596404    245   9e-74   Nelumbo nucifera [Indian lotus]
ref|XP_006595393.1|  PREDICTED: uncharacterized protein LOC100815597    245   2e-73   
ref|XP_010278880.1|  PREDICTED: uncharacterized protein LOC104612...    243   6e-73   Nelumbo nucifera [Indian lotus]
emb|CAB10208.1|  hypothetical protein                                   234   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311822.2|  hypothetical protein POPTR_0008s20480g             235   1e-69   
ref|XP_011090821.1|  PREDICTED: uncharacterized protein LOC105171...    221   3e-64   
ref|XP_003535011.1|  PREDICTED: uncharacterized protein LOC100787...    216   2e-63   Glycine max [soybeans]
ref|XP_002968666.1|  hypothetical protein SELMODRAFT_170125             211   3e-63   
ref|XP_004486396.1|  PREDICTED: uncharacterized protein LOC101505...    214   6e-63   Cicer arietinum [garbanzo]
ref|XP_006584122.1|  PREDICTED: alpha/beta hydrolase domain-conta...    212   8e-63   
ref|XP_007147555.1|  hypothetical protein PHAVU_006G134600g             214   1e-62   Phaseolus vulgaris [French bean]
ref|XP_001769780.1|  predicted protein                                  210   2e-62   
ref|XP_003594373.1|  Abhydrolase domain-containing protein              214   2e-62   
gb|KDO78612.1|  hypothetical protein CISIN_1g011425mg                   207   3e-62   Citrus sinensis [apfelsine]
gb|AES64624.2|  alpha/beta superfamily hydrolase                        213   3e-62   Medicago truncatula
ref|XP_003550951.1|  PREDICTED: uncharacterized protein LOC100784...    212   4e-62   
gb|KEH32722.1|  esterase/lipase domain protein                          210   6e-62   Medicago truncatula
ref|XP_006597639.1|  PREDICTED: uncharacterized protein LOC100778...    208   7e-62   
gb|KDO78613.1|  hypothetical protein CISIN_1g011425mg                   208   2e-61   Citrus sinensis [apfelsine]
ref|XP_006449959.1|  hypothetical protein CICLE_v10015057mg             208   2e-61   
gb|KEH32721.1|  esterase/lipase domain protein                          209   2e-61   Medicago truncatula
gb|KDO78610.1|  hypothetical protein CISIN_1g011425mg                   208   2e-61   Citrus sinensis [apfelsine]
ref|XP_010252925.1|  PREDICTED: uncharacterized protein LOC104594...    211   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008440941.1|  PREDICTED: uncharacterized protein LOC103485...    210   3e-61   Cucumis melo [Oriental melon]
ref|XP_004134817.1|  PREDICTED: uncharacterized protein LOC101211724    210   3e-61   Cucumis sativus [cucumbers]
ref|XP_008440940.1|  PREDICTED: uncharacterized protein LOC103485...    210   5e-61   Cucumis melo [Oriental melon]
gb|KEH32720.1|  esterase/lipase domain protein                          210   6e-61   Medicago truncatula
ref|XP_007154081.1|  hypothetical protein PHAVU_003G089300g             208   7e-61   Phaseolus vulgaris [French bean]
ref|XP_006597638.1|  PREDICTED: uncharacterized protein LOC100778...    208   8e-61   Glycine max [soybeans]
gb|KJB57898.1|  hypothetical protein B456_009G185500                    206   9e-61   Gossypium raimondii
ref|XP_007154082.1|  hypothetical protein PHAVU_003G089300g             209   1e-60   Phaseolus vulgaris [French bean]
ref|XP_009411958.1|  PREDICTED: uncharacterized protein LOC103993...    209   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO78611.1|  hypothetical protein CISIN_1g011425mg                   207   1e-60   Citrus sinensis [apfelsine]
ref|XP_004499346.1|  PREDICTED: uncharacterized protein LOC101489...    208   1e-60   Cicer arietinum [garbanzo]
gb|KJB57899.1|  hypothetical protein B456_009G185500                    206   1e-60   Gossypium raimondii
ref|XP_006467246.1|  PREDICTED: uncharacterized protein LOC102629...    208   2e-60   Citrus sinensis [apfelsine]
ref|XP_006449960.1|  hypothetical protein CICLE_v10015057mg             208   2e-60   Citrus clementina [clementine]
ref|XP_004499344.1|  PREDICTED: uncharacterized protein LOC101489...    209   2e-60   Cicer arietinum [garbanzo]
ref|XP_003571271.1|  PREDICTED: uncharacterized protein LOC100830...    208   2e-60   Brachypodium distachyon [annual false brome]
ref|XP_010233983.1|  PREDICTED: uncharacterized protein LOC100830...    208   2e-60   Brachypodium distachyon [annual false brome]
gb|ACN85333.1|  unknown                                                 207   4e-60   Oryza meyeriana var. granulata
ref|XP_001780178.1|  predicted protein                                  203   4e-60   
gb|KHN40755.1|  Hypothetical protein glysoja_015122                     207   4e-60   Glycine soja [wild soybean]
ref|XP_003547304.1|  PREDICTED: uncharacterized protein LOC100778...    207   4e-60   
ref|XP_007026441.1|  Alpha/beta-Hydrolases superfamily protein is...    204   5e-60   
gb|KJB57903.1|  hypothetical protein B456_009G185500                    206   6e-60   Gossypium raimondii
ref|XP_010647089.1|  PREDICTED: uncharacterized protein LOC100242843    206   8e-60   
gb|KJB57901.1|  hypothetical protein B456_009G185500                    206   8e-60   Gossypium raimondii
ref|XP_006380855.1|  hypothetical protein POPTR_0006s00280g             202   8e-60   
gb|KJB57895.1|  hypothetical protein B456_009G185500                    206   1e-59   Gossypium raimondii
gb|KJB57896.1|  hypothetical protein B456_009G185500                    206   1e-59   Gossypium raimondii
ref|XP_003563634.1|  PREDICTED: uncharacterized protein LOC100831715    206   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_004965908.1|  PREDICTED: uncharacterized protein LOC101783766    206   2e-59   Setaria italica
ref|XP_010252924.1|  PREDICTED: uncharacterized protein LOC104594...    206   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006656239.1|  PREDICTED: uncharacterized protein LOC102719683    206   2e-59   Oryza brachyantha
gb|KJB57897.1|  hypothetical protein B456_009G185500                    206   2e-59   Gossypium raimondii
gb|AFW70735.1|  hypothetical protein ZEAMMB73_068292                    204   3e-59   
ref|XP_008794704.1|  PREDICTED: uncharacterized protein LOC103710654    206   3e-59   Phoenix dactylifera
ref|XP_008644127.1|  PREDICTED: hypothetical protein isoform X2         204   3e-59   Zea mays [maize]
ref|XP_004514787.1|  PREDICTED: uncharacterized protein LOC101501...    204   4e-59   Cicer arietinum [garbanzo]
ref|XP_004514786.1|  PREDICTED: uncharacterized protein LOC101501...    205   4e-59   Cicer arietinum [garbanzo]
ref|XP_008782969.1|  PREDICTED: uncharacterized protein LOC103702...    205   5e-59   Phoenix dactylifera
ref|XP_006857594.1|  hypothetical protein AMTR_s00061p00094480          205   6e-59   Amborella trichopoda
ref|XP_006380856.1|  hypothetical protein POPTR_0006s00280g             203   6e-59   
gb|ACN85247.1|  unknown                                                 204   7e-59   Oryza officinalis
gb|ACN85219.1|  unknown                                                 204   7e-59   Oryza punctata
ref|NP_001118998.1|  alpha/beta-Hydrolases superfamily protein          201   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170041.1|  hypothetical protein                               204   7e-59   Zea mays [maize]
ref|XP_008644126.1|  PREDICTED: hypothetical protein isoform X1         204   9e-59   Zea mays [maize]
gb|ACN85260.1|  unknown                                                 204   9e-59   Oryza alta
ref|XP_007026439.1|  Alpha/beta-Hydrolases superfamily protein is...    204   1e-58   
gb|KDP29023.1|  hypothetical protein JCGZ_16412                         204   1e-58   Jatropha curcas
ref|XP_008782966.1|  PREDICTED: uncharacterized protein LOC103702...    204   1e-58   
ref|XP_004951562.1|  PREDICTED: uncharacterized protein LOC101776234    204   1e-58   Setaria italica
gb|ACN85273.1|  unknown                                                 204   1e-58   Oryza alta
ref|XP_010530100.1|  PREDICTED: uncharacterized protein LOC104806...    200   2e-58   
ref|XP_006373549.1|  hypothetical protein POPTR_0016s00300g             203   2e-58   
ref|XP_010686591.1|  PREDICTED: uncharacterized protein LOC104900...    201   2e-58   
ref|XP_010942494.1|  PREDICTED: uncharacterized protein LOC105060476    203   2e-58   
ref|NP_001058047.1|  Os06g0609700                                       203   3e-58   
ref|XP_010434714.1|  PREDICTED: uncharacterized protein LOC104718...    203   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004984313.1|  PREDICTED: uncharacterized protein LOC101769...    204   3e-58   Setaria italica
ref|XP_010434713.1|  PREDICTED: uncharacterized protein LOC104718...    203   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006350228.1|  PREDICTED: uncharacterized protein LOC102589...    202   4e-58   Solanum tuberosum [potatoes]
ref|XP_006350227.1|  PREDICTED: uncharacterized protein LOC102589...    202   4e-58   
ref|XP_002525239.1|  catalytic, putative                                202   5e-58   Ricinus communis
ref|XP_010440051.1|  PREDICTED: uncharacterized protein LOC104723...    201   5e-58   
ref|XP_010440050.1|  PREDICTED: uncharacterized protein LOC104723...    202   6e-58   
ref|XP_010440048.1|  PREDICTED: uncharacterized protein LOC104723...    202   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010530099.1|  PREDICTED: uncharacterized protein LOC104806...    200   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_010440049.1|  PREDICTED: uncharacterized protein LOC104723...    202   7e-58   
ref|XP_011095854.1|  PREDICTED: uncharacterized protein LOC105175196    201   7e-58   Sesamum indicum [beniseed]
ref|XP_008649080.1|  PREDICTED: uncharacterized protein LOC103629745    202   7e-58   Zea mays [maize]
ref|NP_193448.2|  alpha/beta-Hydrolases superfamily protein             202   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009802385.1|  PREDICTED: uncharacterized protein LOC104247...    201   8e-58   Nicotiana sylvestris
ref|XP_010686590.1|  PREDICTED: uncharacterized protein LOC104900...    200   8e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009620526.1|  PREDICTED: uncharacterized protein LOC104112345    201   9e-58   Nicotiana tomentosiformis
ref|XP_007213932.1|  hypothetical protein PRUPE_ppa004766mg             201   1e-57   Prunus persica
ref|XP_007213931.1|  hypothetical protein PRUPE_ppa004766mg             201   1e-57   Prunus persica
ref|XP_010686588.1|  PREDICTED: uncharacterized protein LOC104900...    201   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010530097.1|  PREDICTED: uncharacterized protein LOC104806...    200   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_011040087.1|  PREDICTED: uncharacterized protein LOC105136...    201   1e-57   Populus euphratica
ref|XP_010058007.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    201   1e-57   Eucalyptus grandis [rose gum]
ref|XP_011040086.1|  PREDICTED: uncharacterized protein LOC105136...    201   1e-57   Populus euphratica
ref|XP_011040085.1|  PREDICTED: uncharacterized protein LOC105136...    201   1e-57   Populus euphratica
ref|XP_010530091.1|  PREDICTED: uncharacterized protein LOC104806...    201   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_010449663.1|  PREDICTED: uncharacterized protein LOC104731...    201   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002870121.1|  hypothetical protein ARALYDRAFT_915007             201   2e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_004293431.1|  PREDICTED: uncharacterized protein LOC101309...    200   3e-57   Fragaria vesca subsp. vesca
ref|XP_011460088.1|  PREDICTED: uncharacterized protein LOC101309...    200   3e-57   Fragaria vesca subsp. vesca
ref|XP_008224685.1|  PREDICTED: uncharacterized protein LOC103324410    199   3e-57   
gb|KFK32200.1|  hypothetical protein AALP_AA6G210300                    199   4e-57   Arabis alpina [alpine rockcress]
ref|XP_010319209.1|  PREDICTED: uncharacterized protein LOC101251464    199   5e-57   Solanum lycopersicum
ref|XP_006414266.1|  hypothetical protein EUTSA_v10027147mg             199   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009108297.1|  PREDICTED: uncharacterized protein LOC103833...    197   3e-56   Brassica rapa
ref|XP_008384339.1|  PREDICTED: uncharacterized protein LOC103446...    196   6e-56   
ref|XP_008384338.1|  PREDICTED: uncharacterized protein LOC103446...    196   8e-56   
ref|XP_008384332.1|  PREDICTED: uncharacterized protein LOC103446...    196   8e-56   
gb|EYU45603.1|  hypothetical protein MIMGU_mgv1a0037051mg               195   3e-55   Erythranthe guttata [common monkey flower]
gb|KHN14394.1|  Hypothetical protein glysoja_012432                     194   4e-55   Glycine soja [wild soybean]
ref|XP_010911200.1|  PREDICTED: uncharacterized protein LOC105037208    184   2e-54   
gb|EYU27617.1|  hypothetical protein MIMGU_mgv1a005188mg                192   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_009374809.1|  PREDICTED: uncharacterized protein LOC103963697    192   3e-54   Pyrus x bretschneideri [bai li]
ref|NP_001172844.1|  Os02g0197900                                       181   1e-53   
ref|XP_002885117.1|  hypothetical protein ARALYDRAFT_897893             176   5e-52   
gb|EEC72683.1|  hypothetical protein OsI_06247                          186   6e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_010530096.1|  PREDICTED: uncharacterized protein LOC104806...    181   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_009802386.1|  PREDICTED: uncharacterized protein LOC104247...    179   2e-49   Nicotiana sylvestris
ref|XP_002438665.1|  hypothetical protein SORBIDRAFT_10g023905          177   8e-49   
emb|CDP04561.1|  unnamed protein product                                174   1e-47   Coffea canephora [robusta coffee]
dbj|BAK06433.1|  predicted protein                                      169   8e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011090822.1|  PREDICTED: uncharacterized protein LOC105171...    169   3e-45   Sesamum indicum [beniseed]
ref|XP_006586806.1|  PREDICTED: uncharacterized protein LOC100787...    164   6e-44   
emb|CAN66506.1|  hypothetical protein VITISV_035499                     162   9e-43   Vitis vinifera
ref|XP_010096514.1|  hypothetical protein L484_017966                   161   2e-42   
gb|KHN40219.1|  Hypothetical protein glysoja_038414                     158   1e-41   Glycine soja [wild soybean]
ref|XP_002451724.1|  hypothetical protein SORBIDRAFT_04g006660          157   2e-41   
ref|XP_006283654.1|  hypothetical protein CARUB_v10004712mg             157   2e-41   Capsella rubella
gb|KHG17313.1|  putative yqkD                                           158   2e-41   Gossypium arboreum [tree cotton]
ref|XP_011009031.1|  PREDICTED: uncharacterized protein LOC105114...    157   3e-41   Populus euphratica
ref|XP_010434715.1|  PREDICTED: uncharacterized protein LOC104718...    157   4e-41   Camelina sativa [gold-of-pleasure]
gb|EAZ22104.1|  hypothetical protein OsJ_05763                          156   5e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006597635.1|  PREDICTED: uncharacterized protein LOC100778...    155   9e-41   Glycine max [soybeans]
ref|XP_009802387.1|  PREDICTED: uncharacterized protein LOC104247...    154   1e-40   Nicotiana sylvestris
ref|XP_006648424.1|  PREDICTED: uncharacterized protein LOC102719462    155   1e-40   
ref|XP_010449665.1|  PREDICTED: uncharacterized protein LOC104731...    154   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_005834328.1|  hypothetical protein GUITHDRAFT_106795             153   3e-40   Guillardia theta CCMP2712
ref|XP_009108298.1|  PREDICTED: uncharacterized protein LOC103833...    154   3e-40   Brassica rapa
ref|XP_009802384.1|  PREDICTED: uncharacterized protein LOC104247...    154   4e-40   Nicotiana sylvestris
gb|KHN19820.1|  Serine hydroxymethyltransferase 1                       147   4e-39   Glycine soja [wild soybean]
ref|XP_010686589.1|  PREDICTED: uncharacterized protein LOC104900...    149   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002465239.1|  hypothetical protein SORBIDRAFT_01g034850          148   7e-38   
dbj|GAM26335.1|  hypothetical protein SAMD00019534_095100               147   8e-38   Acytostelium subglobosum LB1
ref|XP_002683321.1|  predicted protein                                  142   5e-37   Naegleria gruberi strain NEG-M
ref|XP_002500526.1|  predicted protein                                  140   3e-36   Micromonas commoda
gb|EFA83276.1|  alpha/beta hydrolase fold-1 domain-containing pro...    143   3e-36   Heterostelium album PN500
emb|CDJ70048.1|  hypothetical protein, conserved                        136   1e-35   Eimeria necatrix
ref|XP_004039103.1|  hypothetical protein IMG5_033680                   136   6e-35   Ichthyophthirius multifiliis
emb|CDJ56015.1|  hypothetical protein, conserved                        139   1e-34   Eimeria maxima
emb|CDY50125.1|  BnaCnng18740D                                          138   2e-34   Brassica napus [oilseed rape]
ref|XP_005822973.1|  hypothetical protein GUITHDRAFT_146136             137   5e-34   Guillardia theta CCMP2712
emb|CDY58164.1|  BnaA08g30210D                                          137   7e-34   Brassica napus [oilseed rape]
emb|CDI77547.1|  hypothetical protein EAH_00025150                      137   9e-34   Eimeria acervulina
ref|XP_006467249.1|  PREDICTED: uncharacterized protein LOC102629...    135   1e-33   Citrus sinensis [apfelsine]
ref|XP_006449958.1|  hypothetical protein CICLE_v10015057mg             135   1e-33   
gb|KFG99519.1|  putative protein c14orf29                               138   1e-33   Toxoplasma gondii VAND
gb|KFG51948.1|  putative protein c14orf29                               138   2e-33   Toxoplasma gondii p89
gb|EPR64695.1|  putative protein c14orf29                               138   2e-33   
gb|KFG61733.1|  putative protein c14orf29                               138   2e-33   
gb|EPT28520.1|  protein c14orf29, putative                              138   2e-33   
gb|ESS36204.1|  putative protein c14orf29                               138   2e-33   
gb|KFH16547.1|  putative protein c14orf29                               138   2e-33   
ref|XP_002365812.1|  hypothetical protein TGME49_071460                 136   2e-33   
ref|XP_008882514.1|  protein c14orf29, putative                         138   2e-33   
ref|XP_010530098.1|  PREDICTED: uncharacterized protein LOC104806...    133   7e-33   
ref|XP_645007.1|  alpha/beta hydrolase fold-1 domain-containing p...    134   8e-33   
ref|XP_003285027.1|  hypothetical protein DICPUDRAFT_148856             134   9e-33   
ref|XP_005849267.1|  hypothetical protein CHLNCDRAFT_143536             135   1e-32   
ref|XP_003883797.1|  Alpha/beta hydrolase, related                      135   2e-32   
emb|CDJ41283.1|  hypothetical protein, conserved                        134   6e-32   
ref|XP_010278885.1|  PREDICTED: uncharacterized protein LOC104612...    131   8e-32   
ref|XP_001019221.1|  hypothetical protein TTHERM_00849190               130   8e-32   
gb|EJY87631.1|  hypothetical protein OXYTRI_01425                       130   1e-31   
gb|KHN03563.1|  hypothetical protein glysoja_004589                     130   1e-31   
gb|KHG30285.1|  putative yqkD                                           129   3e-31   
emb|CBJ29857.1|  conserved unknown protein                              131   4e-31   
ref|XP_003056359.1|  predicted protein                                  125   9e-31   
gb|EJY74722.1|  hypothetical protein OXYTRI_04018                       127   1e-30   
ref|XP_011395460.1|  Uncharacterized protein YqkD                       126   2e-30   
ref|XP_002780525.1|  Protein C14orf29, putative                         125   3e-30   
dbj|BAF02033.1|  hypothetical protein                                   117   6e-30   
ref|XP_002787187.1|  Protein C14orf29, putative                         123   8e-30   
emb|CDW72798.1|  UNKNOWN                                                124   1e-29   
ref|XP_009035971.1|  hypothetical protein AURANDRAFT_2040               122   1e-29   
ref|XP_005840487.1|  hypothetical protein GUITHDRAFT_161065             120   2e-29   
ref|XP_001690455.1|  hypothetical protein CHLREDRAFT_188508             124   4e-29   
ref|XP_009040667.1|  hypothetical protein AURANDRAFT_32346              120   7e-29   
emb|CDW72273.1|  UNKNOWN                                                125   7e-29   
ref|XP_002781185.1|  Protein C14orf29, putative                         120   8e-29   
ref|WP_028832089.1|  hypothetical protein                               121   1e-28   
gb|EJY71252.1|  Protein C14orf29, putative                              120   2e-28   
ref|XP_011131447.1|  alpha/beta hydrolase family protein                120   3e-28   
ref|XP_004336643.1|  hypothetical protein ACA1_066610                   122   4e-28   
gb|KDO23939.1|  hypothetical protein SPRG_10085                         120   5e-28   
ref|XP_004359060.1|  alpha/beta hydrolase fold-1 domain-containin...    119   1e-27   
emb|CDJ45709.1|  hypothetical protein EBH_0061260                       114   1e-27   
gb|EPY23000.1|  hypothetical protein STCU_07959                         116   1e-27   
emb|CDW85425.1|  UNKNOWN                                                117   2e-27   
ref|XP_008914557.1|  hypothetical protein PPTG_18194                    118   4e-27   
ref|XP_005829247.1|  hypothetical protein GUITHDRAFT_111828             115   4e-27   
gb|ETI32165.1|  hypothetical protein F443_20953                         118   5e-27   
gb|ETO60903.1|  hypothetical protein F444_20964                         118   5e-27   
gb|ETK72540.1|  hypothetical protein L915_20365                         118   5e-27   
ref|XP_001428850.1|  hypothetical protein                               120   5e-27   
gb|ETP30186.1|  hypothetical protein F442_20753                         118   6e-27   
ref|XP_001447435.1|  hypothetical protein                               116   7e-27   
gb|EFA84193.1|  hypothetical protein PPL_03268                          115   9e-27   
ref|XP_002998858.1|  serine protease family S09X, putative              117   1e-26   
ref|XP_008614637.1|  hypothetical protein SDRG_10426                    115   2e-26   
emb|CAB10496.1|  hypothetical protein                                   114   5e-26   
gb|EWM25459.1|  serine protease family                                  115   7e-26   
ref|XP_008871632.1|  hypothetical protein, variant                      112   1e-25   
ref|XP_009835314.1|  hypothetical protein H257_10454                    113   1e-25   
ref|XP_001459749.1|  hypothetical protein                               111   2e-25   
emb|CCW67946.1|  unnamed protein product                                111   2e-25   
emb|CCA19146.1|  serine protease family S09X putative                   113   2e-25   
ref|XP_008871631.1|  hypothetical protein H310_07893                    112   2e-25   
gb|EPS70866.1|  hypothetical protein M569_03894                         105   2e-25   
ref|XP_668367.1|  random slug cDNA-11 (Fragment)                        113   3e-25   
emb|CCI43474.1|  unnamed protein product                                112   3e-25   
ref|XP_628229.1|  protein with a conserved N-terminal region            113   3e-25   
ref|XP_009314015.1|  hypothetical protein DQ04_08901020                 111   4e-25   
ref|XP_009041890.1|  hypothetical protein AURANDRAFT_72733              112   9e-25   
ref|XP_005835898.1|  hypothetical protein GUITHDRAFT_136548             110   1e-24   
ref|XP_001447920.1|  hypothetical protein                               108   4e-24   
gb|KIY96673.1|  hypothetical protein MNEG_11288                         108   4e-24   
emb|CCC90908.1|  unnamed protein product                                107   6e-24   
gb|EKF37985.1|  hypothetical protein MOQ_001810                         107   6e-24   
gb|EKG05821.1|  hypothetical protein TCSYLVIO_003099                    107   7e-24   
ref|XP_002142078.1|  hypothetical protein                               108   7e-24   
ref|XP_004035138.1|  hypothetical protein IMG5_105010                   106   1e-23   
ref|XP_005714234.1|  unnamed protein product                            109   1e-23   
gb|ETP50752.1|  hypothetical protein F442_04020                         107   2e-23   
ref|XP_008901240.1|  hypothetical protein PPTG_08082                    107   2e-23   
gb|ETL46239.1|  hypothetical protein L916_03863                         107   2e-23   
ref|XP_010701076.1|  hypothetical protein LPMP_300410                   106   2e-23   
ref|XP_845302.1|  hypothetical protein                                  106   2e-23   
emb|CBH11673.1|  hypothetical protein, conserved                        106   2e-23   
ref|XP_005783561.1|  hypothetical protein EMIHUDRAFT_434409             107   2e-23   
ref|XP_001566680.1|  conserved hypothetical protein                     105   4e-23   
ref|XP_002291190.1|  hypothetical protein THAPSDRAFT_269163             107   5e-23   
emb|CCA24963.1|  serine protease family S09X putative                   105   5e-23   
ref|XP_004035837.1|  hypothetical protein IMG5_086710                   105   6e-23   
gb|EAS02968.2|  alpha/beta fold hydrolase                               105   6e-23   
ref|XP_001443817.1|  hypothetical protein                               104   6e-23   
gb|EJK64219.1|  hypothetical protein THAOC_15066                        106   7e-23   
ref|XP_009538086.1|  hypothetical protein PHYSODRAFT_307213             106   8e-23   
ref|XP_005832880.1|  hypothetical protein GUITHDRAFT_138727             104   8e-23   
ref|XP_002773985.1|  Abhydrolase domain-containing protein, putative    103   1e-22   
ref|XP_813897.1|  hypothetical protein                                  104   1e-22   
gb|EJY73890.1|  hypothetical protein OXYTRI_04857                       102   2e-22   
emb|CCI46060.1|  unnamed protein product                                103   3e-22   
ref|XP_009529301.1|  hypothetical protein PHYSODRAFT_546309             104   3e-22   
ref|XP_002909261.1|  serine protease family S09X, putative              103   4e-22   
ref|XP_009041300.1|  hypothetical protein AURANDRAFT_72626              105   4e-22   
gb|EAR98281.2|  alpha/beta hydrolase family protein                     103   4e-22   
ref|XP_001431900.1|  hypothetical protein                               102   4e-22   
ref|XP_002765178.1|  conserved hypothetical protein                     102   6e-22   
ref|XP_005648115.1|  alpha/beta-hydrolase                               103   8e-22   
emb|CDW81374.1|  abhydrolase domain-containing                          101   8e-22   
ref|XP_003877186.1|  conserved hypothetical protein                     102   1e-21   
ref|XP_001430009.1|  hypothetical protein                               101   1e-21   
gb|EAR89045.2|  X-pro dipeptidyl-peptidase, S15 family protein          104   1e-21   
ref|XP_001009290.1|  hypothetical protein TTHERM_00846990               103   1e-21   
ref|XP_001445385.1|  hypothetical protein                               100   1e-21   
gb|EPY28011.1|  hypothetical protein AGDE_10595                         100   2e-21   
gb|EMS51371.1|  hypothetical protein TRIUR3_15935                       102   2e-21   
ref|XP_001684629.1|  conserved hypothetical protein                     101   2e-21   
dbj|BAP69022.1|  RxLR effector candidate protein                        102   2e-21   
ref|XP_004031116.1|  hypothetical protein IMG5_146530                 99.8    5e-21   
gb|KDO35722.1|  hypothetical protein SPRG_18871                       99.8    5e-21   
ref|XP_009040576.1|  hypothetical protein AURANDRAFT_72453            99.8    2e-20   
emb|CBN74744.1|  conserved unknown protein                              100   3e-20   
ref|XP_001466886.1|  conserved hypothetical protein                   98.6    3e-20   
ref|XP_003862754.1|  hypothetical protein, conserved                  98.6    3e-20   
ref|XP_008607180.1|  hypothetical protein SDRG_03327                  97.4    4e-20   
ref|XP_004367489.1|  abnormal long morphology protein                 96.3    5e-20   
ref|XP_001012870.1|  hypothetical protein TTHERM_00094160             99.0    1e-19   
ref|XP_004039812.1|  hypothetical protein IMG5_009170                 97.1    1e-19   
emb|CCW67952.1|  unnamed protein product                              92.4    7e-19   
gb|EAR83757.2|  alpha/beta fold hydrolase                             95.5    7e-19   
emb|CDO64002.1|  alpha/beta-hydrolase, putative                       93.2    2e-18   
ref|XP_005781400.1|  hypothetical protein EMIHUDRAFT_456875           90.9    3e-18   
ref|XP_004221107.1|  hypothetical protein PCYB_051780                 90.5    5e-18   
ref|XP_001018256.1|  hypothetical protein TTHERM_00284010             93.6    5e-18   
ref|XP_678874.1|  hypothetical protein                                90.5    5e-18   
gb|EAS05128.2|  alpha/beta hydrolase family protein                   93.6    6e-18   
emb|CCI48112.1|  unnamed protein product                              90.5    6e-18   
ref|XP_008816465.1|  hypothetical protein C922_02644                  92.0    7e-18   
gb|EYU45602.1|  hypothetical protein MIMGU_mgv1a0037052mg             84.3    8e-18   
ref|XP_004026841.1|  serine protease family, putative                 90.9    8e-18   
gb|EUT87307.1|  hypothetical protein PFAG_02129                       90.1    8e-18   
gb|ETW18969.1|  hypothetical protein PFFVO_02176                      90.1    8e-18   
gb|ETW49834.1|  hypothetical protein PFMALIP_02192                    90.1    8e-18   
ref|XP_008914946.1|  hypothetical protein PPTG_18473                  88.6    1e-17   
ref|XP_001314988.1|  hypothetical protein                             89.4    1e-17   
ref|XP_001016054.2|  hypothetical protein TTHERM_00877040             92.8    1e-17   
ref|XP_744629.1|  hypothetical protein                                89.7    1e-17   
gb|ETB58663.1|  hypothetical protein YYC_03816                        90.9    1e-17   
ref|XP_002258089.1|  hypothetical protein in Apicomplexan species     90.1    3e-17   
ref|XP_001315649.1|  Clan SC, family S9, unassigned serine peptidase  88.2    3e-17   
emb|CCA24173.1|  serine protease family S09X putative                 89.4    3e-17   
emb|CDS45687.1|  alpha/beta hydrolase, putative                       90.1    3e-17   
ref|XP_008618710.1|  hypothetical protein SDRG_14364                  89.0    3e-17   
ref|XP_002808873.1|  conserved Plasmodium protein, unknown function   89.7    3e-17   
ref|XP_009521324.1|  hypothetical protein PHYSODRAFT_482632           89.4    4e-17   
ref|XP_001449217.1|  hypothetical protein                             88.6    5e-17   
gb|ETK72174.1|  hypothetical protein L915_20690                       87.8    5e-17   
ref|XP_001436216.1|  hypothetical protein                             88.2    6e-17   
emb|CDR12095.1|  alpha/beta hydrolase, putative                       89.0    7e-17   
ref|XP_730594.1|  hypothetical protein                                88.6    7e-17   
ref|XP_008626199.1|  hypothetical protein YYE_04336                   88.6    1e-16   
ref|XP_001614928.1|  hypothetical protein                             88.2    1e-16   
ref|XP_002998182.1|  serine protease family S09X, putative            86.7    1e-16   
ref|XP_008875870.1|  hypothetical protein H310_11095                  87.0    2e-16   
emb|CCC48334.1|  conserved hypothetical protein                       85.9    2e-16   
ref|XP_002181623.1|  predicted protein                                85.1    2e-16   
ref|XP_001432920.1|  hypothetical protein                             85.9    2e-16   
ref|XP_004035282.1|  hypothetical protein IMG5_102050                 87.4    3e-16   
gb|EWM27930.1|  serine protease family                                87.4    4e-16   
gb|EUD70658.1|  hypothetical protein YYG_04216                        86.7    4e-16   
ref|XP_001303939.1|  Clan SC, family S9, unassigned serine peptidase  84.7    4e-16   
ref|XP_001025373.1|  hypothetical protein TTHERM_00765130             87.8    4e-16   
ref|XP_001018526.1|  hypothetical protein TTHERM_00346800             86.3    6e-16   
ref|XP_004035399.1|  hypothetical protein IMG5_099930                 86.3    6e-16   
ref|XP_009108299.1|  PREDICTED: uncharacterized protein LOC103833...  85.1    7e-16   
ref|XP_002905156.1|  conserved hypothetical protein                   85.5    7e-16   
ref|XP_009036766.1|  hypothetical protein AURANDRAFT_71549            87.0    8e-16   
gb|KDO31408.1|  hypothetical protein SPRG_04024                       84.7    9e-16   
ref|WP_028830769.1|  hypothetical protein                             85.1    1e-15   
ref|XP_004024168.1|  hypothetical protein IMG5_198760                 82.4    1e-15   
ref|XP_001315076.1|  hypothetical protein                             82.8    2e-15   
ref|XP_009835150.1|  hypothetical protein H257_10339                  84.3    2e-15   
ref|XP_009835152.1|  hypothetical protein, variant 2                  84.3    2e-15   
ref|XP_001471058.1|  Abnormal long morphology protein, putative       85.9    2e-15   
ref|XP_009835151.1|  hypothetical protein, variant 1                  84.3    2e-15   
ref|XP_009835153.1|  hypothetical protein, variant 3                  84.0    2e-15   
emb|CCI45202.1|  unnamed protein product                              84.7    5e-15   
gb|EAS06230.2|  alpha/beta fold hydrolase                             84.3    5e-15   
ref|XP_008864598.1|  hypothetical protein H310_02754                  83.2    5e-15   
ref|XP_009532602.1|  hypothetical protein PHYSODRAFT_336708           81.6    1e-14   
gb|KDD74697.1|  hypothetical protein H632_c1127p1                     78.2    1e-14   
ref|XP_001026475.1|  hypothetical protein TTHERM_00327120             82.8    2e-14   
ref|XP_009829036.1|  hypothetical protein H257_05765                  81.3    2e-14   
emb|CCA23748.1|  serine protease family S09X putative                 78.2    1e-13   
gb|ESS65374.1|  hypothetical protein TCDM_06305                       78.2    2e-13   
ref|XP_001440468.1|  hypothetical protein                             78.2    2e-13   
ref|XP_004031365.1|  hypothetical protein IMG5_141100                 75.5    2e-13   
ref|XP_008351157.1|  PREDICTED: uncharacterized protein LOC103414...  77.4    3e-13   
emb|CCI48668.1|  unnamed protein product                              77.8    4e-13   
emb|CCI48669.1|  unnamed protein product                              77.8    4e-13   
emb|CCI48667.1|  unnamed protein product                              77.8    4e-13   
ref|XP_001453596.1|  hypothetical protein                             77.0    6e-13   
ref|XP_004030596.1|  hypothetical protein IMG5_157330                 73.6    6e-13   
emb|CCA24651.1|  conserved hypothetical protein                       75.9    2e-12   
ref|XP_009032986.1|  hypothetical protein AURANDRAFT_61105            76.3    2e-12   
ref|XP_001031420.1|  hypothetical protein TTHERM_00825520             76.3    3e-12   
ref|XP_009032989.1|  hypothetical protein AURANDRAFT_70671            74.3    1e-11   
ref|XP_001330359.1|  hypothetical protein                             71.2    4e-11   
ref|XP_008611713.1|  hypothetical protein SDRG_07645                  72.4    4e-11   
ref|XP_008896345.1|  hypothetical protein PPTG_04229                  71.6    4e-11   
ref|XP_001322254.1|  hypothetical protein                             72.0    4e-11   
gb|ETK76157.1|  hypothetical protein L915_17362                       71.2    5e-11   
ref|XP_002771424.1|  conserved hypothetical protein                   69.3    6e-11   
gb|ETI35851.1|  hypothetical protein F443_17838                       71.2    6e-11   
ref|XP_001347180.1|  hypothetical protein                             70.9    6e-11   
ref|XP_001423101.1|  hypothetical protein                             70.9    6e-11   
ref|XP_001312212.1|  hypothetical protein                             69.7    6e-11   
ref|XP_001455919.1|  hypothetical protein                             70.9    6e-11   
ref|XP_001316821.1|  hypothetical protein                             69.7    2e-10   
ref|XP_001458019.1|  hypothetical protein                             69.3    2e-10   
ref|XP_001328215.1|  Clan SC, family S9, unassigned serine peptidase  69.3    2e-10   
ref|XP_001457598.1|  hypothetical protein                             68.6    4e-10   
gb|EAR95469.2|  alpha/beta fold hydrolase                             68.6    6e-10   
ref|XP_001015714.1|  hypothetical protein TTHERM_00077730             68.6    6e-10   
ref|XP_004984314.1|  PREDICTED: uncharacterized protein LOC101769...  68.2    6e-10   
ref|XP_004037083.1|  hypothetical protein IMG5_061800                 66.6    1e-09   
emb|CDJ33666.1|  hypothetical protein, conserved                      62.8    2e-09   



>ref|XP_006339420.1| PREDICTED: uncharacterized protein LOC102603324 [Solanum tuberosum]
Length=568

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDVLKCSHYMPLIRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVVEYLR DGNVSLIGL
Sbjct  121  LRAVVEYLRTDGNVSLIGL  139



>ref|XP_009614536.1| PREDICTED: uncharacterized protein LOC104107438 [Nicotiana tomentosiformis]
Length=358

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR DALKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDALKCTHYMPLIRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVVEYLR DGNVSLIGL
Sbjct  121  LRAVVEYLRTDGNVSLIGL  139



>ref|XP_009775161.1| PREDICTED: uncharacterized protein LOC104225093 [Nicotiana sylvestris]
Length=569

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQR+DLEVKNSR D LKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRRDLEVKNSRDDVLKCTHYMPLIRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVVEYLR DGNVSLIGL
Sbjct  121  LRAVVEYLRTDGNVSLIGL  139



>gb|KHN03032.1| Hypothetical protein glysoja_009898 [Glycine soja]
Length=584

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_006600321.1| PREDICTED: uncharacterized protein LOC100807823 isoform X1 [Glycine 
max]
Length=608

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_006600322.1| PREDICTED: uncharacterized protein LOC100807823 isoform X2 [Glycine 
max]
Length=606

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>gb|KHN03427.1| Hypothetical protein glysoja_004453 [Glycine soja]
Length=612

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_006584056.1| PREDICTED: uncharacterized protein LOC100798920 isoform X3 [Glycine 
max]
Length=608

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_003529600.1| PREDICTED: uncharacterized protein LOC100798920 isoform X1 [Glycine 
max]
Length=607

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_006584055.1| PREDICTED: uncharacterized protein LOC100798920 isoform X2 [Glycine 
max]
Length=609

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_004229458.1| PREDICTED: uncharacterized protein LOC101262250 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVVEYLR DGNVSLIGL
Sbjct  121  LRAVVEYLRTDGNVSLIGL  139



>ref|XP_008223032.1| PREDICTED: uncharacterized protein LOC103322864 [Prunus mume]
Length=582

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV+YLR DGNVSLIGL
Sbjct  121  LRTVVDYLRADGNVSLIGL  139



>ref|XP_007222369.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
 gb|EMJ23568.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
Length=576

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV+YLR DGNVSLIGL
Sbjct  121  LRTVVDYLRADGNVSLIGL  139



>gb|KDP40084.1| hypothetical protein JCGZ_02082 [Jatropha curcas]
Length=575

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV+YLRQDGNVSLIGL
Sbjct  121  LRAVVDYLRQDGNVSLIGL  139



>ref|XP_010322788.1| PREDICTED: uncharacterized protein LOC101262250 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVVEYLR DGNVSLIGL
Sbjct  121  LRAVVEYLRTDGNVSLIGL  139



>ref|XP_004508352.1| PREDICTED: uncharacterized protein LOC101492469 isoform X1 [Cicer 
arietinum]
Length=603

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV YLR DGNVSLIGL
Sbjct  121  LTAVVNYLRNDGNVSLIGL  139



>ref|XP_004508353.1| PREDICTED: uncharacterized protein LOC101492469 isoform X2 [Cicer 
arietinum]
Length=601

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV YLR DGNVSLIGL
Sbjct  121  LTAVVNYLRNDGNVSLIGL  139



>gb|KJB72268.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=499

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_007154171.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26165.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=611

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>ref|XP_007154170.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26164.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=610

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVSLIGL
Sbjct  121  LKAVVNYLRDDGNVSLIGL  139



>gb|KJB72266.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72267.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72269.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=584

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_002516800.1| catalytic, putative [Ricinus communis]
 gb|EEF45414.1| catalytic, putative [Ricinus communis]
Length=760

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY PK+DLLD+EFMLKGKWYQRKDLE+KN+RGD L+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPKHDLLDQEFMLKGKWYQRKDLEIKNNRGDVLQCSHYAPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLRQDGNVSLIGL
Sbjct  121  LKAVVDYLRQDGNVSLIGL  139



>ref|XP_009365782.1| PREDICTED: uncharacterized protein LOC103955607 [Pyrus x bretschneideri]
Length=588

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKD+EVKNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFILKGKWYQRKDVEVKNSRGDVLKCSHYTPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV+YLR DGNVSLIGL
Sbjct  121  LKTVVDYLRADGNVSLIGL  139



>ref|XP_007034567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05493.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=587

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P NDLLD+EFMLKGKWYQRKD+EVKNSRGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPDNDLLDQEFMLKGKWYQRKDIEVKNSRGDVLRCSHYVPLVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>emb|CBI26166.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV++LR DGNVSLIGL
Sbjct  121  LKAVVDHLRADGNVSLIGL  139



>ref|XP_010649852.1| PREDICTED: uncharacterized protein LOC100257995 [Vitis vinifera]
Length=599

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV++LR DGNVSLIGL
Sbjct  121  LKAVVDHLRADGNVSLIGL  139



>ref|XP_010512570.1| PREDICTED: uncharacterized protein LOC104788495 [Camelina sativa]
Length=561

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_004296971.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462782.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462783.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
Length=591

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ME LVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKDL+VKNSRGD LKCSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKNDLLDDEFILKGKWYQRKDLDVKNSRGDVLKCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSN+TVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNVTVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV+YLR DGNVSLIGL
Sbjct  121  LRTVVDYLRADGNVSLIGL  139



>ref|XP_008340898.1| PREDICTED: uncharacterized protein LOC103403829 [Malus domestica]
Length=589

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYXPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV+YLR DGNVSLIGL
Sbjct  121  LKTVVDYLRADGNVSLIGL  139



>ref|XP_010466700.1| PREDICTED: uncharacterized protein LOC104746856 [Camelina sativa]
Length=561

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_011090819.1| PREDICTED: uncharacterized protein LOC105171411 isoform X4 [Sesamum 
indicum]
Length=600

 Score =   275 bits (702),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_011090820.1| PREDICTED: uncharacterized protein LOC105171411 isoform X5 [Sesamum 
indicum]
Length=599

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_011090818.1| PREDICTED: uncharacterized protein LOC105171411 isoform X3 [Sesamum 
indicum]
Length=614

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_011090816.1| PREDICTED: uncharacterized protein LOC105171411 isoform X1 [Sesamum 
indicum]
Length=615

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_011090817.1| PREDICTED: uncharacterized protein LOC105171411 isoform X2 [Sesamum 
indicum]
Length=614

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>ref|XP_006299834.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
 gb|EOA32732.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
Length=564

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGNVSLIGL
Sbjct  121  LKAVVEFLRQDGNVSLIGL  139



>ref|XP_011071522.1| PREDICTED: uncharacterized protein LOC105156947 [Sesamum indicum]
Length=605

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEY+PKNDLLD+EFMLKGKWYQRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFMLKGKWYQRKDLEVVNSRGDVLQCSHYMPIVRP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRADGNVSLIGL  139



>gb|KDO74880.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVS+IGL
Sbjct  121  LKAVVDYLRADGNVSMIGL  139



>ref|XP_008390806.1| PREDICTED: uncharacterized protein LOC103453051 [Malus domestica]
Length=588

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP+NDLLD+EF+LKGKWYQRKD+E+KNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPQNDLLDQEFILKGKWYQRKDVELKNSRGDVLKCSHYTPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV+YLR DGNVSLIGL
Sbjct  121  LKTVVDYLRADGNVSLIGL  139



>ref|XP_010488424.1| PREDICTED: uncharacterized protein LOC104766269 isoform X1 [Camelina 
sativa]
 ref|XP_010488425.1| PREDICTED: uncharacterized protein LOC104766269 isoform X2 [Camelina 
sativa]
Length=561

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPQHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKP PCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPFPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>gb|KDO74878.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=588

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVS+IGL
Sbjct  121  LKAVVDYLRADGNVSMIGL  139



>ref|XP_010105703.1| hypothetical protein L484_011315 [Morus notabilis]
 gb|EXC05734.1| hypothetical protein L484_011315 [Morus notabilis]
Length=569

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLL+EEFML+GKWY+R D+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKHDLLEEEFMLRGKWYKRNDVEIKNSRGDVLQCSHYVPIVAP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGQHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+A+VEYLR DGNVSLIGL
Sbjct  121  LRAIVEYLRADGNVSLIGL  139



>ref|XP_006489238.1| PREDICTED: uncharacterized protein LOC102610023 [Citrus sinensis]
Length=588

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVS+IGL
Sbjct  121  LKAVVDYLRADGNVSMIGL  139



>gb|KDO74879.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVS+IGL
Sbjct  121  LKAVVDYLRADGNVSMIGL  139



>emb|CDX85110.1| BnaC07g07960D [Brassica napus]
Length=566

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_009102606.1| PREDICTED: uncharacterized protein LOC103828728 [Brassica rapa]
Length=566

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>emb|CDX77500.1| BnaA07g06380D [Brassica napus]
Length=566

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_010532691.1| PREDICTED: uncharacterized protein LOC104808656 isoform X2 [Tarenaya 
hassleriana]
Length=537

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRTDGNVSLIGL  139



>ref|XP_010532690.1| PREDICTED: uncharacterized protein LOC104808656 isoform X1 [Tarenaya 
hassleriana]
Length=539

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVSLIGL
Sbjct  121  LKAVVDYLRTDGNVSLIGL  139



>ref|XP_009339931.1| PREDICTED: uncharacterized protein LOC103932104 [Pyrus x bretschneideri]
Length=589

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYTPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
              KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   GEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV+YLR DGNVSLIGL
Sbjct  121  LKTVVDYLRADGNVSLIGL  139



>ref|NP_188996.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAT06481.1| At3g23540 [Arabidopsis thaliana]
 gb|AEE76774.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=566

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MDQLVNFIIRPPRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_008458538.1| PREDICTED: uncharacterized protein LOC103497914 isoform X2 [Cucumis 
melo]
Length=595

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>ref|XP_004154381.1| PREDICTED: uncharacterized protein LOC101218432 [Cucumis sativus]
 ref|XP_004166999.1| PREDICTED: uncharacterized protein LOC101225095 [Cucumis sativus]
 gb|KGN46163.1| hypothetical protein Csa_6G061740 [Cucumis sativus]
Length=595

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>ref|XP_004145038.1| PREDICTED: uncharacterized protein LOC101215845 [Cucumis sativus]
Length=586

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>ref|XP_006283452.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16350.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=558

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_008458537.1| PREDICTED: uncharacterized protein LOC103497914 isoform X1 [Cucumis 
melo]
Length=597

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>ref|XP_006283451.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16349.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=556

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_006419777.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
 gb|ESR33017.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
Length=588

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR DGNVS+IGL
Sbjct  121  LKAVVDYLRADGNVSMIGL  139



>gb|KEH32227.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=594

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYDPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV YLR DGNVSLIGL
Sbjct  121  LTAVVNYLRNDGNVSLIGL  139



>ref|XP_006597567.1| PREDICTED: uncharacterized protein LOC100781610 isoform X1 [Glycine 
max]
Length=582

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVSLIGL
Sbjct  121  LRAVVNYLRADGNVSLIGL  139



>ref|XP_006597568.1| PREDICTED: uncharacterized protein LOC100781610 isoform X2 [Glycine 
max]
Length=580

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVSLIGL
Sbjct  121  LRAVVNYLRADGNVSLIGL  139



>ref|XP_010450069.1| PREDICTED: uncharacterized protein LOC104732228 [Camelina sativa]
Length=556

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_007147795.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19789.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=590

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVSLIGL
Sbjct  121  LRAVVNYLRADGNVSLIGL  139



>ref|XP_007147794.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19788.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=591

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVSLIGL
Sbjct  121  LRAVVNYLRADGNVSLIGL  139



>ref|XP_002315536.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
 gb|EEF01707.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
Length=563

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            + KPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAVILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV YLRQDGNVSLIGL
Sbjct  121  LMAVVNYLRQDGNVSLIGL  139



>gb|KHN37552.1| Hypothetical protein glysoja_007255 [Glycine soja]
Length=597

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ME LVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVSLIGL
Sbjct  121  LRAVVNYLRADGNVSLIGL  139



>ref|XP_002883434.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59693.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYD ++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDAEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQDGN+SLIGL
Sbjct  121  LKAVVEFLRQDGNISLIGL  139



>ref|XP_006414745.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
 gb|ESQ56198.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
Length=550

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_006406019.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
 gb|ESQ47472.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
Length=566

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEV NSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEVTNSRGDVLQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVE+LRQD N+SLIGL
Sbjct  121  LKAVVEFLRQDANISLIGL  139



>ref|XP_011014506.1| PREDICTED: uncharacterized protein LOC105118291 [Populus euphratica]
Length=583

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            + KPLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV +LRQDGNVSLIGL
Sbjct  121  LMAVVNHLRQDGNVSLIGL  139



>ref|XP_009107962.1| PREDICTED: uncharacterized protein LOC103833638 [Brassica rapa]
 emb|CDY18119.1| BnaA01g23800D [Brassica napus]
Length=524

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLRQDGNVSLIGL
Sbjct  121  LKAVVEYLRQDGNVSLIGL  139



>gb|ACJ85572.1| unknown [Medicago truncatula]
Length=464

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYGPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV YLR DGNVSLIGL
Sbjct  121  LTAVVNYLRNDGNVSLIGL  139



>emb|CDY09027.1| BnaC01g30640D [Brassica napus]
Length=532

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLRQDGN+SLIGL
Sbjct  121  LKAVVEYLRQDGNISLIGL  139



>ref|XP_010440497.1| PREDICTED: uncharacterized protein LOC104723788 [Camelina sativa]
Length=559

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG +VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGAYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_010435158.1| PREDICTED: uncharacterized protein LOC104719022 isoform X2 [Camelina 
sativa]
Length=557

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_010435157.1| PREDICTED: uncharacterized protein LOC104719022 isoform X1 [Camelina 
sativa]
Length=559

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|NP_193165.7| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
 gb|AEE83410.1| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
Length=558

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNF+IRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFVIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_010669834.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669835.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+E+KNSRGDAL+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEIKNSRGDALQCSHYSPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GK LPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKLLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV+YLR +GNVS+IGL
Sbjct  121  LKAVVDYLRLEGNVSMIGL  139



>ref|XP_002868296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>emb|CDY12752.1| BnaC04g28890D [Brassica napus]
Length=506

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>emb|CDY49406.1| BnaCnng17160D [Brassica napus]
Length=505

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLELP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            + +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   QDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_009139528.1| PREDICTED: uncharacterized protein LOC103863543 isoform X1 [Brassica 
rapa]
Length=550

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_009139529.1| PREDICTED: uncharacterized protein LOC103863543 isoform X2 [Brassica 
rapa]
Length=548

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>ref|XP_010035885.1| PREDICTED: uncharacterized protein LOC104425011 isoform X2 [Eucalyptus 
grandis]
Length=588

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>ref|XP_010035879.1| PREDICTED: uncharacterized protein LOC104425011 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84317.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=590

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRADGNVSLIGL  139



>gb|AES64344.2| alpha/beta hydrolase family protein [Medicago truncatula]
Length=535

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN RGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDNEFMLKGKWFQRKDVEIKNDRGDVLQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR D NVSLIGL
Sbjct  121  LRAVVNYLRTDENVSLIGL  139



>ref|XP_009139530.1| PREDICTED: uncharacterized protein LOC103863543 isoform X3 [Brassica 
rapa]
Length=546

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVVEYLR DGNVSLIGL
Sbjct  121  LKAVVEYLRTDGNVSLIGL  139



>gb|EPS65169.1| hypothetical protein M569_09610, partial [Genlisea aurea]
Length=431

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEYDPK+DLL+ EFMLKG+WY+RKDLEV NSR D L+CSHY+P+I P
Sbjct  1    MEQLINFIIRPPRAEYDPKHDLLESEFMLKGRWYRRKDLEVVNSRSDVLQCSHYMPLILP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E K LPCVIYCHGNSGCR DASEAA+ILLPSN++VFTLDFSGSGLSGGEHVTLGWNE+DD
Sbjct  61   EDKTLPCVIYCHGNSGCRTDASEAAVILLPSNVSVFTLDFSGSGLSGGEHVTLGWNERDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV+YLR DGNVSLIGL
Sbjct  121  LRAVVDYLRADGNVSLIGL  139



>ref|XP_011009032.1| PREDICTED: uncharacterized protein LOC105114237 isoform X3 [Populus 
euphratica]
Length=573

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV+YLRQDGNVSLIGL
Sbjct  121  LMAVVDYLRQDGNVSLIGL  139



>ref|XP_011009029.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
 ref|XP_011009030.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
Length=588

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV+YLRQDGNVSLIGL
Sbjct  121  LMAVVDYLRQDGNVSLIGL  139



>ref|XP_004486108.1| PREDICTED: HBS1-like protein-like [Cicer arietinum]
Length=929

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDYEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR D NVSLIGL
Sbjct  121  LKAVVNYLRADENVSLIGL  139



>ref|XP_009109570.1| PREDICTED: uncharacterized protein LOC103835198 [Brassica rapa]
Length=530

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ C 
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVECS  60

Query  433  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  609
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  610  DLKAVVEYLRQDGNVSLIGL  669
            DLKAVVEYLR D NVSLIGL
Sbjct  121  DLKAVVEYLRTDVNVSLIGL  140



>emb|CDY12069.1| BnaC03g59850D [Brassica napus]
Length=537

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI-IC  429
            MEQLVNFIIRPPRAEY+P+NDLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ + 
Sbjct  1    MEQLVNFIIRPPRAEYNPENDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVELS  60

Query  430  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  609
             + +PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  610  DLKAVVEYLRQDGNVSLIGL  669
            DLKAVVEYLR D NVSLIGL
Sbjct  121  DLKAVVEYLRTDVNVSLIGL  140



>ref|XP_010942429.1| PREDICTED: uncharacterized protein LOC105060435 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVS IGL
Sbjct  121  LRAVVNYLRTDGNVSCIGL  139



>ref|XP_010942428.1| PREDICTED: uncharacterized protein LOC105060435 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV YLR DGNVS IGL
Sbjct  121  LRAVVNYLRTDGNVSCIGL  139



>ref|XP_009393893.1| PREDICTED: uncharacterized protein LOC103979459 [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+Y P++DLL++EFMLKG+W+QRKDLEV N RG  L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYSPQDDLLEQEFMLKGRWFQRKDLEVINGRGKKLQCSHYVPLVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKVLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L AVV+YLR DGNVS IGL
Sbjct  121  LTAVVDYLRTDGNVSCIGL  139



>dbj|BAJ88870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGN+S IGL
Sbjct  121  LKAVVNYLRTDGNISCIGL  139



>emb|CDO98976.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQL+NFIIRPPRAEY+PKNDLLD+EF LK KWYQRKDLEV N RG+ L+CSHY+PI   
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFKLKRKWYQRKDLEVSNCRGEILQCSHYMPIGFS  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRAD SEAAIILLP NITVFTLDFSGSGLSGGE+V+LGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADGSEAAIILLPLNITVFTLDFSGSGLSGGEYVSLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV+YLR DGNVSLIGL
Sbjct  121  LRAVVDYLRADGNVSLIGL  139



>gb|EMS48134.1| hypothetical protein TRIUR3_10822 [Triticum urartu]
Length=366

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGN+S I L
Sbjct  121  LKAVVNYLRTDGNISCIAL  139



>gb|EMT30875.1| hypothetical protein F775_08510 [Aegilops tauschii]
Length=383

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGN+S I L
Sbjct  121  LKAVVNYLRTDGNISCIAL  139



>ref|XP_003557834.1| PREDICTED: uncharacterized protein LOC100838212 [Brachypodium 
distachyon]
Length=573

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVINGQGKKLQCSHYMPVVMP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGKPLPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSG+S GEHVTLGWNE++D
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGISEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGN+S IGL
Sbjct  121  LKAVVNYLRTDGNISCIGL  139



>ref|XP_004984312.1| PREDICTED: uncharacterized protein LOC101769070 isoform X1 [Setaria 
italica]
Length=572

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEVKN  G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVS I L
Sbjct  121  LKAVVNYLRTDGNVSCIAL  139



>emb|CDX90263.1| BnaA08g17210D [Brassica napus]
Length=538

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+P++DLL+ EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+   
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEHEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVEHS  60

Query  433  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  609
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGSNEKD  120

Query  610  DLKAVVEYLRQDGNVSLIGL  669
            DLKAVVEYLR D NVSLIGL
Sbjct  121  DLKAVVEYLRTDVNVSLIGL  140



>ref|NP_001141958.1| hypothetical protein [Zea mays]
 gb|ACF87375.1| unknown [Zea mays]
 tpg|DAA45457.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=564

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVS IGL
Sbjct  121  LKAVVNYLRTDGNVSCIGL  139



>ref|XP_008668219.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA45458.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=566

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVS IGL
Sbjct  121  LKAVVNYLRTDGNVSCIGL  139



>gb|ABF96061.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ26989.1| hypothetical protein OsJ_10915 [Oryza sativa Japonica Group]
Length=574

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV +LR DGN+S IGL
Sbjct  121  LKAVVNHLRTDGNISCIGL  139



>gb|EAY90076.1| hypothetical protein OsI_11646 [Oryza sativa Indica Group]
Length=575

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV +LR DGN+S IGL
Sbjct  121  LKAVVNHLRTDGNISCIGL  139



>dbj|BAB02772.1| unnamed protein product [Arabidopsis thaliana]
Length=599

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 11/147 (7%)
 Frame = +1

Query  253  MEQLVNFIIRPPR--------AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCS  408
            M+QLVNFIIRPPR        AEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CS
Sbjct  1    MDQLVNFIIRPPRFDLLVCCRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCS  60

Query  409  HYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVT  588
            HY+P+  PEGKPLPCVIYCHGN   RAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVT
Sbjct  61   HYMPVERPEGKPLPCVIYCHGN---RADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVT  117

Query  589  LGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            LGWNEKDDLKAVVE+LRQDGN+SLIGL
Sbjct  118  LGWNEKDDLKAVVEFLRQDGNISLIGL  144



>ref|XP_006850814.1| hypothetical protein AMTR_s00025p00118390 [Amborella trichopoda]
 gb|ERN12395.1| hypothetical protein AMTR_s00025p00118390 [Amborella trichopoda]
Length=554

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRAEY+PK DLLDE+F+LKG+W+QRKDLEV NSRG+ LKC+HY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPKTDLLDEKFVLKGQWFQRKDLEVVNSRGNVLKCTHYLPLNIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EG+ LPCVIYCHGNSGCRADASEAAIILLPS ITVF LDF+GSGLS GEHVTLGWNEKDD
Sbjct  61   EGRSLPCVIYCHGNSGCRADASEAAIILLPSYITVFALDFAGSGLSEGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV +LR+DGN+S IGL
Sbjct  121  LKAVVNHLREDGNISCIGL  139



>ref|XP_008797057.1| PREDICTED: uncharacterized protein LOC103712341 [Phoenix dactylifera]
Length=591

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+Y PKNDLLD+EFMLKG+WYQRKDLEV N +G  L+CSHY+P+   
Sbjct  1    MEQLVNFIIRPPRADYSPKNDLLDQEFMLKGRWYQRKDLEVINGQGKKLQCSHYVPLAMT  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLG NEKDD
Sbjct  61   EGKTLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGCNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+AVV +LR DGNVS IGL
Sbjct  121  LRAVVNFLRTDGNVSCIGL  139



>ref|XP_006650100.1| PREDICTED: uncharacterized protein LOC102716943 [Oryza brachyantha]
Length=573

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRAEY P +DLL++EFMLK +W+QRKDLEV N +G  L+CSHY+P + P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKRRWFQRKDLEVVNGQGKKLQCSHYMPTVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVS IGL
Sbjct  121  LKAVVNYLRTDGNVSCIGL  139



>gb|ACF83402.1| unknown [Zea mays]
Length=564

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWN ++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNGRED  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR DGNVS IGL
Sbjct  121  LKAVVNYLRTDGNVSCIGL  139



>ref|XP_010255853.1| PREDICTED: uncharacterized protein LOC104596404 [Nelumbo nucifera]
Length=580

 Score =   245 bits (626),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+Y+P+NDL+D+EF L+G+ + RKDL+V NSRG+ L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYNPQNDLVDQEFTLRGQRFHRKDLQVTNSRGNVLQCSHYMPVVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSYITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR +GNVS IGL
Sbjct  121  LKAVVNYLRSNGNVSCIGL  139



>ref|XP_006595393.1| PREDICTED: uncharacterized protein LOC100815597 [Glycine max]
Length=592

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +1

Query  289  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  468
            +AEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P+GKPLPCVIYCH
Sbjct  8    KAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSPDGKPLPCVIYCH  67

Query  469  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  648
            GNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDDL+AVV YLR DG
Sbjct  68   GNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDDLRAVVNYLRADG  127

Query  649  NVSLIGL  669
            NVSLIGL
Sbjct  128  NVSLIGL  134



>ref|XP_010278880.1| PREDICTED: uncharacterized protein LOC104612914 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            MEQLVNFIIRPPRA+Y+PKNDLL++EF L+G+ + RKDL+V NSRG+ L+CSHY+P + P
Sbjct  1    MEQLVNFIIRPPRADYNPKNDLLEQEFTLQGQRFHRKDLQVTNSRGNVLQCSHYVPDVIP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSCITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAVV YLR +GNVS IGL
Sbjct  121  LKAVVNYLRSEGNVSCIGL  139



>emb|CAB10208.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78471.1| hypothetical protein [Arabidopsis thaliana]
Length=505

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  471
            AEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  PE +PLPCVIYCHG
Sbjct  62   AEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERPEDRPLPCVIYCHG  121

Query  472  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGN  651
            NSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLR DGN
Sbjct  122  NSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRTDGN  181

Query  652  VSLIGL  669
            VSLIGL
Sbjct  182  VSLIGL  187



>ref|XP_002311822.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
 gb|EEE89189.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
Length=591

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  250  CMEQLVNFIIRP--PRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI  423
            CM + + F++      AEY+PK+DLLD+EFMLKGKWYQRKD+EV+NSRGD L+CSHY+PI
Sbjct  3    CMPRKLQFLMTGYLSIAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNSRGDVLQCSHYMPI  62

Query  424  ICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNE  603
            + P+ KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNE
Sbjct  63   VNPQEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNE  122

Query  604  KDDLKAVVEYLRQDGNVSLIGL  669
            KDDL AVV+YLRQDGNVSLIGL
Sbjct  123  KDDLMAVVDYLRQDGNVSLIGL  144



>ref|XP_011090821.1| PREDICTED: uncharacterized protein LOC105171411 isoform X6 [Sesamum 
indicum]
Length=588

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +1

Query  334  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  513
            MLKGKWY RKDLEV NSRGD L+CSHY+PIICPEG  LPCVIYCHGNSGCR DASEAA+I
Sbjct  1    MLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICPEGTKLPCVIYCHGNSGCRTDASEAAVI  60

Query  514  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVV+YLR DGNVSLIGL
Sbjct  61   LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVDYLRADGNVSLIGL  112



>ref|XP_003535011.1| PREDICTED: uncharacterized protein LOC100787162 isoform X1 [Glycine 
max]
 ref|XP_006586805.1| PREDICTED: uncharacterized protein LOC100787162 isoform X2 [Glycine 
max]
Length=496

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG ALKCSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLELKNSRGYALKCSHYLPSRLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKMVVSHLRSNKQVSRIGL  140



>ref|XP_002968666.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
 ref|XP_002989915.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ08928.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ29782.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
Length=330

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 4/143 (3%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE----VKNSRGDALKCSHYIP  420
            ++QLVNF+IRPPRA+Y P +DLL+ EF+LKG  Y+RKDLE    + NSRG  L+CSHY P
Sbjct  2    IDQLVNFVIRPPRADYMPSHDLLEREFVLKGHRYERKDLEASLFITNSRGHVLQCSHYRP  61

Query  421  IICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWN  600
               PE   LPCVIYCHGNSGCRADA+EAAIILLPSNITVFTLDFSGSGLS G++V+LGWN
Sbjct  62   RPLPEDVSLPCVIYCHGNSGCRADANEAAIILLPSNITVFTLDFSGSGLSEGKYVSLGWN  121

Query  601  EKDDLKAVVEYLRQDGNVSLIGL  669
            E DDLKAVV +LR+D  VSL+GL
Sbjct  122  ETDDLKAVVTHLRKDKQVSLVGL  144



>ref|XP_004486396.1| PREDICTED: uncharacterized protein LOC101505258 isoform X1 [Cicer 
arietinum]
 ref|XP_004486397.1| PREDICTED: uncharacterized protein LOC101505258 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L ++EF L GK +QRKDLE+KN+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKEFTLAGKNFQRKDLELKNTRGYTLQCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
               PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   ANIPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR D  VS IGL
Sbjct  122  LKMVVSYLRSDKQVSRIGL  140



>ref|XP_006584122.1| PREDICTED: alpha/beta hydrolase domain-containing protein 13-like 
[Glycine max]
Length=397

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLAGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKMVVSYLRSNKQISCIGL  140



>ref|XP_007147555.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 ref|XP_007147556.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19549.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19550.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
Length=496

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNI+VFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNISVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  122  LKMVVSYLRSKKQVSRIGL  140



>ref|XP_001769780.1| predicted protein [Physcomitrella patens]
 gb|EDQ65342.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE--VKNSRGDALKCSHYIPII  426
            MEQLVNF+IRPPRA Y P  DLL++EF+LKG+ Y RKDL+  V N+RG  L+CSHY P  
Sbjct  2    MEQLVNFVIRPPRASYSPSLDLLEQEFLLKGRKYSRKDLQAGVLNNRGHVLQCSHYTPQS  61

Query  427  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  606
             P+ +PLPCVIYCHGNSGCRADA+EAAIILLP NITVFTLDFSGSGLS G +V+LGWNE 
Sbjct  62   PPDDEPLPCVIYCHGNSGCRADANEAAIILLPCNITVFTLDFSGSGLSDGNYVSLGWNET  121

Query  607  DDLKAVVEYLRQDGNVSLIGL  669
            DDLKAVV +LR D  VS IGL
Sbjct  122  DDLKAVVNHLRTDEKVSRIGL  142



>ref|XP_003594373.1| Abhydrolase domain-containing protein [Medicago truncatula]
Length=500

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  43   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  102

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  103  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  162

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  163  LKMVVSYLRSNKQVSRIGL  181



>gb|KDO78612.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=284

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>gb|AES64624.2| alpha/beta superfamily hydrolase [Medicago truncatula]
Length=516

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  57   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  116

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  117  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  176

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  177  LKMVVSYLRSNKQVSRIGL  195



>ref|XP_003550951.1| PREDICTED: uncharacterized protein LOC100784510 isoform X1 [Glycine 
max]
 ref|XP_006600274.1| PREDICTED: uncharacterized protein LOC100784510 isoform X2 [Glycine 
max]
Length=481

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLTGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKMVVSYLRSNKQISRIGL  140



>gb|KEH32722.1| esterase/lipase domain protein [Medicago truncatula]
Length=401

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>ref|XP_006597639.1| PREDICTED: uncharacterized protein LOC100778204 isoform X8 [Glycine 
max]
Length=350

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +L+ +  VS IGL
Sbjct  122  LKMVVSHLKSNKLVSHIGL  140



>gb|KDO78613.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=381

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>ref|XP_006449959.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63199.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=381

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>gb|KEH32721.1| esterase/lipase domain protein [Medicago truncatula]
Length=440

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>gb|KDO78610.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=391

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>ref|XP_010252925.1| PREDICTED: uncharacterized protein LOC104594357 isoform X2 [Nelumbo 
nucifera]
Length=499

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLELVNGRGHTLQCSHYVPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKDD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISCIGL  140



>ref|XP_008440941.1| PREDICTED: uncharacterized protein LOC103485206 isoform X2 [Cucumis 
melo]
Length=470

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  122  LKVVVTYLRSNKQVSRIGL  140



>ref|XP_004134817.1| PREDICTED: uncharacterized protein LOC101211724 [Cucumis sativus]
 ref|XP_004163397.1| PREDICTED: uncharacterized protein LOC101223332 [Cucumis sativus]
 gb|KGN49009.1| hypothetical protein Csa_6G510270 [Cucumis sativus]
Length=489

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKSFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR + +VS IGL
Sbjct  122  LKVVVTYLRSNKHVSRIGL  140



>ref|XP_008440940.1| PREDICTED: uncharacterized protein LOC103485206 isoform X1 [Cucumis 
melo]
Length=489

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  122  LKVVVTYLRSNKQVSRIGL  140



>gb|KEH32720.1| esterase/lipase domain protein [Medicago truncatula]
Length=502

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>ref|XP_007154081.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26075.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=453

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKMVVSYLRSNKQISHIGL  140



>ref|XP_006597638.1| PREDICTED: uncharacterized protein LOC100778204 isoform X7 [Glycine 
max]
Length=432

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +L+ +  VS IGL
Sbjct  122  LKMVVSHLKSNKLVSHIGL  140



>gb|KJB57898.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=375

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>ref|XP_007154082.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26076.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=499

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKMVVSYLRSNKQISHIGL  140



>ref|XP_009411958.1| PREDICTED: uncharacterized protein LOC103993570 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=528

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFTLAGRKYKRLDLELTNGRGHTLQCSHYVPSFVP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ESTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V +LR +  VS IGL
Sbjct  122  LKTAVSFLRSNKQVSCIGL  140



>gb|KDO78611.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=446

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>ref|XP_004499346.1| PREDICTED: uncharacterized protein LOC101489957 isoform X3 [Cicer 
arietinum]
Length=469

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>gb|KJB57899.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=395

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>ref|XP_006467246.1| PREDICTED: uncharacterized protein LOC102629222 isoform X1 [Citrus 
sinensis]
 ref|XP_006467247.1| PREDICTED: uncharacterized protein LOC102629222 isoform X2 [Citrus 
sinensis]
 ref|XP_006467248.1| PREDICTED: uncharacterized protein LOC102629222 isoform X3 [Citrus 
sinensis]
 gb|KDO78609.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=486

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>ref|XP_006449960.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63200.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=486

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +   S IGL
Sbjct  122  LKVVVSYLRGNKQTSRIGL  140



>ref|XP_004499344.1| PREDICTED: uncharacterized protein LOC101489957 isoform X1 [Cicer 
arietinum]
 ref|XP_004499345.1| PREDICTED: uncharacterized protein LOC101489957 isoform X2 [Cicer 
arietinum]
Length=497

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>ref|XP_003571271.1| PREDICTED: uncharacterized protein LOC100830635 isoform X1 [Brachypodium 
distachyon]
Length=500

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK+VV +LR +  VS IGL
Sbjct  122  LKSVVSFLRTNKQVSRIGL  140



>ref|XP_010233983.1| PREDICTED: uncharacterized protein LOC100830635 isoform X2 [Brachypodium 
distachyon]
Length=496

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK+VV +LR +  VS IGL
Sbjct  122  LKSVVSFLRTNKQVSRIGL  140



>gb|ACN85333.1| unknown [Oryza granulata]
Length=502

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R  ALKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQALKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>ref|XP_001780178.1| predicted protein [Physcomitrella patens]
 gb|EDQ55019.1| predicted protein [Physcomitrella patens]
Length=328

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 114/144 (79%), Gaps = 5/144 (3%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-----VKNSRGDALKCSHYI  417
            MEQLVNF+IRPPRA+Y P  DLL +EF+LK + + RKDL+     +   RG  L+CSHY 
Sbjct  2    MEQLVNFVIRPPRADYSPSFDLLSQEFLLKSRKFTRKDLQAGSLLLSGCRGHVLQCSHYT  61

Query  418  PIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW  597
            P+   E +PLPCVIYCHGNSGCRADA+EAAI+LLP NITVFTLDFSGSGLS G +V+LGW
Sbjct  62   PLSPLEDEPLPCVIYCHGNSGCRADANEAAIVLLPCNITVFTLDFSGSGLSDGNYVSLGW  121

Query  598  NEKDDLKAVVEYLRQDGNVSLIGL  669
            NEKDDLKAVV +LR D  VS IGL
Sbjct  122  NEKDDLKAVVNHLRTDEKVSRIGL  145



>gb|KHN40755.1| Hypothetical protein glysoja_015122 [Glycine soja]
Length=497

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 117/151 (77%), Gaps = 12/151 (8%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE------------VKNSRGDA  396
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE            +KNSRG A
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLEANRLSSFFLTLQLKNSRGYA  61

Query  397  LKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG  576
            LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G
Sbjct  62   LKCSHYLPSRLPEDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDG  121

Query  577  EHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            +HV+LGW+EKDDLK VV +LR +  VS IGL
Sbjct  122  DHVSLGWHEKDDLKMVVSHLRSNKQVSRIGL  152



>ref|XP_003547304.1| PREDICTED: uncharacterized protein LOC100778204 isoform X1 [Glycine 
max]
 ref|XP_006597633.1| PREDICTED: uncharacterized protein LOC100778204 isoform X2 [Glycine 
max]
 ref|XP_006597634.1| PREDICTED: uncharacterized protein LOC100778204 isoform X3 [Glycine 
max]
Length=492

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +L+ +  VS IGL
Sbjct  122  LKMVVSHLKSNKLVSHIGL  140



>ref|XP_007026441.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY29063.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=378

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSEKQISRIGL  140



>gb|KJB57903.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=432

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>ref|XP_010647089.1| PREDICTED: uncharacterized protein LOC100242843 [Vitis vinifera]
Length=457

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  L CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKDFTLAGRTYKRQDLELTNGRGHTLHCSHYVPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKVVVSHLRSNKQISRIGL  140



>gb|KJB57901.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=450

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>ref|XP_006380855.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58652.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=331

 Score =   202 bits (514),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  259  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  438
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  439  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  618
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  619  AVVEYLRQDGNVSLIGL  669
             VV YLR +  +S IGL
Sbjct  124  VVVSYLRSNKQISCIGL  140



>gb|KJB57895.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=473

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>gb|KJB57896.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57900.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57902.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=496

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>ref|XP_003563634.1| PREDICTED: uncharacterized protein LOC100831715 [Brachypodium 
distachyon]
Length=497

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELSNERNQTLKCSHYVPSVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>ref|XP_004965908.1| PREDICTED: uncharacterized protein LOC101783766 [Setaria italica]
Length=502

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS GE+V+LGW+EK D
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V +LR +  VS IGL
Sbjct  122  LKCAVSFLRNNKQVSCIGL  140



>ref|XP_010252924.1| PREDICTED: uncharacterized protein LOC104594357 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-VKNSRGDALKCSHYIPIIC  429
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE + N RG  L+CSHY+P   
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLEQLVNGRGHTLQCSHYVPSPF  61

Query  430  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  609
            PE  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKD
Sbjct  62   PEDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKD  121

Query  610  DLKAVVEYLRQDGNVSLIGL  669
            DLK VV YLR +  +S IGL
Sbjct  122  DLKVVVSYLRSNKQISCIGL  141



>ref|XP_006656239.1| PREDICTED: uncharacterized protein LOC102719683 [Oryza brachyantha]
 gb|ACN85318.1| unknown [Oryza brachyantha]
Length=502

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVVP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>gb|KJB57897.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=524

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSERQISRIGL  140



>gb|AFW70735.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=444

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V  LR +  VS IGL
Sbjct  122  LKCAVSCLRDNKQVSTIGL  140



>ref|XP_008794704.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
 ref|XP_008794705.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
Length=503

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L + EF    + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFSFASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDD
Sbjct  62   ENSTLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ V+ +LR +  VS IGL
Sbjct  122  LRVVISFLRSNKQVSCIGL  140



>ref|XP_008644127.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=471

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V  LR +  VS IGL
Sbjct  122  LKCAVSCLRDNKQVSTIGL  140



>ref|XP_004514787.1| PREDICTED: uncharacterized protein LOC101501041 isoform X2 [Cicer 
arietinum]
Length=468

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>ref|XP_004514786.1| PREDICTED: uncharacterized protein LOC101501041 isoform X1 [Cicer 
arietinum]
Length=495

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  +S IGL
Sbjct  122  LKIVVSHLRSNKQISRIGL  140



>ref|XP_008782969.1| PREDICTED: uncharacterized protein LOC103702352 isoform X2 [Phoenix 
dactylifera]
Length=503

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV +LR +  VS IGL
Sbjct  122  LRIVVSFLRSNKQVSCIGL  140



>ref|XP_006857594.1| hypothetical protein AMTR_s00061p00094480 [Amborella trichopoda]
 gb|ERN19061.1| hypothetical protein AMTR_s00061p00094480 [Amborella trichopoda]
Length=509

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRAEY+P   L + +F + G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWETDFTIAGRKYKRQDLELTNGRGHVLQCSHYVPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+EKDD
Sbjct  62   ENTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFILDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV++LR +  VS IGL
Sbjct  122  LKTVVDFLRGNKQVSCIGL  140



>ref|XP_006380856.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58653.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=429

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  259  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  438
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  439  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  618
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  619  AVVEYLRQDGNVSLIGL  669
             VV YLR +  +S IGL
Sbjct  124  VVVSYLRSNKQISCIGL  140



>gb|ACN85247.1| unknown [Oryza officinalis]
Length=502

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>gb|ACN85219.1| unknown [Oryza punctata]
Length=502

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>ref|NP_001118998.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE83855.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=387

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|NP_001170041.1| hypothetical protein [Zea mays]
 gb|ACN35611.1| unknown [Zea mays]
 gb|AFW70736.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=504

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V  LR +  VS IGL
Sbjct  122  LKCAVSCLRDNKQVSTIGL  140



>ref|XP_008644126.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=502

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V  LR +  VS IGL
Sbjct  122  LKCAVSCLRDNKQVSTIGL  140



>gb|ACN85260.1| unknown [Oryza alta]
Length=502

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>ref|XP_007026439.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007026440.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29061.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29062.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=492

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSEKQISRIGL  140



>gb|KDP29023.1| hypothetical protein JCGZ_16412 [Jatropha curcas]
Length=493

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L + +F L  + Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWERDFTLASRAYKRQDLELTNARGHTLRCSHYVPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK V+ YLR +  +S IGL
Sbjct  122  LKVVISYLRSNQQISCIGL  140



>ref|XP_008782966.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782967.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782968.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
Length=535

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV +LR +  VS IGL
Sbjct  122  LRIVVSFLRSNKQVSCIGL  140



>ref|XP_004951562.1| PREDICTED: uncharacterized protein LOC101776234 [Setaria italica]
Length=503

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EYDP   L D EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYDPDQYLWDTEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILL SNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLSSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V  LR +  VS IGL
Sbjct  122  LKCAVSCLRANKQVSSIGL  140



>gb|ACN85273.1| unknown [Oryza alta]
Length=502

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWETEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +    PCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTAFPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKCVVSFLRNNKEVSCIGL  140



>ref|XP_010530100.1| PREDICTED: uncharacterized protein LOC104806750 isoform X6 [Tarenaya 
hassleriana]
Length=377

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YL+    VS IGL
Sbjct  122  LKIVVSYLKNSKLVSRIGL  140



>ref|XP_006373549.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 ref|XP_006373550.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51346.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51347.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
Length=482

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G+HV+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDHVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_010686591.1| PREDICTED: uncharacterized protein LOC104900779 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=415

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV YLR   +VS IGL
Sbjct  122  LRVVVAYLRSKDHVSHIGL  140



>ref|XP_010942494.1| PREDICTED: uncharacterized protein LOC105060476 [Elaeis guineensis]
Length=503

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   EDTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV +LR +  VS IGL
Sbjct  122  LRIVVSFLRSNKQVSCIGL  140



>ref|NP_001058047.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAD35477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19961.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAG90325.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80956.1| hypothetical protein OsI_23672 [Oryza sativa Indica Group]
 gb|EEE66001.1| hypothetical protein OsJ_21943 [Oryza sativa Japonica Group]
 gb|ACN85169.1| unknown [Oryza nivara]
 gb|ACN85186.1| unknown [Oryza rufipogon]
 gb|ACN85202.1| unknown [Oryza glaberrima]
Length=502

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V +LR +  VS IGL
Sbjct  122  LKCAVSFLRNNKEVSCIGL  140



>ref|XP_010434714.1| PREDICTED: uncharacterized protein LOC104718633 isoform X2 [Camelina 
sativa]
Length=505

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_004984313.1| PREDICTED: uncharacterized protein LOC101769070 isoform X2 [Setaria 
italica]
Length=545

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  334  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  513
            MLKG+W+QRKDLEVKN  G  L+CSHY+P++ PEGK LPCVIYCHGNSGCRADASEAAII
Sbjct  1    MLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIPEGKALPCVIYCHGNSGCRADASEAAII  60

Query  514  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            LLP+NITVFTLDFSGSGLS GEHVTLGWNEK+DLKAVV YLR DGNVS I L
Sbjct  61   LLPTNITVFTLDFSGSGLSEGEHVTLGWNEKEDLKAVVNYLRTDGNVSCIAL  112



>ref|XP_010434713.1| PREDICTED: uncharacterized protein LOC104718633 isoform X1 [Camelina 
sativa]
Length=506

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_006350228.1| PREDICTED: uncharacterized protein LOC102589452 isoform X2 [Solanum 
tuberosum]
Length=490

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  122  LKVVVSYLRSNLKVSRIGL  140



>ref|XP_006350227.1| PREDICTED: uncharacterized protein LOC102589452 isoform X1 [Solanum 
tuberosum]
Length=492

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  VS IGL
Sbjct  122  LKVVVSYLRSNLKVSRIGL  140



>ref|XP_002525239.1| catalytic, putative [Ricinus communis]
 gb|EEF37205.1| catalytic, putative [Ricinus communis]
Length=493

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA Y+P   L + +F L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAAYNPDQYLWERDFTLAGRAYKRLDLELTNIRGHTLQCSHYVPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    +S IGL
Sbjct  122  LKVVVSYLRSSKQISRIGL  140



>ref|XP_010440051.1| PREDICTED: uncharacterized protein LOC104723387 isoform X4 [Camelina 
sativa]
Length=475

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_010440050.1| PREDICTED: uncharacterized protein LOC104723387 isoform X3 [Camelina 
sativa]
Length=500

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_010440048.1| PREDICTED: uncharacterized protein LOC104723387 isoform X1 [Camelina 
sativa]
Length=502

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_010530099.1| PREDICTED: uncharacterized protein LOC104806750 isoform X5 [Tarenaya 
hassleriana]
Length=419

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YL+    VS IGL
Sbjct  122  LKIVVSYLKNSKLVSRIGL  140



>ref|XP_010440049.1| PREDICTED: uncharacterized protein LOC104723387 isoform X2 [Camelina 
sativa]
Length=501

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_011095854.1| PREDICTED: uncharacterized protein LOC105175196 [Sesamum indicum]
Length=471

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++  +NF+IRPPRA+Y+P + L +++F L G+ Y+R+D+E++N RG  L+CSHY+P   P
Sbjct  2    IDLFINFVIRPPRADYNPDHYLWEKDFTLSGRKYKREDVELRNERGHTLRCSHYVPSEFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   DDSPLPCVIYCHGNSGCRADANEAAVVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKND  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LKAV+ YLR +  VS IGL
Sbjct  122  LKAVLSYLRSNAKVSRIGL  140



>ref|XP_008649080.1| PREDICTED: uncharacterized protein LOC103629745 [Zea mays]
Length=501

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK D
Sbjct  62   ENTSLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK  V +LR++  VS IGL
Sbjct  122  LKCAVSFLRKNKQVSCIGL  140



>ref|NP_193448.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAC43443.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83854.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=502

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_009802385.1| PREDICTED: uncharacterized protein LOC104247929 isoform X2 [Nicotiana 
sylvestris]
Length=490

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKVVVSHLRSNLKVSRIGL  140



>ref|XP_010686590.1| PREDICTED: uncharacterized protein LOC104900779 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=439

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV YLR   +VS IGL
Sbjct  122  LRVVVAYLRSKDHVSHIGL  140



>ref|XP_009620526.1| PREDICTED: uncharacterized protein LOC104112345 [Nicotiana tomentosiformis]
Length=490

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKVVVSHLRSNLKVSRIGL  140



>ref|XP_007213932.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15131.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=491

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_007213931.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15130.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=492

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_010686588.1| PREDICTED: uncharacterized protein LOC104900779 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV YLR   +VS IGL
Sbjct  122  LRVVVAYLRSKDHVSHIGL  140



>ref|XP_010530097.1| PREDICTED: uncharacterized protein LOC104806750 isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YL+    VS IGL
Sbjct  122  LKIVVSYLKNSKLVSRIGL  140



>ref|XP_011040087.1| PREDICTED: uncharacterized protein LOC105136438 isoform X3 [Populus 
euphratica]
Length=482

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_010058007.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104445782 
[Eucalyptus grandis]
Length=491

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  LKCSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKDFTLAGRSYKRQDLELTNKRGHTLKCSHYVPAPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNS CRADA+EA +ILLPSNITVFTLDFSGSGLS GE V+LGW+EK+D
Sbjct  62   EETPLPCVIYCHGNSXCRADANEAVVILLPSNITVFTLDFSGSGLSDGEFVSLGWHEKND  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            L+ VV +LR +  +S IGL
Sbjct  122  LQVVVSHLRSNKQISRIGL  140



>ref|XP_011040086.1| PREDICTED: uncharacterized protein LOC105136438 isoform X2 [Populus 
euphratica]
Length=493

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_011040085.1| PREDICTED: uncharacterized protein LOC105136438 isoform X1 [Populus 
euphratica]
Length=497

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>ref|XP_010530091.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530092.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530094.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530095.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YL+    VS IGL
Sbjct  122  LKIVVSYLKNSKLVSRIGL  140



>ref|XP_010449663.1| PREDICTED: uncharacterized protein LOC104731865 isoform X1 [Camelina 
sativa]
Length=500

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKREDLELTNSRGHTLRCSHYVPSSSQ  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   DDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSNQVSRIGL  149



>ref|XP_002870121.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46380.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTECKRQDLELTNSRGHTLRCSHYVPSSSL  70

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  131  LKTVVSYLRNSDQVSRIGL  149



>ref|XP_004293431.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460084.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460085.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460086.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSNKQISRIGL  140



>ref|XP_011460088.1| PREDICTED: uncharacterized protein LOC101309618 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKIVVSYLRSNKQISRIGL  140



>ref|XP_008224685.1| PREDICTED: uncharacterized protein LOC103324410 [Prunus mume]
Length=480

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLHCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR +  +S IGL
Sbjct  122  LKVVVSYLRSNKQISRIGL  140



>gb|KFK32200.1| hypothetical protein AALP_AA6G210300 [Arabis alpina]
Length=493

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 2/139 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L D++F L G   QR+DLE+ NSRG  L+CSHYIP    
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWDKDFTLAGTNCQRQDLELTNSRGHTLRCSHYIP--SS  59

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
               PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  60   HTPPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  119

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR   +VS IGL
Sbjct  120  LKTVVTYLRNSNHVSRIGL  138



>ref|XP_010319209.1| PREDICTED: uncharacterized protein LOC101251464 [Solanum lycopersicum]
Length=490

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGNYVSLGWHEKDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV +LR +  VS IGL
Sbjct  122  LKVVVSHLRSNLKVSRIGL  140



>ref|XP_006414266.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
 gb|ESQ55719.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
Length=505

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F +     +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGSTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  72   EDNPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  131

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    VS IGL
Sbjct  132  LKTVVSYLRNSNQVSRIGL  150



>ref|XP_009108297.1| PREDICTED: uncharacterized protein LOC103833996 isoform X1 [Brassica 
rapa]
Length=500

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F + G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGGTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  433  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  609
            E   PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKD
Sbjct  72   ENTTPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKD  131

Query  610  DLKAVVEYLRQDGNVSLIGL  669
            DLK VV YLR    VS IGL
Sbjct  132  DLKTVVSYLRSSNQVSRIGL  151



>ref|XP_008384339.1| PREDICTED: uncharacterized protein LOC103446950 isoform X3 [Malus 
domestica]
Length=456

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR       IGL
Sbjct  122  LKIVVSYLRSKKQNLRIGL  140



>ref|XP_008384338.1| PREDICTED: uncharacterized protein LOC103446950 isoform X2 [Malus 
domestica]
Length=482

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR       IGL
Sbjct  122  LKIVVSYLRSKKQNLRIGL  140



>ref|XP_008384332.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384333.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384335.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384336.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384337.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
Length=483

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR       IGL
Sbjct  122  LKIVVSYLRSKKQNLRIGL  140



>gb|EYU45603.1| hypothetical protein MIMGU_mgv1a0037051mg, partial [Erythranthe 
guttata]
Length=529

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +1

Query  373  VKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDF  552
            + N RGD L+CSHY+PIICP+G PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDF
Sbjct  1    IVNVRGDTLQCSHYVPIICPDGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDF  60

Query  553  SGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            SGSGLSGGEHVTLGWNEKDDLKAVV+YLR+DGNVSLIGL
Sbjct  61   SGSGLSGGEHVTLGWNEKDDLKAVVDYLREDGNVSLIGL  99



>gb|KHN14394.1| Hypothetical protein glysoja_012432 [Glycine soja]
Length=494

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNS--RGDALKCSHYIPII  426
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE       G  L+CSHY+P  
Sbjct  2    IEQFINFIIRPPRAQYDPDQYLWEKEFTLAGRTYQRQDLEASMDIFLGYTLQCSHYLPSP  61

Query  427  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  606
             PE   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS GEHV+LGW+EK
Sbjct  62   LPEDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGEHVSLGWHEK  121

Query  607  DDLKAVVEYLRQDGNVSLIGL  669
            DDLK VV +L+ +  VS IGL
Sbjct  122  DDLKMVVSHLKSNKLVSHIGL  142



>ref|XP_010911200.1| PREDICTED: uncharacterized protein LOC105037208, partial [Elaeis 
guineensis]
Length=182

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  289  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  468
            RAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   PE   LPCVIYCH
Sbjct  5    RAEYNPDQYLWESEFTLASRKFKRLDLELTNTRGHTLQCSHYVPSDVPENMALPCVIYCH  64

Query  469  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  648
            GNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDDL+ VV +LR + 
Sbjct  65   GNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDDLRIVVSFLRSNK  124

Query  649  NVSLIGL  669
             VS IGL
Sbjct  125  QVSCIGL  131



>gb|EYU27617.1| hypothetical protein MIMGU_mgv1a005188mg [Erythranthe guttata]
Length=494

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DL   N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRKYKREDL--TNERGHTLRCSHYVPSQFP  59

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  60   DDSPLPCVIYCHGNSGCRADANEAAVVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKND  119

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK V+ +LR +  +S IGL
Sbjct  120  LKVVISHLRSNEKISRIGL  138



>ref|XP_009374809.1| PREDICTED: uncharacterized protein LOC103963697 [Pyrus x bretschneideri]
Length=491

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            + Q +NF+IRPPRAEY+P +  L E F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNP-DQYLWESFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  60

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            +   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G +V+LGW+E+ D
Sbjct  61   DDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGNYVSLGWHERYD  120

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR    +S IGL
Sbjct  121  LKIVVSYLRSKKQISRIGL  139



>ref|NP_001172844.1| Os02g0197900 [Oryza sativa Japonica Group]
 dbj|BAH91573.1| Os02g0197900, partial [Oryza sativa Japonica Group]
Length=161

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  +KCSHY+P   P
Sbjct  9    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRKYKRLDLELTNARGLTIKCSHYVPAFIP  68

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNE  603
            E   LPCVIYCHGNSGCRADA+EAA+ILLP+NITVFTLDFSGSGLSGG++V+LGW+E
Sbjct  69   ENTSLPCVIYCHGNSGCRADANEAAVILLPANITVFTLDFSGSGLSGGDYVSLGWHE  125



>ref|XP_002885117.1| hypothetical protein ARALYDRAFT_897893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61376.1| hypothetical protein ARALYDRAFT_897893 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 18/130 (14%)
 Frame = +1

Query  253  MEQLVNFIIRPPR-----------AEYDPKNDLLD--EEFMLKGKWYQRKDLEVKNSRGD  393
            MEQLVNFIIRPPR           AE     +++    EFM++G+WYQRKDLE +     
Sbjct  1    MEQLVNFIIRPPRLSICELTCLCAAELSMTRNMISWKREFMMRGRWYQRKDLERR-----  55

Query  394  ALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSG  573
             L+CSHY+P+  PEGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSG
Sbjct  56   CLQCSHYMPVERPEGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSG  115

Query  574  GEHVTLGWNE  603
            GE+VTLGWNE
Sbjct  116  GEYVTLGWNE  125



>gb|EEC72683.1| hypothetical protein OsI_06247 [Oryza sativa Indica Group]
Length=514

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 19/158 (12%)
 Frame = +1

Query  253  MEQLVNFIIRPPR-----------AEYDPKNDLLDEEFMLKGKWYQRKDLE--------V  375
            +EQ VNF+IRPPR           +EY+P   L + EF+L G+ Y+R DLE        +
Sbjct  2    IEQFVNFVIRPPRYPHSVALVCLWSEYNPDQYLWETEFILAGRKYKRLDLEATLFCLYQL  61

Query  376  KNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFS  555
             N+RG  +KCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLP+NITVFTLDFS
Sbjct  62   TNARGLTIKCSHYVPAFIPENTSLPCVIYCHGNSGCRADANEAAVILLPANITVFTLDFS  121

Query  556  GSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            GSGLSGG++V+LG +EK+DLK VV YLR    VS IGL
Sbjct  122  GSGLSGGDYVSLGCHEKEDLKCVVSYLRTTKQVSCIGL  159



>ref|XP_010530096.1| PREDICTED: uncharacterized protein LOC104806750 isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+H        DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDH-------SDD  114

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YL+    VS IGL
Sbjct  115  LKIVVSYLKNSKLVSRIGL  133



>ref|XP_009802386.1| PREDICTED: uncharacterized protein LOC104247929 isoform X3 [Nicotiana 
sylvestris]
Length=488

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +1

Query  283  PP--RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCV  456
            PP  RA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P+G PLPCV
Sbjct  8    PPLSRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFPDGAPLPCV  67

Query  457  IYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYL  636
            IYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDDLK VV +L
Sbjct  68   IYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDDLKVVVSHL  127

Query  637  RQDGNVSLIGL  669
            R +  VS IGL
Sbjct  128  RSNLKVSRIGL  138



>ref|XP_002438665.1| hypothetical protein SORBIDRAFT_10g023905 [Sorghum bicolor]
 gb|EER90032.1| hypothetical protein SORBIDRAFT_10g023905 [Sorghum bicolor]
Length=501

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  289  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  468
            R EY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + PE   LPCV+YCH
Sbjct  11   RLEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIPENTALPCVVYCH  70

Query  469  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDG  648
            GNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK DLK  V +LR + 
Sbjct  71   GNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQDLKCAVSFLRNNK  130

Query  649  NVSLIGL  669
             VS IGL
Sbjct  131  QVSRIGL  137



>emb|CDP04561.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 19/139 (14%)
 Frame = +1

Query  253  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  432
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE                    
Sbjct  2    IDQFINFVIRPPRAQYNPDQYLWEKDFTLAGRKYKRQDLEA-------------------  42

Query  433  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  612
             G PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  43   NGTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSGGDYVSLGWHEKND  102

Query  613  LKAVVEYLRQDGNVSLIGL  669
            LK VV YLR + N+S IGL
Sbjct  103  LKVVVSYLRSNPNISRIGL  121



>dbj|BAK06433.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  334  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  513
            ML G+ Y+R DLE+ N+RG  LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA++
Sbjct  1    MLAGRRYKRIDLELTNARGHTLKCSHYLPAFVPENIALPCVIYCHGNSGCRADANEAAVV  60

Query  514  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            LLPSNITVFTLDFSGSGLS G++V+LGW+EK+DLK  V +LR +  VS IGL
Sbjct  61   LLPSNITVFTLDFSGSGLSDGDYVSLGWHEKEDLKCAVSFLRTNKQVSRIGL  112



>ref|XP_011090822.1| PREDICTED: uncharacterized protein LOC105171411 isoform X7 [Sesamum 
indicum]
Length=561

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +1

Query  415  IPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLG  594
            +PIICPEG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLG
Sbjct  1    MPIICPEGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLG  60

Query  595  WNEKDDLKAVVEYLRQDGNVSLIGL  669
            WNEKDDLKAVV+YLR DGNVSLIGL
Sbjct  61   WNEKDDLKAVVDYLRADGNVSLIGL  85



>ref|XP_006586806.1| PREDICTED: uncharacterized protein LOC100787162 isoform X3 [Glycine 
max]
Length=481

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = +1

Query  292  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  471
            + Y  +N  L EE      W Q     +KNSRG ALKCSHY+P   PE   LPCVIYCHG
Sbjct  5    STYGKRNSPLQEEHTKGRIWRQ-----LKNSRGYALKCSHYLPSRLPEDISLPCVIYCHG  59

Query  472  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGN  651
            NSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDDLK VV +LR +  
Sbjct  60   NSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDDLKMVVSHLRSNKQ  119

Query  652  VSLIGL  669
            VS IGL
Sbjct  120  VSRIGL  125



>emb|CAN66506.1| hypothetical protein VITISV_035499 [Vitis vinifera]
Length=595

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 103/157 (66%), Gaps = 30/157 (19%)
 Frame = +1

Query  289  RAEYDPKNDLLDEEFMLKGKWYQRKDLE-----------VKNSRGDALKCSHYIPIICPE  435
            +AEY+P   L +++F L G+ Y+R+DLE           + N RG  L CSHY+P   PE
Sbjct  12   QAEYNPDQYLWEKDFTLAGRTYKRQDLEASMDNSYQNFTLTNGRGHTLHCSHYVPSPFPE  71

Query  436  GKPLPCVIYCHGN-------------------SGCRADASEAAIILLPSNITVFTLDFSG  558
              PLPCVIYCHGN                   SGCRADA+EAA+ILLPSNITVFTLDFSG
Sbjct  72   DTPLPCVIYCHGNRVLRMREFRIDSFGSCGQYSGCRADANEAAVILLPSNITVFTLDFSG  131

Query  559  SGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            SGLS G++V+LGW+E+DDLK VV +LR +  +S IGL
Sbjct  132  SGLSDGDYVSLGWHERDDLKVVVSHLRSNKQISRIGL  168



>ref|XP_010096514.1| hypothetical protein L484_017966 [Morus notabilis]
 gb|EXB64634.1| hypothetical protein L484_017966 [Morus notabilis]
Length=671

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  370  EVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLD  549
            E++NSRG  L+CSHY+P   PE  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLD
Sbjct  222  ELRNSRGHVLRCSHYVPSQFPEDSPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLD  281

Query  550  FSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            FSGSGLS G++V+LGW+EKDDLK V+ +LR +  +S IGL
Sbjct  282  FSGSGLSDGDYVSLGWHEKDDLKTVISHLRSNKQISRIGL  321



>gb|KHN40219.1| Hypothetical protein glysoja_038414 [Glycine soja]
Length=471

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  370  EVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLD  549
            ++KN+RG  LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLD
Sbjct  33   QLKNTRGYTLKCSHYLPSPFPEDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLD  92

Query  550  FSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            FSGSGLS G++V+LGW+EKDDLK VV YLR +  +S IGL
Sbjct  93   FSGSGLSDGDYVSLGWHEKDDLKMVVSYLRSNKQISCIGL  132



>ref|XP_002451724.1| hypothetical protein SORBIDRAFT_04g006660 [Sorghum bicolor]
 gb|EES04700.1| hypothetical protein SORBIDRAFT_04g006660 [Sorghum bicolor]
Length=491

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  349  WYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSN  528
            W+Q   + + N+RG  LKCSHY+P   PE   LPCV+YCHGNSGCRADA+EAA+ILLPSN
Sbjct  22   WFQIVCMMLTNARGYILKCSHYVPAFIPENTALPCVVYCHGNSGCRADANEAAVILLPSN  81

Query  529  ITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            ITVFTLDFSGSGLSGG++V+LGW+EK+DLK  V  LR +  VS IGL
Sbjct  82   ITVFTLDFSGSGLSGGDYVSLGWHEKEDLKCAVSCLRDNKQVSTIGL  128



>ref|XP_006283654.1| hypothetical protein CARUB_v10004712mg [Capsella rubella]
 gb|EOA16552.1| hypothetical protein CARUB_v10004712mg [Capsella rubella]
Length=480

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  370  EVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLD  549
            ++ NSRG  L+CSHYIP    E  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLD
Sbjct  26   QLTNSRGHTLRCSHYIPSSSQEDTPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLD  85

Query  550  FSGSGLSGGEHVTLGWNEKDDLKAVVEYLRQDGNVSLIGL  669
            FSGSGLS G++V+LGW+EKDDLK VV YLR    VS IGL
Sbjct  86   FSGSGLSDGDYVSLGWHEKDDLKTVVSYLRNSNQVSRIGL  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780