BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020H03

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589162.1|  PREDICTED: EH domain-containing protein 1-li...    335   8e-109   Nicotiana tomentosiformis
emb|CDP13787.1|  unnamed protein product                                328   3e-106   Coffea canephora [robusta coffee]
ref|XP_011095452.1|  PREDICTED: EH domain-containing protein 1-like     328   4e-106   Sesamum indicum [beniseed]
ref|XP_009598339.1|  PREDICTED: EH domain-containing protein 1-li...    328   6e-106   Nicotiana tomentosiformis
ref|XP_009598337.1|  PREDICTED: EH domain-containing protein 1-li...    327   8e-106   Nicotiana tomentosiformis
ref|XP_009776640.1|  PREDICTED: EH domain-containing protein 1 is...    326   3e-105   Nicotiana sylvestris
ref|XP_009776638.1|  PREDICTED: EH domain-containing protein 1 is...    326   3e-105   Nicotiana sylvestris
ref|XP_009598338.1|  PREDICTED: EH domain-containing protein 1-li...    323   3e-104   Nicotiana tomentosiformis
ref|XP_009776639.1|  PREDICTED: EH domain-containing protein 1 is...    322   1e-103   Nicotiana sylvestris
ref|XP_010324305.1|  PREDICTED: EH domain-containing protein 1-li...    316   2e-101   Solanum lycopersicum
ref|XP_006346193.1|  PREDICTED: EH domain-containing protein 1-like     315   4e-101   Solanum tuberosum [potatoes]
ref|XP_004294399.1|  PREDICTED: EH domain-containing protein 1 is...    315   5e-101   Fragaria vesca subsp. vesca
gb|EYU27376.1|  hypothetical protein MIMGU_mgv1a004087mg                313   2e-100   Erythranthe guttata [common monkey flower]
gb|KDO62120.1|  hypothetical protein CISIN_1g009050mg                   308   2e-100   Citrus sinensis [apfelsine]
ref|XP_007213895.1|  hypothetical protein PRUPE_ppa003834mg             313   2e-100   Prunus persica
ref|XP_008226997.1|  PREDICTED: EH domain-containing protein 1          313   4e-100   Prunus mume [ume]
ref|XP_010096102.1|  EH domain-containing protein 1                     311   1e-99    
ref|XP_011461076.1|  PREDICTED: EH domain-containing protein 1 is...    311   1e-99    Fragaria vesca subsp. vesca
ref|XP_009334157.1|  PREDICTED: EH domain-containing protein 1-like     311   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_008359253.1|  PREDICTED: EH domain-containing protein 1-like     311   2e-99    
gb|EPS68571.1|  hypothetical protein M569_06192                         308   1e-98    Genlisea aurea
ref|XP_010324304.1|  PREDICTED: EH domain-containing protein 1-li...    309   2e-98    Solanum lycopersicum
ref|XP_002298819.2|  hypothetical protein POPTR_0001s36630g             307   2e-98    
ref|XP_002277794.1|  PREDICTED: EH domain-containing protein 1          308   2e-98    Vitis vinifera
ref|XP_006475006.1|  PREDICTED: EH domain-containing protein 3-like     308   3e-98    Citrus sinensis [apfelsine]
gb|KDO62119.1|  hypothetical protein CISIN_1g009050mg                   308   3e-98    Citrus sinensis [apfelsine]
gb|KCW70228.1|  hypothetical protein EUGRSUZ_F03500                     305   4e-98    Eucalyptus grandis [rose gum]
ref|XP_006452452.1|  hypothetical protein CICLE_v10007883mg             308   6e-98    
gb|KDP39189.1|  hypothetical protein JCGZ_00946                         306   9e-98    Jatropha curcas
ref|XP_002264320.1|  PREDICTED: EH domain-containing protein 3-like     306   2e-97    Vitis vinifera
ref|XP_009348303.1|  PREDICTED: EH domain-containing protein 1-like     305   3e-97    Pyrus x bretschneideri [bai li]
ref|XP_011046717.1|  PREDICTED: EH domain-containing protein 3          305   3e-97    Populus euphratica
ref|XP_010063047.1|  PREDICTED: EH domain-containing protein 1          304   1e-96    Eucalyptus grandis [rose gum]
ref|XP_009361045.1|  PREDICTED: EH domain-containing protein 1-like     303   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_007020711.1|  EPS15 domain 1                                     303   1e-96    
gb|KCW70227.1|  hypothetical protein EUGRSUZ_F03500                     305   3e-96    Eucalyptus grandis [rose gum]
ref|XP_010313928.1|  PREDICTED: EH domain-containing protein 3-like     300   5e-95    Solanum lycopersicum
ref|XP_006344871.1|  PREDICTED: EH domain-containing protein 1-like     298   1e-94    Solanum tuberosum [potatoes]
ref|XP_010544277.1|  PREDICTED: EH domain-containing protein 1          298   2e-94    Tarenaya hassleriana [spider flower]
ref|XP_010270065.1|  PREDICTED: EH domain-containing protein 1          298   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_002531194.1|  EH-domain-containing protein, putative             298   3e-94    Ricinus communis
ref|XP_007026229.1|  EPS15 domain 2 isoform 5                           293   1e-92    
gb|KEH28435.1|  calcium-binding EF hand protein                         289   2e-92    Medicago truncatula
ref|XP_007026226.1|  EPS15 domain 2 isoform 2                           292   3e-92    
gb|ACJ85603.1|  unknown                                                 289   3e-92    Medicago truncatula
ref|XP_006829517.1|  hypothetical protein AMTR_s00074p00139810          292   4e-92    Amborella trichopoda
ref|XP_007026225.1|  EPS15 domain 2 isoform 1                           292   4e-92    
ref|XP_007026228.1|  EPS15 domain 2 isoform 4                           292   4e-92    
ref|XP_003519595.1|  PREDICTED: EH domain-containing protein 1-like     291   6e-92    Glycine max [soybeans]
ref|XP_007026227.1|  EPS15 domain 2 isoform 3                           292   8e-92    
gb|KHN38249.1|  EH domain-containing protein 1                          290   2e-91    Glycine soja [wild soybean]
ref|XP_004149345.1|  PREDICTED: EH domain-containing protein 1-like     290   3e-91    Cucumis sativus [cucumbers]
gb|KGN56098.1|  hypothetical protein Csa_3G073890                       290   4e-91    Cucumis sativus [cucumbers]
gb|AFK42442.1|  unknown                                                 289   5e-91    Medicago truncatula
ref|XP_003617631.1|  EH-domain-containing protein                       289   6e-91    Medicago truncatula
ref|XP_009334827.1|  PREDICTED: EH domain-containing protein 1-li...    288   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_010665753.1|  PREDICTED: EH domain-containing protein 1-like     288   2e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP20684.1|  hypothetical protein JCGZ_21155                         287   3e-90    Jatropha curcas
ref|XP_006406401.1|  hypothetical protein EUTSA_v10020459mg             287   5e-90    Eutrema salsugineum [saltwater cress]
ref|XP_009352442.1|  PREDICTED: EH domain-containing protein 1-like     286   6e-90    Pyrus x bretschneideri [bai li]
ref|XP_008449138.1|  PREDICTED: EH domain-containing protein 1          286   7e-90    Cucumis melo [Oriental melon]
ref|NP_566657.1|  EPS15 homology domain 1 protein                       285   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491428.1|  PREDICTED: EH domain-containing protein 3-like     285   3e-89    Cicer arietinum [garbanzo]
gb|KJB13767.1|  hypothetical protein B456_002G093200                    284   3e-89    Gossypium raimondii
ref|XP_004966283.1|  PREDICTED: EH domain-containing protein 1-like     285   3e-89    Setaria italica
gb|KJB13765.1|  hypothetical protein B456_002G093200                    285   4e-89    Gossypium raimondii
ref|XP_002437485.1|  hypothetical protein SORBIDRAFT_10g027960          284   4e-89    Sorghum bicolor [broomcorn]
ref|XP_010252585.1|  PREDICTED: EH domain-containing protein 1-li...    283   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_002885363.1|  calcium-binding EF hand family protein             284   7e-89    
ref|XP_009334825.1|  PREDICTED: EH domain-containing protein 1-li...    285   7e-89    Pyrus x bretschneideri [bai li]
ref|XP_008644157.1|  PREDICTED: uncharacterized protein LOC100384...    283   7e-89    
ref|XP_009334826.1|  PREDICTED: EH domain-containing protein 1-li...    284   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_010466211.1|  PREDICTED: EH domain-containing protein 1-like     283   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_007142331.1|  hypothetical protein PHAVU_008G271300g             283   1e-88    Phaseolus vulgaris [French bean]
emb|CBI35707.3|  unnamed protein product                                283   2e-88    Vitis vinifera
gb|KJB69209.1|  hypothetical protein B456_011G010900                    282   3e-88    Gossypium raimondii
gb|KJB69208.1|  hypothetical protein B456_011G010900                    281   6e-88    Gossypium raimondii
ref|XP_009111201.1|  PREDICTED: EH domain-containing protein 1-li...    281   7e-88    Brassica rapa
ref|XP_009145651.1|  PREDICTED: EH domain-containing protein 1 is...    281   9e-88    
ref|XP_010052900.1|  PREDICTED: EH domain-containing protein 1-li...    278   9e-88    
ref|XP_010508763.1|  PREDICTED: EH domain-containing protein 1-like     281   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010487999.1|  PREDICTED: EH domain-containing protein 1-like     281   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009603507.1|  PREDICTED: EH domain-containing protein 1-li...    280   2e-87    Nicotiana tomentosiformis
ref|NP_001058410.1|  Os06g0687800                                       280   3e-87    
gb|EAZ02155.1|  hypothetical protein OsI_24244                          280   3e-87    Oryza sativa Indica Group [Indian rice]
gb|EYU27374.1|  hypothetical protein MIMGU_mgv1a026674mg                275   3e-87    Erythranthe guttata [common monkey flower]
ref|XP_008805597.1|  PREDICTED: EH domain-containing protein 1-li...    279   5e-87    
ref|XP_008805596.1|  PREDICTED: EH domain-containing protein 1-li...    278   7e-87    Phoenix dactylifera
ref|XP_010052899.1|  PREDICTED: EH domain-containing protein 1-li...    278   1e-86    Eucalyptus grandis [rose gum]
gb|KJB13766.1|  hypothetical protein B456_002G093200                    278   1e-86    Gossypium raimondii
gb|KHG30640.1|  EH domain-containing 1                                  278   1e-86    Gossypium arboreum [tree cotton]
ref|XP_008805595.1|  PREDICTED: EH domain-containing protein 1-li...    277   2e-86    Phoenix dactylifera
gb|KHN03510.1|  EH domain-containing protein 1                          277   2e-86    Glycine soja [wild soybean]
ref|XP_003550477.1|  PREDICTED: EH domain-containing protein 1-like     277   2e-86    Glycine max [soybeans]
ref|XP_008799457.1|  PREDICTED: EH domain-containing protein 1-like     277   2e-86    Phoenix dactylifera
ref|XP_006296699.1|  hypothetical protein CARUB_v10013398mg             277   3e-86    Capsella rubella
gb|KFK39351.1|  hypothetical protein AALP_AA3G233100                    276   3e-86    Arabis alpina [alpine rockcress]
ref|XP_003529656.1|  PREDICTED: EH domain-containing protein 1-like     276   4e-86    Glycine max [soybeans]
ref|XP_009145649.1|  PREDICTED: EH domain-containing protein 1 is...    276   5e-86    
ref|XP_009770782.1|  PREDICTED: EH domain-containing protein 1-li...    276   6e-86    Nicotiana sylvestris
ref|XP_009770776.1|  PREDICTED: EH domain-containing protein 1-li...    276   6e-86    Nicotiana sylvestris
ref|XP_006467361.1|  PREDICTED: EH domain-containing protein 1-like     274   3e-85    Citrus sinensis [apfelsine]
ref|XP_006449830.1|  hypothetical protein CICLE_v10014814mg             274   3e-85    Citrus clementina [clementine]
ref|XP_006657273.1|  PREDICTED: EH domain-containing protein 1-like     274   4e-85    Oryza brachyantha
ref|XP_003563453.1|  PREDICTED: EH domain-containing protein 1-like     273   7e-85    Brachypodium distachyon [annual false brome]
ref|XP_009145650.1|  PREDICTED: EH domain-containing protein 1 is...    273   8e-85    Brassica rapa
gb|KDO78396.1|  hypothetical protein CISIN_1g008954mg                   273   9e-85    Citrus sinensis [apfelsine]
ref|XP_011097835.1|  PREDICTED: EH domain-containing protein 1-li...    272   1e-84    Sesamum indicum [beniseed]
ref|XP_010913401.1|  PREDICTED: EH domain-containing protein 1-like     273   1e-84    Elaeis guineensis
ref|XP_009398680.1|  PREDICTED: EH domain-containing protein 1-like     272   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211540.1|  hypothetical protein PRUPE_ppa003972mg             272   2e-84    Prunus persica
ref|XP_006352527.1|  PREDICTED: EH domain-containing protein 1-li...    272   3e-84    
ref|XP_009393691.1|  PREDICTED: EH domain-containing protein 1-like     271   6e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928404.1|  PREDICTED: EH domain-containing protein 1-like     270   1e-83    Elaeis guineensis
ref|XP_011097837.1|  PREDICTED: EH domain-containing protein 1-li...    269   2e-83    
gb|EMT05303.1|  EH domain-containing protein 1                          269   2e-83    
ref|XP_004951833.1|  PREDICTED: EH domain-containing protein 1-like     271   3e-83    Setaria italica
ref|NP_001045954.1|  Os02g0158100                                       269   3e-83    
ref|XP_011096032.1|  PREDICTED: EH domain-containing protein 1-like     269   4e-83    
ref|XP_008224739.1|  PREDICTED: EH domain-containing protein 1-like     269   4e-83    Prunus mume [ume]
ref|XP_009145648.1|  PREDICTED: EH domain-containing protein 1 is...    269   4e-83    Brassica rapa
ref|XP_009779278.1|  PREDICTED: EH domain-containing protein 1-li...    268   5e-83    Nicotiana sylvestris
gb|EMS68080.1|  EH domain-containing protein 1                          268   5e-83    Triticum urartu
gb|KHN28769.1|  EH domain-containing protein 1                          275   5e-83    Glycine soja [wild soybean]
ref|XP_002518408.1|  EH-domain-containing protein, putative             267   1e-82    Ricinus communis
ref|XP_010675784.1|  PREDICTED: EH domain-containing protein 1-like     267   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007154001.1|  hypothetical protein PHAVU_003G082600g             263   2e-82    Phaseolus vulgaris [French bean]
ref|XP_007153999.1|  hypothetical protein PHAVU_003G082600g             263   3e-82    Phaseolus vulgaris [French bean]
ref|XP_006586764.1|  PREDICTED: EH domain-containing protein 1-like     266   3e-82    Glycine max [soybeans]
ref|XP_006646902.1|  PREDICTED: EH domain-containing protein 1-like     266   4e-82    Oryza brachyantha
ref|XP_002453335.1|  hypothetical protein SORBIDRAFT_04g004020          266   6e-82    Sorghum bicolor [broomcorn]
ref|XP_006602183.1|  PREDICTED: EH domain-containing protein 1-like     265   7e-82    Glycine max [soybeans]
ref|XP_006352528.1|  PREDICTED: EH domain-containing protein 1-li...    265   8e-82    
dbj|BAJ95881.1|  predicted protein                                      265   9e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB02809.1|  unnamed protein product                                265   9e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500109.1|  PREDICTED: EH domain-containing protein 1-like     265   1e-81    Cicer arietinum [garbanzo]
gb|KEH33921.1|  EPS15-like domain protein                               265   2e-81    Medicago truncatula
ref|XP_010327191.1|  PREDICTED: EH domain-containing protein 1-like     264   2e-81    
gb|EYU33672.1|  hypothetical protein MIMGU_mgv1a004199mg                264   2e-81    Erythranthe guttata [common monkey flower]
ref|XP_003574764.1|  PREDICTED: EH domain-containing protein 1-like     264   3e-81    Brachypodium distachyon [annual false brome]
dbj|BAJ86819.1|  predicted protein                                      264   3e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003547274.1|  PREDICTED: EH domain-containing protein 1-like     262   1e-80    Glycine max [soybeans]
gb|EMT01492.1|  EH domain-containing protein 1                          263   1e-80    
ref|XP_010538746.1|  PREDICTED: EH domain-containing protein 1 is...    262   1e-80    Tarenaya hassleriana [spider flower]
ref|XP_007154000.1|  hypothetical protein PHAVU_003G082600g             262   1e-80    Phaseolus vulgaris [French bean]
gb|KHN40844.1|  EH domain-containing protein 1                          261   2e-80    Glycine soja [wild soybean]
ref|XP_004486203.1|  PREDICTED: EH domain-containing protein 1-like     261   3e-80    Cicer arietinum [garbanzo]
ref|XP_010455719.1|  PREDICTED: EH domain-containing protein 1-li...    261   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_006396726.1|  hypothetical protein EUTSA_v10028561mg             261   4e-80    Eutrema salsugineum [saltwater cress]
ref|XP_009390977.1|  PREDICTED: EH domain-containing protein 1-li...    261   4e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538744.1|  PREDICTED: EH domain-containing protein 1 is...    260   6e-80    Tarenaya hassleriana [spider flower]
ref|NP_001266688.1|  EH-domain-containing protein 1                     260   7e-80    
ref|NP_001140588.1|  uncharacterized protein LOC100272658               260   7e-80    Zea mays [maize]
ref|XP_010433120.1|  PREDICTED: EH domain-containing protein 1-li...    260   8e-80    Camelina sativa [gold-of-pleasure]
gb|KJB45560.1|  hypothetical protein B456_007G312100                    259   9e-80    Gossypium raimondii
ref|XP_009114593.1|  PREDICTED: EH domain-containing protein 1 is...    260   9e-80    
ref|XP_002874791.1|  calcium-binding EF hand family protein             260   1e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_010433113.1|  PREDICTED: EH domain-containing protein 1-li...    259   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_004293342.1|  PREDICTED: EH domain-containing protein 1-like     259   2e-79    Fragaria vesca subsp. vesca
ref|XP_006352380.1|  PREDICTED: EH domain-containing protein 1-like     259   2e-79    Solanum tuberosum [potatoes]
ref|XP_006287437.1|  hypothetical protein CARUB_v10000641mg             259   3e-79    Capsella rubella
emb|CDX94536.1|  BnaC09g23000D                                          259   3e-79    
ref|XP_010455720.1|  PREDICTED: EH domain-containing protein 1-li...    258   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_004507655.1|  PREDICTED: EH domain-containing protein 1-li...    258   5e-79    Cicer arietinum [garbanzo]
ref|XP_009390978.1|  PREDICTED: EH domain-containing protein 1-li...    258   8e-79    
ref|NP_974517.1|  EPS15 homology domain 2 protein                       258   8e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507654.1|  PREDICTED: EH domain-containing protein 1-li...    258   8e-79    
ref|XP_004145425.1|  PREDICTED: EH domain-containing protein 1-like     257   9e-79    
ref|XP_007145728.1|  hypothetical protein PHAVU_007G262900g             257   1e-78    Phaseolus vulgaris [French bean]
emb|CDY16689.1|  BnaA09g20670D                                          257   2e-78    Brassica napus [oilseed rape]
ref|NP_567299.2|  EPS15 homology domain 2 protein                       257   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157728.1|  PREDICTED: EH domain-containing protein 1-like     256   4e-78    
ref|XP_011000650.1|  PREDICTED: EH domain-containing protein 1-like     255   5e-78    Populus euphratica
ref|XP_009114592.1|  PREDICTED: EH domain-containing protein 1 is...    256   5e-78    Brassica rapa
ref|XP_007147670.1|  hypothetical protein PHAVU_006G144500g             254   9e-78    Phaseolus vulgaris [French bean]
gb|KFK32206.1|  hypothetical protein AALP_AA6G211000                    254   1e-77    Arabis alpina [alpine rockcress]
ref|XP_003594167.1|  EH-domain-containing protein                       254   2e-77    Medicago truncatula
ref|XP_004250246.1|  PREDICTED: EH domain-containing protein 1-like     254   3e-77    Solanum lycopersicum
ref|XP_008458980.1|  PREDICTED: EH domain-containing protein 1          253   3e-77    Cucumis melo [Oriental melon]
ref|XP_009769722.1|  PREDICTED: EH domain-containing protein 1-like     253   3e-77    Nicotiana sylvestris
ref|XP_009626939.1|  PREDICTED: EH domain-containing protein 1-like     253   4e-77    Nicotiana tomentosiformis
ref|XP_009401415.1|  PREDICTED: EH domain-containing protein 1-like     253   4e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390979.1|  PREDICTED: EH domain-containing protein 1-li...    251   1e-76    
ref|XP_006652990.1|  PREDICTED: EH domain-containing protein 1-like     251   2e-76    Oryza brachyantha
ref|XP_003610495.1|  EH-domain-containing protein                       251   2e-76    Medicago truncatula
emb|CAN67909.1|  hypothetical protein VITISV_034695                     249   8e-76    Vitis vinifera
ref|XP_008384122.1|  PREDICTED: EH domain-containing protein 1-like     248   3e-75    
ref|XP_002316591.2|  calcium-binding EF hand family protein             247   4e-75    
ref|XP_003579456.1|  PREDICTED: EH domain-containing protein 1-like     246   2e-74    
gb|AEV41109.1|  putative EH-domain-containing protein 1                 246   2e-74    Oryza officinalis
ref|XP_009357509.1|  PREDICTED: EH domain-containing protein 1-li...    246   2e-74    Pyrus x bretschneideri [bai li]
gb|AEV40966.1|  putative EH-domain-containing protein 1                 245   4e-74    Oryza punctata
gb|AEV41063.1|  putative EH-domain-containing protein 1                 245   6e-74    Oryza minuta
emb|CDY29816.1|  BnaC05g31740D                                          244   1e-73    Brassica napus [oilseed rape]
ref|NP_001054202.1|  Os04g0669300                                       243   3e-73    
gb|AEV41016.1|  putative EH-domain-containing protein 1                 242   9e-73    Oryza minuta
emb|CDY25408.1|  BnaA05g18760D                                          241   2e-72    Brassica napus [oilseed rape]
ref|XP_010090952.1|  EH domain-containing protein 1                     239   6e-72    
ref|XP_002447292.1|  hypothetical protein SORBIDRAFT_06g032210          239   1e-71    Sorghum bicolor [broomcorn]
ref|XP_001772546.1|  predicted protein                                  237   5e-71    
ref|NP_001167939.1|  uncharacterized protein LOC100381653               234   1e-69    Zea mays [maize]
gb|EYU27756.1|  hypothetical protein MIMGU_mgv1a004743mg                231   4e-69    Erythranthe guttata [common monkey flower]
tpg|DAA35457.1|  TPA: hypothetical protein ZEAMMB73_021494              231   7e-69    
emb|CDY50093.1|  BnaC01g32680D                                          231   8e-69    Brassica napus [oilseed rape]
emb|CDO98110.1|  unnamed protein product                                231   1e-68    Coffea canephora [robusta coffee]
emb|CDY50090.1|  BnaC01g32650D                                          231   2e-68    Brassica napus [oilseed rape]
emb|CDP04464.1|  unnamed protein product                                228   2e-67    Coffea canephora [robusta coffee]
ref|XP_002970092.1|  hypothetical protein SELMODRAFT_92582              227   3e-67    Selaginella moellendorffii
gb|EPS69769.1|  hypothetical protein M569_04997                         217   1e-64    Genlisea aurea
ref|XP_007145730.1|  hypothetical protein PHAVU_007G263100g             219   2e-64    Phaseolus vulgaris [French bean]
ref|XP_009402015.1|  PREDICTED: EH domain-containing protein 1-like     218   6e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002974220.1|  hypothetical protein SELMODRAFT_414547             217   3e-63    Selaginella moellendorffii
ref|XP_008363998.1|  PREDICTED: EH domain-containing protein 1-like     209   5e-63    
gb|AAD48968.1|AF147263_10  contains similarity to Pfam family PF0...    212   1e-61    Arabidopsis thaliana [mouse-ear cress]
emb|CAJ86083.1|  H0818H01.5                                             211   5e-61    Oryza sativa [red rice]
gb|EMT24958.1|  EH domain-containing protein 1                          207   3e-60    
ref|XP_002985697.1|  hypothetical protein SELMODRAFT_122705             209   3e-60    
ref|XP_002985283.1|  hypothetical protein SELMODRAFT_121714             209   4e-60    
ref|XP_009589164.1|  PREDICTED: EH domain-containing protein 1-li...    197   1e-56    Nicotiana tomentosiformis
ref|XP_001784382.1|  predicted protein                                  197   6e-56    
ref|XP_009598340.1|  PREDICTED: EH domain-containing protein 1-li...    191   5e-54    Nicotiana tomentosiformis
ref|XP_009776641.1|  PREDICTED: EH domain-containing protein 1 is...    189   2e-53    Nicotiana sylvestris
ref|XP_008371039.1|  PREDICTED: EH domain-containing protein 3-li...    181   4e-53    
gb|KHG22957.1|  EH domain-containing 1                                  181   3e-50    Gossypium arboreum [tree cotton]
gb|AIE88276.1|  hypothetical protein OG_BBa0063K01.7                    174   9e-48    Oryza glaberrima
ref|XP_009111206.1|  PREDICTED: EH domain-containing protein 1-li...    164   6e-44    Brassica rapa
ref|XP_008370549.1|  PREDICTED: EH domain-containing protein 1-like     164   8e-44    
ref|XP_006585913.1|  PREDICTED: actin cytoskeleton-regulatory com...    152   1e-41    
ref|XP_005851211.1|  hypothetical protein CHLNCDRAFT_33853              157   5e-41    Chlorella variabilis
ref|XP_007515068.1|  unnamed protein product                            157   5e-41    Bathycoccus prasinos
ref|XP_006585914.1|  PREDICTED: actin cytoskeleton-regulatory com...    148   5e-40    
ref|XP_006585916.1|  PREDICTED: actin cytoskeleton-regulatory com...    148   5e-40    
ref|XP_006585912.1|  PREDICTED: actin cytoskeleton-regulatory com...    148   9e-40    
ref|XP_006585922.1|  PREDICTED: actin cytoskeleton-regulatory com...    145   2e-39    
ref|XP_006585919.1|  PREDICTED: actin cytoskeleton-regulatory com...    145   3e-39    
ref|XP_009603511.1|  PREDICTED: EH domain-containing protein 1-li...    150   4e-39    Nicotiana tomentosiformis
ref|XP_006585918.1|  PREDICTED: actin cytoskeleton-regulatory com...    144   7e-39    
ref|XP_009770779.1|  PREDICTED: EH domain-containing protein 1-li...    148   3e-38    Nicotiana sylvestris
ref|XP_002946165.1|  hypothetical protein VOLCADRAFT_55400              145   3e-37    Volvox carteri f. nagariensis
ref|XP_006452453.1|  hypothetical protein CICLE_v10007883mg             145   5e-37    
ref|XP_009779284.1|  PREDICTED: EH domain-containing protein 1-li...    144   1e-36    Nicotiana sylvestris
ref|XP_003055188.1|  predicted protein                                  144   2e-36    Micromonas pusilla CCMP1545
gb|KHG01502.1|  EH domain-containing 1                                  143   2e-36    Gossypium arboreum [tree cotton]
gb|KHN38606.1|  Epidermal growth factor receptor substrate 15 like      137   9e-36    Glycine soja [wild soybean]
ref|XP_005643284.1|  hypothetical protein COCSUDRAFT_38543              142   1e-35    Coccomyxa subellipsoidea C-169
ref|XP_006406402.1|  hypothetical protein EUTSA_v10020459mg             138   1e-34    
ref|XP_011402336.1|  EH domain-containing protein 1                     137   5e-34    Auxenochlorella protothecoides
ref|XP_010252586.1|  PREDICTED: EH domain-containing protein 1-li...    135   2e-33    Nelumbo nucifera [Indian lotus]
emb|CDP13785.1|  unnamed protein product                                123   8e-32    Coffea canephora [robusta coffee]
ref|XP_008371040.1|  PREDICTED: uncharacterized protein LOC103434...    124   2e-31    
ref|XP_010054613.1|  PREDICTED: EH domain-containing protein 1-like     129   3e-31    
gb|KCW77036.1|  hypothetical protein EUGRSUZ_D01382                     129   3e-31    Eucalyptus grandis [rose gum]
ref|XP_010481359.1|  PREDICTED: epidermal growth factor receptor ...    120   1e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010481360.1|  PREDICTED: uncharacterized calcium-binding p...    119   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010481358.1|  PREDICTED: epidermal growth factor receptor ...    119   3e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010042270.1|  PREDICTED: EH domain-containing protein 1-like     117   2e-27    Eucalyptus grandis [rose gum]
gb|KIZ06387.1|  EH domain-containing protein 4                          118   3e-27    Monoraphidium neglectum
ref|XP_010422242.1|  PREDICTED: EH domain-containing protein 1-like     112   1e-25    
gb|KEH33927.1|  calcium-binding EF hand protein                         112   2e-25    Medicago truncatula
tpg|DAA56214.1|  TPA: hypothetical protein ZEAMMB73_437723              111   2e-25    
ref|XP_008371041.1|  PREDICTED: EH domain-containing protein 1-li...    106   5e-25    
ref|XP_009770780.1|  PREDICTED: EH domain-containing protein 1-li...    109   2e-24    Nicotiana sylvestris
ref|XP_009357511.1|  PREDICTED: EH domain-containing protein 1-li...    107   2e-23    Pyrus x bretschneideri [bai li]
ref|XP_010675794.1|  PREDICTED: EH domain-containing protein 1-like     105   5e-23    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009779286.1|  PREDICTED: EH domain-containing protein 1-li...    105   8e-23    Nicotiana sylvestris
gb|KIY99063.1|  EH domain-containing protein 4                          102   4e-22    Monoraphidium neglectum
ref|XP_008225167.1|  PREDICTED: EH domain-containing protein 1-like     100   5e-22    Prunus mume [ume]
ref|XP_010513641.1|  PREDICTED: uncharacterized protein LOC104789679  97.1    3e-21    
ref|XP_010042271.1|  PREDICTED: EH domain-containing protein 1-like   97.1    2e-20    Eucalyptus grandis [rose gum]
ref|XP_001641640.1|  predicted protein                                89.4    5e-17    Nematostella vectensis
ref|XP_001508007.3|  PREDICTED: EH domain-containing protein 1        83.6    1e-16    
gb|ELT99462.1|  hypothetical protein CAPTEDRAFT_108382                87.4    2e-16    Capitella teleta
emb|CEG84957.1|  hypothetical protein RMATCC62417_18698               84.7    2e-16    Rhizopus microsporus
ref|XP_005107738.1|  PREDICTED: EH domain-containing protein 3-like   87.4    3e-16    Aplysia californica
ref|XP_008302461.1|  PREDICTED: EH domain-containing protein 3-like   83.6    3e-16    Stegastes partitus
ref|XP_008047905.1|  PREDICTED: EH domain-containing protein 1-like   84.0    4e-16    
ref|XP_010819470.1|  PREDICTED: EH domain-containing protein 1        83.2    5e-16    
ref|XP_002978188.1|  hypothetical protein SELMODRAFT_108442           85.1    6e-16    
ref|XP_002966377.1|  hypothetical protein SELMODRAFT_85478            85.1    6e-16    
ref|XP_004683416.1|  PREDICTED: EH domain-containing protein 1        86.3    6e-16    
ref|XP_009011174.1|  hypothetical protein HELRODRAFT_109211           86.3    7e-16    
gb|AAH84135.1|  LOC495040 protein                                     84.0    8e-16    
ref|XP_002430570.1|  EH-domain-containing protein, putative           85.9    8e-16    
emb|CAJ82518.1|  EH-domain containing 1                               84.0    8e-16    
ref|XP_008418633.1|  PREDICTED: EH domain-containing protein 1-li...  85.1    8e-16    
emb|CEG64412.1|  hypothetical protein RMATCC62417_01389               84.7    9e-16    
tpg|DAA13661.1|  TPA: EH-domain containing 1-like                     82.4    9e-16    
gb|ELW65085.1|  EH domain-containing protein 1                        83.2    9e-16    
ref|XP_010868930.1|  PREDICTED: EH domain-containing protein 1-like   85.9    9e-16    
ref|XP_005792863.1|  RME1A, RME-1/EHD family protein                  81.6    9e-16    
ref|XP_008325062.1|  PREDICTED: EH domain-containing protein 1-like   85.5    1e-15    
emb|CDQ63557.1|  unnamed protein product                              85.5    1e-15    
ref|XP_006781385.1|  PREDICTED: EH domain-containing protein 1-like   85.5    1e-15    
ref|XP_004596919.1|  PREDICTED: EH domain-containing protein 1        83.6    1e-15    
ref|XP_005660782.1|  PREDICTED: EH domain-containing protein 1 is...  85.5    1e-15    
ref|XP_009064815.1|  hypothetical protein LOTGIDRAFT_196647           85.1    1e-15    
ref|XP_003122601.2|  PREDICTED: EH domain-containing protein 1 is...  85.1    1e-15    
gb|EJW78181.1|  receptor mediated endocytosis protein 1               84.3    1e-15    
ref|XP_006861018.1|  PREDICTED: EH domain-containing protein 1 is...  85.1    1e-15    
ref|XP_010766243.1|  PREDICTED: EH domain-containing protein 1        85.1    1e-15    
ref|XP_007246435.1|  PREDICTED: EH domain-containing protein 1-like   85.1    2e-15    
ref|XP_005814925.1|  PREDICTED: EH domain-containing protein 1-like   85.1    2e-15    
ref|XP_006861019.1|  PREDICTED: EH domain-containing protein 1 is...  85.1    2e-15    
ref|XP_008418632.1|  PREDICTED: EH domain-containing protein 1-li...  84.7    2e-15    
gb|EJD74139.1|  receptor mediated endocytosis protein 1               85.1    2e-15    
ref|XP_002131017.1|  PREDICTED: EH domain-containing protein 3-like   84.7    2e-15    
ref|NP_001004578.1|  EH domain-containing protein 1                   84.7    2e-15    
emb|CDQ05700.1|  Protein Bm6218, isoform b                            84.7    2e-15    
emb|CDQ05702.1|  Protein Bm6218, isoform d                            84.7    2e-15    
emb|CDQ05701.1|  Protein Bm6218, isoform a                            84.7    2e-15    
ref|XP_006642819.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...  84.3    2e-15    
gb|ACC64578.1|  EH-domain containing 1 (predicted)                    83.6    2e-15    
ref|XP_005988942.1|  PREDICTED: EH domain-containing protein 1-like   84.3    2e-15    
emb|CEG64411.1|  hypothetical protein RMATCC62417_01389               84.3    2e-15    
dbj|BAG64091.1|  unnamed protein product                              84.0    2e-15    
emb|CDQ05699.1|  Protein Bm6218, isoform c                            84.7    2e-15    
ref|XP_009174734.1|  hypothetical protein T265_15072                  84.3    3e-15    
emb|CEJ02933.1|  hypothetical protein RMCBS344292_16925               80.5    3e-15    
ref|NP_998039.1|  EH-domain containing 1a                             84.3    3e-15    
emb|CBY21336.1|  unnamed protein product                              84.3    3e-15    
tpg|DAA13730.1|  TPA: EH domain-containing protein 1                  82.8    3e-15    
emb|CEI99343.1|  hypothetical protein RMCBS344292_13433               84.7    3e-15    
ref|NP_001088212.1|  EH-domain containing 1                           84.3    3e-15    
gb|AAH97601.1|  LOC495040 protein                                     84.0    3e-15    
ref|NP_001006734.1|  EH-domain containing 1                           84.3    3e-15    
ref|XP_003970287.1|  PREDICTED: EH domain-containing protein 1-like   84.3    3e-15    
ref|XP_008278543.1|  PREDICTED: EH domain-containing protein 1-like   84.0    3e-15    
dbj|BAE01936.1|  unnamed protein product                              83.6    3e-15    
dbj|BAE43123.1|  unnamed protein product                              84.0    3e-15    
ref|XP_004073212.1|  PREDICTED: EH domain-containing protein 1-like   84.0    3e-15    
emb|CAG09748.1|  unnamed protein product                              84.3    4e-15    
ref|XP_005723146.1|  PREDICTED: EH domain-containing protein 1-like   84.0    4e-15    
ref|XP_004545608.1|  PREDICTED: EH domain-containing protein 1-like   84.0    4e-15    
ref|XP_010747976.1|  PREDICTED: EH domain-containing protein 1-like   84.0    4e-15    
ref|XP_003444774.1|  PREDICTED: EH domain-containing protein 1        84.0    4e-15    
ref|XP_010994338.1|  PREDICTED: EH domain-containing protein 1        84.0    4e-15    
ref|XP_003419656.1|  PREDICTED: EH domain-containing protein 1        83.6    4e-15    
ref|XP_007942988.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_010634332.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
gb|ETE55849.1|  EH domain-containing protein 1                        79.3    5e-15    
gb|EQB77753.1|  EH domain-containing protein 1                        84.0    5e-15    
ref|XP_007462099.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
gb|AAI60908.1|  Ehd1 protein                                          83.6    5e-15    
ref|XP_004823289.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|NP_001269374.1|  EH domain-containing protein 1 isoform 2         83.6    5e-15    
emb|CDQ63653.1|  unnamed protein product                              83.6    5e-15    
ref|XP_005384609.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_007518643.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_004478690.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_004394029.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_006745612.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_009183961.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_007174350.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_001951167.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_004618455.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_007462100.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
gb|AAH37094.1|  EH-domain containing 1                                83.6    5e-15    
ref|XP_010634333.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|NP_034249.1|  EH domain-containing protein 1                      83.6    5e-15    
ref|XP_004437632.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
dbj|BAE40477.1|  unnamed protein product                              83.6    5e-15    
gb|ACA64879.1|  EH-domain containing 1 (predicted)                    83.6    5e-15    
ref|XP_008251915.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...  83.6    5e-15    
ref|XP_006216738.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_004264369.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_003432468.2|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_002755558.3|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_008578193.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_007110081.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    5e-15    
ref|XP_004643795.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
dbj|BAE39763.1|  unnamed protein product                              83.6    5e-15    
ref|XP_004887841.1|  PREDICTED: EH domain-containing protein 1        83.6    5e-15    
ref|XP_010346582.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
ref|XP_006901528.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_005064005.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
ref|XP_004770175.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
ref|XP_004394030.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_003468257.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
dbj|BAK63307.1|  EH-domain-containing protein 1                       83.6    6e-15    
ref|XP_010955402.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
gb|AAD45866.1|AF099011_1  EH-domain containing protein testilin       83.6    6e-15    
ref|XP_006745613.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
dbj|BAE35852.1|  unnamed protein product                              83.6    6e-15    
ref|NP_001267146.1|  EH domain-containing protein 1                   83.6    6e-15    
gb|ACQ62995.1|  EH-domain containing 1 (predicted)                    83.6    6e-15    
ref|XP_009006688.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_004051595.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
gb|AAG02009.1|  similar to Homo sapiens Hpast (HPAST) mRNA with G...  83.6    6e-15    
ref|XP_005631565.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_009183962.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_006911196.1|  PREDICTED: EH domain-containing protein 1        83.6    6e-15    
ref|NP_006786.2|  EH domain-containing protein 1 isoform 1            83.6    6e-15    
ref|XP_009006687.1|  PREDICTED: EH domain-containing protein 1 is...  83.6    6e-15    
ref|XP_006179621.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...  83.2    6e-15    
gb|KGB33136.1|  EH domain-containing protein 1                        83.2    6e-15    
ref|XP_006149915.1|  PREDICTED: EH domain-containing protein 1 is...  83.2    7e-15    
gb|ABI13180.1|  hypothetical protein                                  82.4    7e-15    
dbj|BAN21100.1|  past-1                                               83.2    8e-15    
ref|XP_004383816.1|  PREDICTED: EH domain-containing protein 1        82.8    8e-15    
ref|XP_966867.1|  PREDICTED: EH domain-containing protein 3-like      82.8    8e-15    
ref|XP_003993621.2|  PREDICTED: EH domain-containing protein 1        83.2    8e-15    
ref|XP_005864512.1|  PREDICTED: EH domain-containing protein 1        82.8    8e-15    
ref|XP_007550413.1|  PREDICTED: EH domain-containing protein 1-like   82.8    8e-15    
ref|XP_006771666.1|  PREDICTED: EH domain-containing protein 1        82.8    8e-15    
ref|XP_004365433.1|  hypothetical protein CAOG_00562                  82.8    9e-15    
ref|XP_008157310.1|  PREDICTED: EH domain-containing protein 1        82.8    9e-15    
gb|ABG66989.1|  EH-domain containing 1                                82.8    9e-15    
ref|NP_001015578.1|  EH domain-containing protein 1                   82.8    9e-15    
gb|ETE58213.1|  EH domain-containing protein 3                        78.2    9e-15    
ref|XP_003798673.1|  PREDICTED: EH domain-containing protein 1        82.8    1e-14    
ref|XP_006056578.1|  PREDICTED: EH domain-containing protein 1        82.8    1e-14    
ref|XP_005780580.1|  RME1A, RME-1/EHD family protein                  82.8    1e-14    
emb|CDJ03631.1|  Receptor Mediated Endocytosis family member          82.8    1e-14    
dbj|GAA50074.1|  EH domain-containing protein 3                       83.2    1e-14    
ref|XP_002502191.1|  predicted protein                                82.8    1e-14    
ref|XP_004927463.1|  PREDICTED: EH domain-containing protein 1-like   82.4    1e-14    
gb|KHN85977.1|  EH domain-containing protein 1                        79.7    1e-14    
gb|EUB63467.1|  EH domain-containing protein                          82.8    1e-14    
gb|EHJ75206.1|  past-1                                                82.0    1e-14    
emb|CCA22188.1|  conserved hypothetical protein                       80.1    1e-14    
gb|AAW25265.1|  SJCHGC04908 protein                                   79.7    1e-14    
emb|CCD77695.1|  eh domain containing/past-1-related                  82.4    1e-14    
ref|XP_002899341.1|  conserved hypothetical protein                   82.4    1e-14    
gb|ELR57915.1|  EH domain-containing protein 3                        82.4    1e-14    
ref|XP_006079678.1|  PREDICTED: EH domain-containing protein 3        82.4    1e-14    
ref|NP_001091473.1|  EH domain-containing protein 3                   82.4    1e-14    
ref|XP_005980047.1|  PREDICTED: EH domain-containing protein 3        82.4    1e-14    
ref|XP_004005851.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...  82.4    1e-14    
ref|XP_011152664.1|  PREDICTED: EH domain-containing protein 3        82.4    1e-14    
ref|XP_005686903.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...  82.0    1e-14    
gb|KDO25885.1|  hypothetical protein SPRG_08827                       82.0    2e-14    
ref|XP_011498656.1|  PREDICTED: EH domain-containing protein 3        82.0    2e-14    
ref|XP_008618010.1|  hypothetical protein SDRG_13692                  82.0    2e-14    
ref|XP_011169329.1|  PREDICTED: EH domain-containing protein 3        82.0    2e-14    
gb|EFZ22199.1|  hypothetical protein SINV_15529                       82.0    2e-14    
gb|EMS14781.1|  receptor mediated endocytosis protein                 77.0    2e-14    
ref|XP_005351853.1|  PREDICTED: EH domain-containing protein 1        82.0    2e-14    
gb|EMD49223.1|  EH domain containing protein                          79.0    2e-14    
ref|XP_005284662.1|  PREDICTED: EH domain-containing protein 4        81.6    2e-14    
gb|KFM72425.1|  EH domain-containing protein 1                        78.2    2e-14    
gb|EFA11233.1|  hypothetical protein TcasGA2_TC010765                 82.4    2e-14    
ref|XP_006570328.1|  PREDICTED: EH domain-containing protein 3        82.4    2e-14    
ref|XP_006622156.1|  PREDICTED: EH domain-containing protein 3-like   82.4    2e-14    
ref|XP_003744278.1|  PREDICTED: EH domain-containing protein 1-like   81.6    2e-14    
ref|XP_004327382.1|  PREDICTED: EH domain-containing protein 3-like   80.1    2e-14    
ref|XP_010896654.1|  PREDICTED: EH domain-containing protein 1-li...  81.6    2e-14    
ref|XP_010739820.1|  PREDICTED: EH domain-containing protein 4        77.4    2e-14    
ref|XP_003696342.1|  PREDICTED: EH domain-containing protein 1-like   82.4    2e-14    
ref|XP_010896656.1|  PREDICTED: EH domain-containing protein 1-li...  81.6    2e-14    
ref|XP_003121623.1|  PREDICTED: EH domain-containing protein 4-like   77.4    2e-14    
gb|EMH72886.1|  receptor mediated endocytosis protein, putative       77.0    3e-14    
emb|CDJ88426.1|  Dynamin and EF hand domain containing protein        82.0    3e-14    
emb|CEF69854.1|  AT21416p                                             81.6    3e-14    
ref|XP_010896655.1|  PREDICTED: EH domain-containing protein 1-li...  81.3    3e-14    
gb|AAH84280.1|  LOC495107 protein                                     81.3    3e-14    
gb|KFH11100.1|  sarcalumenin/eps15 family protein                     78.6    3e-14    
gb|KFG55407.1|  sarcalumenin/eps15 family protein                     78.6    3e-14    
ref|XP_007191438.1|  PREDICTED: EH domain-containing protein 3 is...  80.9    3e-14    
ref|XP_011266745.1|  PREDICTED: EH domain-containing protein 3        81.3    3e-14    
gb|EHH56113.1|  Testilin                                              81.3    3e-14    
emb|CEP08065.1|  hypothetical protein                                 81.3    3e-14    
ref|XP_006265046.1|  PREDICTED: glioma tumor suppressor candidate...  81.6    4e-14    
ref|XP_006265021.1|  PREDICTED: EH domain-containing protein 1        80.9    4e-14    
dbj|GAN06268.1|  past-1                                               80.9    4e-14    
emb|CEG72115.1|  hypothetical protein RMATCC62417_07727               80.9    4e-14    
emb|CEJ00342.1|  hypothetical protein RMCBS344292_14400               80.9    4e-14    
gb|ENN79547.1|  hypothetical protein YQE_04009                        80.9    4e-14    
ref|XP_005990842.1|  PREDICTED: EH domain-containing protein 4        81.3    4e-14    
gb|EIE86499.1|  hypothetical protein RO3G_11210                       80.9    4e-14    
gb|EPB81232.1|  hypothetical protein HMPREF1544_12055                 80.9    4e-14    
gb|AEE63488.1|  unknown                                               80.9    4e-14    
emb|CCI42136.1|  unnamed protein product                              80.9    4e-14    
gb|ENN79546.1|  hypothetical protein YQE_04009                        80.9    4e-14    
ref|XP_006033224.1|  PREDICTED: EH domain-containing protein 1 is...  80.9    4e-14    
ref|NP_001024192.1|  Protein RME-1, isoform a                         81.3    4e-14    
gb|EYC08124.1|  hypothetical protein Y032_0067g13                     80.9    4e-14    
gb|ETN74697.1|  dynamin family protein                                80.9    4e-14    
ref|XP_007460261.1|  PREDICTED: EH domain-containing protein 4-like   78.2    4e-14    
ref|XP_006183228.1|  PREDICTED: EH domain-containing protein 3        80.9    4e-14    
ref|NP_001024193.1|  Protein RME-1, isoform b                         81.3    4e-14    
ref|XP_002499973.1|  predicted protein                                80.1    4e-14    
ref|XP_006197310.1|  PREDICTED: EH domain-containing protein 3        80.9    4e-14    
gb|EFX80375.1|  hypothetical protein DAPPUDRAFT_304007                80.9    5e-14    
ref|XP_007440405.1|  PREDICTED: EH domain-containing protein 4-like   79.3    5e-14    
emb|CDS32978.1|  Receptor Mediated Endocytosis family member          80.9    5e-14    
ref|XP_007470944.1|  PREDICTED: EH domain-containing protein 3        80.5    5e-14    
ref|XP_004268234.1|  PREDICTED: EH domain-containing protein 3        80.5    5e-14    
gb|ESA13801.1|  hypothetical protein GLOINDRAFT_175493                80.5    5e-14    
ref|XP_004656697.1|  PREDICTED: EH domain-containing protein 1        80.5    5e-14    
gb|EYC08125.1|  hypothetical protein Y032_0067g13                     80.9    5e-14    
ref|XP_007191437.1|  PREDICTED: EH domain-containing protein 3 is...  80.5    5e-14    
ref|XP_006270383.1|  PREDICTED: EH domain-containing protein 4        80.5    5e-14    
ref|XP_003216109.1|  PREDICTED: EH domain-containing protein 3 is...  80.5    5e-14    
gb|EFN61188.1|  EH domain-containing protein 1                        81.3    5e-14    
gb|AAB81204.1|  Hpast                                                 80.5    6e-14    
gb|KDR15657.1|  EH domain-containing protein 4                        80.5    6e-14    
ref|XP_011052393.1|  PREDICTED: EH domain-containing protein 3        80.5    6e-14    
ref|XP_002107982.1|  hypothetical protein TRIADDRAFT_18691            80.5    6e-14    
ref|XP_003707402.1|  PREDICTED: EH domain-containing protein 1-like   80.9    6e-14    
emb|CDJ45733.1|  EH protein, putative                                 78.6    6e-14    



>ref|XP_009589162.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=545

 Score =   335 bits (859),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PISRCSK HEKIYQ+WFS ADSDGDGR+TGGDA KFFALSNLSRQ+LKQVWAIA
Sbjct  1    MEFDTSPISRCSKEHEKIYQQWFSLADSDGDGRLTGGDAIKFFALSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF+EF+  MQLVSLAQAG+ +T DLL+A+V+FENL+PP +EGLD  L AKKK
Sbjct  61   DSKRQGFLGFREFITSMQLVSLAQAGHPVTSDLLNAEVNFENLQPPTLEGLDL-LQAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EPEQNG+P  QSS  A+WF SS S KKVSL+SVTSI+DGLKKLYIQ LKPLEV Y
Sbjct  120  RAPKSEPEQNGNPTVQSSVTANWFSSSTSVKKVSLTSVTSIIDGLKKLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>emb|CDP13787.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+APISRCSK ++KIYQ+WF+FADSDGDGR+TG DATKFFALSNL R +LKQVWAIA
Sbjct  1    MEIDSAPISRCSKENQKIYQDWFAFADSDGDGRLTGADATKFFALSNLPRHDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  +QLVSLAQAG+A+T D++ A+VDFE+L+PP M+GL+A L AKKK
Sbjct  61   DSKRQGFLGFKEFITAVQLVSLAQAGHALTSDIIYAEVDFESLKPPAMDGLEA-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            +T K++ EQNG P  QSSP+A+WF SSKSAKKVSLSSVTSIVDGLKKLY+Q LKPLE TY
Sbjct  120  HTPKSDLEQNGIPQLQSSPSANWFSSSKSAKKVSLSSVTSIVDGLKKLYVQKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_011095452.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=544

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 199/220 (90%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+APISRCSK H+KIYQ+WFSFADSDGDGR+TGGDA KFFA+SNL RQ+LK VWAIA
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGGDAIKFFAMSNLPRQDLKLVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+  D+L ++VDFENL+PP MEGLDA LA KK+
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHALNSDILTSEVDFENLQPPAMEGLDALLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +S  EPEQNGS   QSSPAASWF SSKSAKKVSLSSVTSI+DGLKKLY+Q LKPLEVTY
Sbjct  121  VSS--EPEQNGSVQPQSSPAASWFSSSKSAKKVSLSSVTSIIDGLKKLYVQKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_009598339.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   328 bits (840),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKK  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  S+PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLEV Y
Sbjct  121  PMPKSEPDQNGSAPVPSAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEVAY  180

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_009598337.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=546

 Score =   327 bits (839),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKK  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  S+PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLEV Y
Sbjct  121  PMPKSEPDQNGSAPVPSAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEVAY  180

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_009776640.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=541

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKK  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  ++PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLE+ Y
Sbjct  121  PMPKSEPDQNGSAPVPTAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEIAY  180

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_009776638.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=546

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKK  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  ++PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLE+ Y
Sbjct  121  PMPKSEPDQNGSAPVPTAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEIAY  180

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_009598338.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  L AKKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFL-AKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  S+PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLEV Y
Sbjct  120  PMPKSEPDQNGSAPVPSAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009776639.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=545

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQEWF+FADSDGDGR+TGGDATKFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F+EFVI MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  L AKKK
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFL-AKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EP+QNGS P  ++PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLE+ Y
Sbjct  120  PMPKSEPDQNGSAPVPTAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEIAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_010324305.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
lycopersicum]
Length=545

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQ+WF+FADSDGDGR+TGGDA KFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDAIKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F++FV+GMQLV+LAQAG+A+T DLL+A VDFENL PP MEGLD  L AKKK
Sbjct  61   DSKRQGFLNFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLPPPAMEGLDV-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+E +QNGS P  ++P  SWF SSKS+KK+SL+SVTSIVDGLKKLYIQ LKPLEV Y
Sbjct  120  LMPKSEQDQNGSAPVPAAPTTSWFSSSKSSKKISLTSVTSIVDGLKKLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_006346193.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI+RCSK HEKIYQ+WF+FADSDGDGR+TGGDATKFFA+S+L R ELKQVWAIA
Sbjct  1    MEFDTNPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDATKFFAMSSLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L F++FV+GMQLV+LAQAG+A+T DLL+A VDFENL PP MEGLD  L AKKK
Sbjct  61   DSKRQGFLSFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLPPPAMEGLDV-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+E +QNGS P  ++P  SWF SSKS+KK+SL+SVTSIVDGLKKLYIQ LKPLEV Y
Sbjct  120  LMPKSEQDQNGSAPVPAAPTTSWFSSSKSSKKISLTSVTSIVDGLKKLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_004294399.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIY+EWF FADSD DGRITG DA KFF++SNLSRQ+LKQVWAI 
Sbjct  1    MEISSVPISSCSKEHQKIYREWFQFADSDSDGRITGSDAIKFFSMSNLSRQDLKQVWAIT  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EFV  MQLVSLAQAGN IT DLL    D ENL+PP MEGLD  LA KK+
Sbjct  61   DSKRQGFLGFTEFVAAMQLVSLAQAGNEITNDLLTRNADLENLKPPVMEGLDVLLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE E NG+P  Q SP+A WF  SKS+KKV LS+VTSIVDGLK+LY+Q LKPLEVTY
Sbjct  121  SNKTNENEVNGNPVVQQSPSALWFS-SKSSKKVPLSAVTSIVDGLKRLYVQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  KFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>gb|EYU27376.1| hypothetical protein MIMGU_mgv1a004087mg [Erythranthe guttata]
Length=544

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 195/220 (89%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+APISRCSK H+KIYQ+WFSFADSDGDGR+TG DATKFF+LSNL RQ+LK VWAIA
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGADATKFFSLSNLPRQDLKLVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+T D+L ++VDFENL+ P ++GL A L  KK+
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHALTSDILSSEVDFENLQTPALDGLGALLTKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  NEPEQNGSP  QSS AASWF SSKSAKK+SLSSVTSIVDGLK+LYIQ LKPLE TY
Sbjct  121  LS--NEPEQNGSPQVQSSLAASWFSSSKSAKKISLSSVTSIVDGLKRLYIQKLKPLETTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  QFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|KDO62120.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=394

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI  CSK H+KIY EWF++ADSDGDGRITG DATKFFALSNLSRQ+LKQVWAIA
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLG++EF+  MQL+SL Q G+ +T DL ++ VDF+NL+PP MEGLD  LA K+ 
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGS   Q SP+A+WF  SKS+KK+S+SSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  SSKTSDPNLNGSLQPQPSPSANWFS-SKSSKKISMSSVTSIIDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_007213895.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
 gb|EMJ15094.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
Length=545

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 184/220 (84%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIYQEWF FADSD DGRITG DA KFF++SNL+RQ+LKQVWAIA
Sbjct  1    MEISSVPISSCSKEHQKIYQEWFRFADSDSDGRITGNDAIKFFSMSNLNRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQ G+ I+ DLL++ VD ENL PP MEGLDA LA KK+
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQGGHDISHDLLNSNVDLENLNPPVMEGLDALLAKKKQ  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE E NG+   + SP+A WF  SKS+KKV LSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  LHRTNENEVNGTVVVEQSPSALWFS-SKSSKKVPLSSVTSIIDGLKRLYVQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_008226997.1| PREDICTED: EH domain-containing protein 1 [Prunus mume]
Length=545

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIYQEWF FADSD DGRITG DA KFF +SNL+RQ+LKQVWAIA
Sbjct  1    MEISSVPISSCSKEHQKIYQEWFRFADSDSDGRITGNDAIKFFGMSNLNRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQ G+ I+ DLL++ VD ENL PP MEGLDA LA KK+
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQGGHDISHDLLNSNVDLENLNPPVMEGLDALLAKKKQ  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE E NG+   + SP+A WF  SKS+KKV LSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  LHKMNENEVNGTAVVEQSPSALWFS-SKSSKKVPLSSVTSIIDGLKRLYVQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_010096102.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB63267.1| EH domain-containing protein 1 [Morus notabilis]
Length=542

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 184/220 (84%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI ++PIS CSK H+KIYQEWFS+ADSDGDGRITG DA KFFA+SNL RQ+LKQVWA+A
Sbjct  1    MEIASSPISSCSKEHQKIYQEWFSYADSDGDGRITGNDAIKFFAMSNLPRQDLKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT DLL++ VD ENL+ P MEGLD  LA KK+
Sbjct  61   DSKRQGYLGFGEFVAAMQLVSLAQAGHGITHDLLNSNVDLENLKLPVMEGLDGLLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                +EP+ NG    + SP+A WF  SKS+ KVSLSSVTSI+DGLK+LYI+ LKPLE TY
Sbjct  121  SQKTSEPDVNGGSIVEQSPSAQWFS-SKSSTKVSLSSVTSIIDGLKRLYIKKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_011461076.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=544

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 183/220 (83%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIY+EWF FADSD DGRITG DA KFF++SNLSRQ+LKQVWAI 
Sbjct  1    MEISSVPISSCSKEHQKIYREWFQFADSDSDGRITGSDAIKFFSMSNLSRQDLKQVWAIT  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EFV  MQLVSLAQAGN IT DLL  + D ENL+PP MEGLD  LA KK+
Sbjct  61   DSKRQGFLGFTEFVAAMQLVSLAQAGNEITNDLL-TRNDLENLKPPVMEGLDVLLAKKKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE E NG+P  Q SP+A WF  SKS+KKV LS+VTSIVDGLK+LY+Q LKPLEVTY
Sbjct  120  SNKTNENEVNGNPVVQQSPSALWFS-SKSSKKVPLSAVTSIVDGLKRLYVQKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  KFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  218



>ref|XP_009334157.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 187/221 (85%), Gaps = 2/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI+ CSK H+KIYQEWF FADSD DGRITGGDA KFF +SNL+RQ+LKQVWA+A
Sbjct  1    MEISSVPITSCSKEHQKIYQEWFRFADSDSDGRITGGDAIKFFGMSNLNRQDLKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  L ++ VD E+L+PP MEGLDA L+AKKK
Sbjct  61   DSKRQGYLGFNEFVAAMQLVSLAQAGHDITHGLQNSNVDLESLKPPVMEGLDALLSAKKK  120

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +T K NE E NG+   Q SP+A WF  SKSAKKV LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  121  HTHKSNENEVNGTAVVQQSPSALWFS-SKSAKKVPLSSVTSIIDGLKRLYVQKLKPLEVT  179

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  YKFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_008359253.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=546

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIYQEWF FADSDGDGRITGGDA KFF +SNL+RQ+LKQVWAIA
Sbjct  1    MEISSVPISSCSKXHQKIYQEWFRFADSDGDGRITGGDAIKFFGMSNLNRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  L ++ VD E+L+PP MEGLD  L+ KK 
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLQNSNVDLESLKPPVMEGLDXLLSKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE E NG+   Q SP+A WF  SKSAKKV LSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  TXKSNENEVNGTAVVQQSPSALWFS-SKSAKKVPLSSVTSIIDGLKRLYVQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  KFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>gb|EPS68571.1| hypothetical protein M569_06192, partial [Genlisea aurea]
Length=541

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+API+RCS+ H+KIYQ+WFSFADSDGDGR+TG DATKFFA+S+L R +LKQ+W+IA
Sbjct  1    MEIDSAPITRCSQEHKKIYQDWFSFADSDGDGRVTGADATKFFAMSDLPRADLKQIWSIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG KEF+  MQLVSLAQAGN I+ +++ ++VDF++L PP M GLDA LA KK+
Sbjct  61   DSKRQGFLGLKEFITAMQLVSLAQAGNTISNNIVYSEVDFDDLSPPNMNGLDALLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              ++ EP+ NGS   Q SP A WF SSKSAKKVSLSSVTSI+DGLKKLY+Q LKPLE TY
Sbjct  121  --AQQEPQDNGSNQVQPSPTAGWFSSSKSAKKVSLSSVTSIIDGLKKLYVQKLKPLETTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  179  LFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>ref|XP_010324304.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 192/229 (84%), Gaps = 10/229 (4%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQ+WF+FADSDGDGR+TGGDA KFFA+SNL R ELKQVWAIA
Sbjct  1    MEFDTSPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDAIKFFAMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLE---------PPRMEGL  338
            DSKRQG+L F++FV+GMQLV+LAQAG+A+T DLL+A VDFENL          PP MEGL
Sbjct  61   DSKRQGFLNFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLSIAVDFENLPPPAMEGL  120

Query  339  DAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQ  518
            D  L AKKK   K+E +QNGS P  ++P  SWF SSKS+KK+SL+SVTSIVDGLKKLYIQ
Sbjct  121  DV-LLAKKKLMPKSEQDQNGSAPVPAAPTTSWFSSSKSSKKISLTSVTSIVDGLKKLYIQ  179

Query  519  NLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             LKPLEV Y FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  KLKPLEVAYHFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  228



>ref|XP_002298819.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
 gb|EEE83624.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
Length=512

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 184/220 (84%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I  CSK  + +YQEWF +ADSDGDGRITG DATKFF+LS LSRQ+LK VWAIA
Sbjct  1    MEISSGAIGSCSKDQKTMYQEWFHYADSDGDGRITGNDATKFFSLSKLSRQDLKPVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+I MQLVSLAQ+G  IT D+L++ VDF++L+PP MEGLDA +A K++
Sbjct  61   DSKRQGYLGFIEFIIAMQLVSLAQSGREITNDILNSDVDFQSLKPPSMEGLDALMAKKRR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                N+ E NG+P  QS+P+A+WF  SK ++K SLSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  SLKSNDNEANGTPTVQSTPSANWFS-SKPSRKASLSSVTSIIDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_002277794.1| PREDICTED: EH domain-containing protein 1 [Vitis vinifera]
 emb|CBI26690.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 185/220 (84%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+ PIS CSK ++ IYQEWF+FADSD DGRITG DA KFFA+SNL R +LKQVWAIA
Sbjct  1    MEIDSGPISSCSKQNQMIYQEWFNFADSDSDGRITGNDAIKFFAMSNLPRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LG KEF+  MQLVSLAQAG+AIT DLL ++VD  NL PP+MEGL A LA KK+
Sbjct  61   DTKRQGFLGLKEFITAMQLVSLAQAGHAITQDLLHSEVDLGNLNPPQMEGLAALLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                ++P+ NGS   Q SP ASWF +SKS+KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  AHKTSDPDINGSSQPQPSPTASWF-TSKSSKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_006475006.1| PREDICTED: EH domain-containing protein 3-like [Citrus sinensis]
Length=545

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI  CSK H+KIY EWF++ADSDGDGRITG DATKFFALSNLSRQ+LKQVWAIA
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLG++EF+  MQL+SL Q G+ +T DL ++ VDF+NL+PP MEGLD  LA K+ 
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGS   Q SP+A+WF  SKS+KK+S+SSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  SSKTSDPNLNGSLQPQPSPSANWFS-SKSSKKISMSSVTSIIDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>gb|KDO62119.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=545

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI  CSK H+KIY EWF++ADSDGDGRITG DATKFFALSNLSRQ+LKQVWAIA
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLG++EF+  MQL+SL Q G+ +T DL ++ VDF+NL+PP MEGLD  LA K+ 
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGS   Q SP+A+WF  SKS+KK+S+SSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  SSKTSDPNLNGSLQPQPSPSANWFS-SKSSKKISMSSVTSIIDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>gb|KCW70228.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=462

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PIS CSK +++IYQEWF +ADSDGDGRITG DATKFFA+SNL R +LKQVWAIA
Sbjct  69   MEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWAIA  128

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  MQLVSLAQAG +IT DL  ++VD  NL PP+M GLD+ LA K+ 
Sbjct  129  DSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAKKRP  188

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE + NGS   Q SPA+ WF  SK +KK+SLSSVTSIVDGLK+LYIQ LKPLEVTY
Sbjct  189  SPRTNESDSNGSSHSQPSPASGWFS-SKPSKKISLSSVTSIVDGLKRLYIQKLKPLEVTY  247

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  248  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  287



>ref|XP_006452452.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65692.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=563

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI  CSK H+KIY EWF++ADSDGDGRITG DATKFFALSNLSRQ+LKQVWAIA
Sbjct  19   MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  78

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLG++EF+  MQL+SL Q G+ +T DL ++ VDF+NL+PP MEGLD  LA K+ 
Sbjct  79   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  138

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGS   Q SP+A+WF  SKS+KK+S+SSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  139  SSKTSDPNLNGSLQPQPSPSANWFS-SKSSKKISMSSVTSIIDGLKRLYIQKLKPLEVTY  197

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  198  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  237



>gb|KDP39189.1| hypothetical protein JCGZ_00946 [Jatropha curcas]
Length=545

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 187/220 (85%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  CSK ++KIY EWF+FADSDGDGRITG DA KFF +SNLSRQ+LKQVWAIA
Sbjct  1    MEISSGPIGSCSKDNQKIYLEWFNFADSDGDGRITGNDAIKFFGMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQL+SLAQAG+ IT DLL++ +DFENL+ P M+GLD  LA KK+
Sbjct  61   DSKRQGYLGFNEFITAMQLISLAQAGHEITHDLLNSNIDFENLKTPFMDGLDLLLAKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  +EP+ NGS   Q SP+A+WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV Y
Sbjct  121  LSKSSEPDTNGSHLVQPSPSANWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_002264320.1| PREDICTED: EH domain-containing protein 3-like [Vitis vinifera]
Length=545

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 181/219 (83%), Gaps = 1/219 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK ++KIYQEWF++ADSD DGRITG DATKFFA+SNLSR ELKQVWAIA
Sbjct  1    MEIASVPISSCSKHNQKIYQEWFNYADSDNDGRITGNDATKFFAMSNLSRSELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF+EF+  MQLVSLAQAGN IT D+L   VD ENLEPP MEGL+A LA  K 
Sbjct  61   DSKRQGFLGFREFITAMQLVSLAQAGNEITSDILKTTVDLENLEPPSMEGLNALLAKNKV  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  E E NG    Q SP+A WF +SKS KK  L+SVTSI+DGLK+LY + LKPLEVTY
Sbjct  121  STNNGELELNGDSRPQPSPSAPWF-TSKSVKKAPLNSVTSIIDGLKRLYNEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            R+NDFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  180  RYNDFVSPLLTHSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_009348303.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 184/221 (83%), Gaps = 2/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI+ CSK H+KIYQ WF FADSD DGRITGGDA KFF +SNL+RQ+LKQVWAIA
Sbjct  1    MEISSVPITSCSKEHQKIYQGWFRFADSDSDGRITGGDAIKFFGMSNLNRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  L ++ VD E L+PP MEGLDA L+AKKK
Sbjct  61   DSKRQGYLGFNEFVAAMQLVSLAQAGHDITHGLQNSNVDLEGLKPPVMEGLDALLSAKKK  120

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +T K NE E NG+   Q S +A WF  SKSAKKV LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  121  HTHKSNENEVNGTAVVQQSSSALWFS-SKSAKKVPLSSVTSIIDGLKRLYVQKLKPLEVT  179

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  YKFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_011046717.1| PREDICTED: EH domain-containing protein 3 [Populus euphratica]
Length=545

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I  CSK  + +YQEWF +ADSDGDGRITG DATKFF+LS LSRQ+LK VWAIA
Sbjct  1    MEISSGAIGSCSKDQKTMYQEWFHYADSDGDGRITGNDATKFFSLSKLSRQDLKPVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+I MQLVSLAQ+G  IT D+L++ VDF++L+PP MEGLDA L  K++
Sbjct  61   DSKRQGYLGFIEFIIAMQLVSLAQSGREITNDILNSDVDFQSLKPPSMEGLDALLVKKRR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                N+ E NG+P  QS+P+A+WF  SK ++K SLSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  SLKSNDNEANGTPTVQSTPSANWFS-SKPSRKASLSSVTSIIDGLKRLYLQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_010063047.1| PREDICTED: EH domain-containing protein 1 [Eucalyptus grandis]
Length=545

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PIS CSK +++IYQEWF +ADSDGDGRITG DATKFFA+SNL R +LKQVWAIA
Sbjct  1    MEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  MQLVSLAQAG +IT DL  ++VD  NL PP+M GLD+ LA K+ 
Sbjct  61   DSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAKKRP  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE + NGS   Q SPA+ WF  SK +KK+SLSSVTSIVDGLK+LYIQ LKPLEVTY
Sbjct  121  SPRTNESDSNGSSHSQPSPASGWFS-SKPSKKISLSSVTSIVDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>ref|XP_009361045.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=546

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 185/221 (84%), Gaps = 2/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+ IYQEWF FAD+D DGRITG DA KFF +SNL+RQ+LKQVWA+A
Sbjct  1    MEISSVPISSCSKEHQNIYQEWFRFADADTDGRITGSDAIKFFGMSNLNRQDLKQVWAMA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  LL++ VD E+L+PP MEGLDA L AKKK
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLESLKPPVMEGLDALLLAKKK  120

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            ++ K NE + NG+   Q +P+A WF  SKS+KKV LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  121  HSHKSNENKVNGTAVVQQTPSALWFS-SKSSKKVPLSSVTSIIDGLKRLYVQKLKPLEVT  179

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  YKFNDFVSPLLRNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_007020711.1| EPS15 domain 1 [Theobroma cacao]
 gb|EOY12236.1| EPS15 domain 1 [Theobroma cacao]
Length=547

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI A  I  CSK H++IYQEWFSF DSD DGRITG DA KFF +SNLSRQ+LKQVWAIA
Sbjct  1    MEIGAGRIGSCSKEHQQIYQEWFSFVDSDNDGRITGTDAIKFFGMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEFV  MQLVSLAQ G+ I+ DLL+  VDFEN +PP MEGLDA +  KK 
Sbjct  61   DSKRQGYLGFKEFVFAMQLVSLAQDGHEISHDLLNGDVDFENAKPPVMEGLDALIMKKKH  120

Query  366  YTSKNEP--EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
             +    P    NGS P QSSPAA WF  SKS+KK+S+SSVTSI+DGLK+LYIQ LKPLEV
Sbjct  121  SSKSTSPASNANGSSPMQSSPAAQWFS-SKSSKKISMSSVTSIIDGLKRLYIQKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  TYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>gb|KCW70227.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=613

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PIS CSK +++IYQEWF +ADSDGDGRITG DATKFFA+SNL R +LKQVWAIA
Sbjct  69   MEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWAIA  128

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  MQLVSLAQAG +IT DL  ++VD  NL PP+M GLD+ LA K+ 
Sbjct  129  DSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAKKRP  188

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                NE + NGS   Q SPA+ WF  SK +KK+SLSSVTSIVDGLK+LYIQ LKPLEVTY
Sbjct  189  SPRTNESDSNGSSHSQPSPASGWFS-SKPSKKISLSSVTSIVDGLKRLYIQKLKPLEVTY  247

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  248  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  287



>ref|XP_010313928.1| PREDICTED: EH domain-containing protein 3-like [Solanum lycopersicum]
Length=545

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 189/219 (86%), Gaps = 1/219 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQ+WFS ADSDGDGR+TGGDA KFFA+SNL RQ+LKQVWAIA
Sbjct  1    MEFDTSPINRCSKDHEKIYQQWFSLADSDGDGRLTGGDAIKFFAMSNLPRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF+EF+  MQLVSLAQAG+ ++ DLL+A+VDFENL+PP +EGLD  L  KKK
Sbjct  61   DSKRQGFLGFREFIAAMQLVSLAQAGHPVSSDLLNAEVDFENLQPPSLEGLDL-LQTKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EPEQNGS   QSS  A+WF SS S KKVSLSSVTSIVDGLKKLY+Q LKPLE TY
Sbjct  120  RMPKSEPEQNGSSTMQSSATANWFSSSASVKKVSLSSVTSIVDGLKKLYLQKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_006344871.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 189/219 (86%), Gaps = 1/219 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI+RCSK HEKIYQ+WFS ADSDGDGR+TGGDA KFFA+SNL RQ+LKQVWAIA
Sbjct  1    MEFDTSPINRCSKDHEKIYQQWFSLADSDGDGRLTGGDAIKFFAMSNLPRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF+EF+  MQLVSLAQAG+ ++ DLL+A+VDFENL+PP +EGLD  L  KKK
Sbjct  61   DSKRQGFLGFREFIAAMQLVSLAQAGHPVSSDLLNAEVDFENLQPPSLEGLDL-LQTKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+EPEQNGS   QSS  A+WF SS S KKVSLSSVTSIVDGLKKLY+Q LKPLE TY
Sbjct  120  RMPKSEPEQNGSSTVQSSATANWFSSSSSVKKVSLSSVTSIVDGLKKLYLQKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_010544277.1| PREDICTED: EH domain-containing protein 1 [Tarenaya hassleriana]
Length=548

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 185/223 (83%), Gaps = 4/223 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IYQEWF FADSD DGRITG DA KFFA+SNLSR ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQMIYQEWFDFADSDSDGRITGNDAIKFFAMSNLSRAELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLA--AK  359
            DSKRQGYLGF+EFVI MQLVSLAQAG  I+ ++L++ VDF NL PP MEGLD  +A   K
Sbjct  61   DSKRQGYLGFREFVIAMQLVSLAQAGREISHEVLNSDVDFRNLSPPTMEGLDVLVAKNKK  120

Query  360  KKYTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLE  536
            KK++ + ++P+ N S P Q+S +A+WF  SKS+KK+ +SSVTSI+DGLK+LYIQ LKPLE
Sbjct  121  KKHSPQLSDPDVNSSTPVQTSLSAAWFS-SKSSKKIPISSVTSIIDGLKRLYIQKLKPLE  179

Query  537  VTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             TYRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  ATYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  222



>ref|XP_010270065.1| PREDICTED: EH domain-containing protein 1 [Nelumbo nucifera]
Length=544

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI  CSK H+KIYQEWF++ADSDGDGRITG DATKFFA+SNLSR ELKQVWAIA
Sbjct  1    MEIVTGPIGPCSKEHQKIYQEWFNYADSDGDGRITGNDATKFFAMSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  MQLV+LAQAG+ IT DLL + ++ ENL PP MEGLD  +A +K+
Sbjct  61   DSKRQGFLGFTEFIAAMQLVALAQAGHEITPDLLSSGINSENLNPPVMEGLDVLIAKRKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K E +     P QSSP+A WF  SKS+KK+ LSSVTSI+DGLKKLYI+ LKPLEVTY
Sbjct  121  SPQKPELDNVTIQP-QSSPSAHWFS-SKSSKKIPLSSVTSIIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLL +SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFNDFVSPLLISSDFDARPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_002531194.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF31171.1| EH-domain-containing protein, putative [Ricinus communis]
Length=550

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 186/224 (83%), Gaps = 4/224 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI A P+  CSK ++KIY EWF+FADSDGDGRITG DA KFF +SNLSRQ+LKQVWAIA
Sbjct  1    MEISAGPVGSCSKENQKIYLEWFAFADSDGDGRITGNDAIKFFGMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLA-AKK  362
            +SKRQGYLGF EF+  MQL+SLAQAG+ I  DLL ++VDFENL PP MEGLD  L   K+
Sbjct  61   NSKRQGYLGFNEFITSMQLISLAQAGHQIAHDLLSSQVDFENLRPPTMEGLDELLEQKKR  120

Query  363  KYTSKNEPEQNGSPPRQSSPAASWF---QssksakkvslssvtsIVDGLKKLYIQNLKPL  533
            + +   + + NG+PP ++SP+ +WF    SSKS+KKV LSSVTSI+DGLK+LYIQ LKPL
Sbjct  121  RRSRSRDFDVNGTPPVETSPSVNWFSPKSSSKSSKKVPLSSVTSIIDGLKRLYIQKLKPL  180

Query  534  EVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            EVTYRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  EVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  224



>ref|XP_007026229.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
 gb|EOY28851.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
Length=511

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME    PI  CSK H+KIY++WF+ ADSDGDGR+TG DATKFF++S LSRQELKQ+WAIA
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF++ MQLVSLAQAGN +T D+L + VD EN+  P MEGLDA     K 
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALAVKSKD  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  EPE NG+   Q   +A WF +SKSA+K   S+VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  121  STTNGEPEMNGTTHPQVPTSAKWF-TSKSARKTPASAVTSIIDGLKRLYIEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>gb|KEH28435.1| calcium-binding EF hand protein [Medicago truncatula]
Length=423

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 186/220 (85%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IYQ+WF+ ADSDGDGRITG DATKFFA+SNLSRQ LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF+EF+I MQLVSLAQ+G+ IT DLL++ VD +NL+PP +EGLDA LA KK 
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALLAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               ++E + NGS   Q SP++S + SSKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  --KQSELDVNGSSQLQPSPSSS-WFSSKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_007026226.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
 gb|EOY28848.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
Length=544

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 177/220 (80%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME    PI  CSK H+KIY++WF+ ADSDGDGR+TG DATKFF++S LSRQELKQ+WAIA
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF++ MQLVSLAQAGN +T D+L + VD EN+  P MEGLDA LA  K 
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDA-LAVSKD  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  EPE NG+   Q   +A WF +SKSA+K   S+VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  120  STTNGEPEMNGTTHPQVPTSAKWF-TSKSARKTPASAVTSIIDGLKRLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  218



>gb|ACJ85603.1| unknown [Medicago truncatula]
Length=430

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 183/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IYQ+WF+ ADSDGDGRITG DATKFFA+SNLSRQ LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF+EF+I MQLVSLAQ+G+ IT DLL++ VD +NL+PP +EGLDA LA KK 
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALLAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               ++E + NGS  +     +S + SSKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  --KQSELDVNGS-SQLQPSPSSSWFSSKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_006829517.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
 gb|ERM96933.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
Length=543

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 182/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + P+  CSK H+KIYQ+WF++ADSDGD RITG DA K F+LS LSR ELKQVWAIA
Sbjct  1    MEIVSLPVGTCSKEHQKIYQQWFNYADSDGDARITGNDAIKLFSLSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQL+SLAQ+G+ IT D+L A  D ENL PP MEGLD  +A  K 
Sbjct  61   DSKRQGFLGFKEFITAMQLISLAQSGHEITPDVL-ASTDLENLNPPPMEGLDGLIARGKP  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K+E + NG+ PRQ + +A WF +SKSAKKV L+SVTSI+DGLK+LY++ LKPLEVTY
Sbjct  120  SPTKSESDLNGT-PRQQTQSAQWF-TSKSAKKVPLNSVTSIIDGLKRLYLEKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_007026225.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
 gb|EOY28847.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
Length=545

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME    PI  CSK H+KIY++WF+ ADSDGDGR+TG DATKFF++S LSRQELKQ+WAIA
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF++ MQLVSLAQAGN +T D+L + VD EN+  P MEGLDA     K 
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALAVKSKD  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  EPE NG+   Q   +A WF +SKSA+K   S+VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  121  STTNGEPEMNGTTHPQVPTSAKWF-TSKSARKTPASAVTSIIDGLKRLYIEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>ref|XP_007026228.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
 gb|EOY28850.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
Length=546

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME    PI  CSK H+KIY++WF+ ADSDGDGR+TG DATKFF++S LSRQELKQ+WAIA
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF++ MQLVSLAQAGN +T D+L + VD EN+  P MEGLDA     K 
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALAVKSKD  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  EPE NG+   Q   +A WF +SKSA+K   S+VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  121  STTNGEPEMNGTTHPQVPTSAKWF-TSKSARKTPASAVTSIIDGLKRLYIEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>ref|XP_003519595.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=543

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 183/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IY+EWF++ADSD DGRITG DATKFFA+SNL R++LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKEHQMIYKEWFNYADSDSDGRITGSDATKFFAMSNLPREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+I MQLVSLAQ+G++IT DLL + VDF N +PP MEGLD  L  KKK
Sbjct  61   DSKRQGYLGFTEFIIAMQLVSLAQSGHSITPDLLTSDVDFTNGKPPSMEGLDV-LLVKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            +  K E + NGS   Q SP+++WF  SKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  120  HKQK-EVDANGSSQLQPSPSSNWFS-SKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_007026227.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
 gb|EOY28849.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
Length=574

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME    PI  CSK H+KIY++WF+ ADSDGDGR+TG DATKFF++S LSRQELKQ+WAIA
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF++ MQLVSLAQAGN +T D+L + VD EN+  P MEGLDA     K 
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALAVKSKD  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+  EPE NG+   Q   +A WF +SKSA+K   S+VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  121  STTNGEPEMNGTTHPQVPTSAKWF-TSKSARKTPASAVTSIIDGLKRLYIEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>gb|KHN38249.1| EH domain-containing protein 1 [Glycine soja]
Length=546

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 180/225 (80%), Gaps = 7/225 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IY+EWF++ADSD DGRITG DATKFFA+SNLSR++LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKEHQMIYKEWFNYADSDSDGRITGSDATKFFAMSNLSREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+I MQLVSLAQ+G++IT DLL + VDF N +PP MEGLD  L  KKK
Sbjct  61   DSKRQGYLGFTEFIIAMQLVSLAQSGHSITPDLLTSDVDFTNGKPPSMEGLDV-LLVKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvs-----lssvtsIVDGLKKLYIQNLKP  530
            +  K E + NGS   Q SP+++WF S  + K        LSSVTSI+DGLK+LYIQ LKP
Sbjct  120  HKQK-EVDANGSSQLQPSPSSNWFSSKSTKKASILLLVPLSSVTSIIDGLKRLYIQKLKP  178

Query  531  LEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LEV YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  LEVNYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  223



>ref|XP_004149345.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004167751.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=547

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 182/222 (82%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  CS+ H+KIYQEWF +ADSDGDGRITG DA KFF++S L RQ+LKQVWAIA
Sbjct  1    MEIGSYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAK  359
            DSKRQGYLGFKEFV  MQLVSLAQ+G  +T D+L  +++VD ++L PPRMEGLD  LA K
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEVDLKSLNPPRMEGLDVILAKK  120

Query  360  KKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
             +    N+ E NGS   Q SP ++ + SSKS+KK+ LSSVTSIVDGLK+LYIQ LKPLEV
Sbjct  121  ARKQKSNDHETNGSSKGQ-SPVSASWFSSKSSKKIPLSSVTSIVDGLKRLYIQKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +YRFNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  SYRFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>gb|KGN56098.1| hypothetical protein Csa_3G073890 [Cucumis sativus]
Length=562

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 182/222 (82%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  CS+ H+KIYQEWF +ADSDGDGRITG DA KFF++S L RQ+LKQVWAIA
Sbjct  1    MEIGSYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAK  359
            DSKRQGYLGFKEFV  MQLVSLAQ+G  +T D+L  +++VD ++L PPRMEGLD  LA K
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEVDLKSLNPPRMEGLDVILAKK  120

Query  360  KKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
             +    N+ E NGS   Q SP ++ + SSKS+KK+ LSSVTSIVDGLK+LYIQ LKPLEV
Sbjct  121  ARKQKSNDHETNGSSKGQ-SPVSASWFSSKSSKKIPLSSVTSIVDGLKRLYIQKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +YRFNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  SYRFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>gb|AFK42442.1| unknown [Medicago truncatula]
Length=543

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 182/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IYQ+WF+ ADSDGDGRITG DATKFFA+SNLSRQ LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF+EF+I MQLVSLAQ+G+ IT DLL++ VD +NL+PP +EGLDA LA KK 
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALLAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S  E + NGS  +     +S + SSKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  KQS--ELDVNGS-SQLQPSPSSSWFSSKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_003617631.1| EH-domain-containing protein [Medicago truncatula]
 gb|AET00590.1| calcium-binding EF hand protein [Medicago truncatula]
Length=543

 Score =   289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 182/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IYQ+WF+ ADSDGDGRITG DATKFFA+SNLSRQ LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF+EF+I MQLVSLAQ+G+ IT DLL++ VD +NL+PP +EGLDA LA KK 
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALLAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S  E + NGS  +     +S + SSKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  121  KQS--ELDVNGS-SQLQPSPSSSWFSSKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_009334827.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009334845.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
Length=545

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 180/221 (81%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIYQEWF F DSD DGRIT  DA KFF +SNL+R+ELKQVWA+A
Sbjct  1    MEICSVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  LL++ VD  +L+PP MEGLDA L   KK
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  120

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +  K NE + NG+  +Q SP+A WF   +S+KK+ LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  121  HLHKSNENKVNGTAVQQ-SPSALWFS-PESSKKIPLSSVTSIIDGLKRLYVQKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FN+FVSPL+ NSDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  179  YKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFVKHLLK  219



>ref|XP_010665753.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 182/221 (82%), Gaps = 5/221 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+K+YQ+WF  ADSDGDGRITG DATKFFA+SNLSR +LKQVWA A
Sbjct  1    MEIASGPISSCSKEHQKVYQQWFIVADSDGDGRITGNDATKFFAMSNLSRSDLKQVWAFA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLGFKEFV  MQL+SLAQAG+ +T DLL   V  E+++ P +EGLDA LA KKK
Sbjct  61   DTKRQGYLGFKEFVGAMQLISLAQAGHELTSDLLSNAV-MEDIQLPVLEGLDALLAKKKK  119

Query  366  YTSKN-EPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
             T+   EPE NGSPP   SPA S + SSKS+KKV LS+VTSI DGLK+LY++ LKPLE T
Sbjct  120  TTATYVEPEINGSPP---SPATSAWFSSKSSKKVPLSAVTSITDGLKRLYLEKLKPLETT  176

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRF+DFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  YRFHDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>gb|KDP20684.1| hypothetical protein JCGZ_21155 [Jatropha curcas]
Length=545

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME+    +  CSK H+++Y+EWF+ ADSDGDGRITG DATKF A+SNLSRQELKQVWA+A
Sbjct  1    MELGKGTVGSCSKEHQQMYKEWFNSADSDGDGRITGNDATKFLAMSNLSRQELKQVWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF++ MQL+SLAQAG+ IT D+L      EN++PP MEG+DA L   K 
Sbjct  61   DSKRQGFLGFTEFILAMQLISLAQAGHEITSDILKTTCSIENIKPPLMEGIDALLVKSKG  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             ++  EPE NGS   Q S     F  SKS++K+ L +VTSI+DGLK+LY++ LKPLEVTY
Sbjct  121  SSTDYEPEINGSAQLQPSITGQRFN-SKSSRKMPLIAVTSIIDGLKRLYLEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_006406401.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47854.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=545

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSIAAGSCSKENQMIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP MEGL   +A KK 
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPIMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  121  SSKSSDPSVNGSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009352442.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=550

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 180/221 (81%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK H+KIYQEWF F DSD DGRIT  DA KFF +SNL+R+ELKQVWA+A
Sbjct  1    MEICSVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  LL++ VD  +L+PP M+GLDA L   KK
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMDGLDALLLVNKK  120

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +  K NE + NG+  +Q SP+A WF   +S+KK+ LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  121  HLHKSNENKVNGTAVQQ-SPSALWFS-PESSKKIPLSSVTSIIDGLKRLYVQKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FN+FVSPL+ NSDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  179  YKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFVKHLLK  219



>ref|XP_008449138.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=547

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 181/222 (82%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  CS+ H+KIYQEWF +ADSDGDGRITG DA KFF++S L RQ+LKQVWAIA
Sbjct  1    MEIASYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAK  359
            DSKRQGYLGFKEFV  MQLVSLAQ+G  +T D+L  +++ D ++L PPRMEGLD  LA K
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEDDLKSLNPPRMEGLDVILAKK  120

Query  360  KKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
             +    N+ E NGS   Q  P ++ + SSKS+KK+ LSSVTSIVDGLK+LYIQ LKPLEV
Sbjct  121  ARKQKSNDHETNGSSKGQ-PPVSASWFSSKSSKKIPLSSVTSIVDGLKRLYIQKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  SYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|NP_566657.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 ref|NP_001030731.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 sp|Q94CF0.1|EHD1_ARATH RecName: Full=EH domain-containing protein 1; Short=AtEHD1 [Arabidopsis 
thaliana]
 gb|AAK59418.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42408.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19984.1| AT3G20290 [Arabidopsis thaliana]
 gb|AEE76359.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AEE76360.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
Length=545

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF F+DSDGDGRITG DA KFF +SNL R ELKQ+WAIA
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFSDSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP MEGL   +A KK 
Sbjct  61   DSKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLISDVDFKNINPPTMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  121  SSKSSDPNMNGSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_004491428.1| PREDICTED: EH domain-containing protein 3-like [Cicer arietinum]
Length=543

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 182/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IYQ WFS+ADSDGDGRITG DATKFF++SNLSRQ+LKQVWAIA
Sbjct  1    MEFDPVPIGSCSKEHQNIYQNWFSYADSDGDGRITGNDATKFFSMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF+EF+I MQLVSLAQ+G+ IT DLL + VD ++L+PP +EGLD  L AK K
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLSSDVDLKDLKPPTLEGLDV-LLAKNK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            +  K+  + NGS  +     +S + SSKS KKV LSSVTSI+DGLK+LYIQ LKPLEVTY
Sbjct  120  HKQKDV-DVNGS-SQLQPSLSSSWFSSKSTKKVPLSSVTSIIDGLKRLYIQKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>gb|KJB13767.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=529

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI    I  CSK H+KIYQEWF+FADSD DGRITG DA KFF +SNLSR +LKQVWA A
Sbjct  1    MEIGTGRIGSCSKEHQKIYQEWFNFADSDNDGRITGNDAIKFFGMSNLSRPDLKQVWATA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEFV  MQLVSLAQ G+ I+ DLL+  VDFEN++PP MEGLDA +  KK+
Sbjct  61   DSKRQGFLGFKEFVFAMQLVSLAQEGHQISHDLLNGDVDFENIKPPVMEGLDALIMRKKQ  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  +  E NGS   Q+SPA+ WF  SKS+KK+SLSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  SSKSSSLESNGSSSNQTSPASQWFS-SKSSKKISLSSVTSIIDGLKRLYLQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_004966283.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=544

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P S CSK H+KIYQEWF+ ADSDGDGRITG DA KFF +S LSR +LKQVWAIA
Sbjct  1    MEIGQYPASGCSKEHQKIYQEWFALADSDGDGRITGPDAIKFFGMSKLSRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DS+RQGYLGF EFV  MQLVSLAQAGN IT D L  + D  +L PP MEGLDA LA  K 
Sbjct  61   DSRRQGYLGFPEFVAAMQLVSLAQAGNEITQDSL-KRDDLSSLNPPVMEGLDALLAKSKH  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               + +PE +G P  QS     WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVTY
Sbjct  120  VVKRVDPEMDGFPQEQSPLTNKWFS-SKSSKKIPLTAVTSVIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  KFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|KJB13765.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
 gb|KJB13768.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=545

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI    I  CSK H+KIYQEWF+FADSD DGRITG DA KFF +SNLSR +LKQVWA A
Sbjct  1    MEIGTGRIGSCSKEHQKIYQEWFNFADSDNDGRITGNDAIKFFGMSNLSRPDLKQVWATA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEFV  MQLVSLAQ G+ I+ DLL+  VDFEN++PP MEGLDA +  KK+
Sbjct  61   DSKRQGFLGFKEFVFAMQLVSLAQEGHQISHDLLNGDVDFENIKPPVMEGLDALIMRKKQ  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  +  E NGS   Q+SPA+ WF  SKS+KK+SLSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  121  SSKSSSLESNGSSSNQTSPASQWFS-SKSSKKISLSSVTSIIDGLKRLYLQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_002437485.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
 gb|EER88852.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
Length=544

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 175/220 (80%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P+S CSK H+KIYQEWF+ AD+DGDGRITG DA KFF +S LSR +LKQVWAI+
Sbjct  1    MEIGQYPVSSCSKEHQKIYQEWFALADADGDGRITGPDAIKFFGMSKLSRPDLKQVWAIS  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D++RQGYLGF EFV  MQLVSLAQAGN IT D L  + D  +L PP MEGLDA LA  K 
Sbjct  61   DTRRQGYLGFPEFVTAMQLVSLAQAGNEITQDSL-KRDDLISLNPPVMEGLDALLAKSKH  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               + +PE +G P  QS+    WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVTY
Sbjct  120  LVKRVDPEMDGYPQEQSTLTNKWFS-SKSSKKIPLTAVTSVIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  KFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_010252585.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=536

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 176/221 (80%), Gaps = 11/221 (5%)
 Frame = +3

Query  3    LMEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            +M+I + PI  CSK H+KIYQ+WF++ADSDGDGR+TG DATKF A+S LSR ELK+VWAI
Sbjct  1    MMDIVSGPIGSCSKEHQKIYQDWFNYADSDGDGRLTGNDATKFLAMSKLSRSELKEVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKRQG+LGFKEF+  MQL++LAQAG+ IT+DLL + +D ENL PP MEGL   +A  K
Sbjct  61   ADSKRQGFLGFKEFITAMQLIALAQAGHEITLDLLSSGIDLENLNPPVMEGLTILMAKIK  120

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +           +P +  S  A+WF SS+S+KK+ L+SVTSIVDGLKKLY + LKPLEVT
Sbjct  121  Q-----------APKKPESEKANWFSSSRSSKKLFLNSVTSIVDGLKKLYTEKLKPLEVT  169

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFI HLL+
Sbjct  170  YHFNDFVSPLLTNSDFDARPMVMLLGQYSTGKTTFITHLLK  210



>ref|XP_002885363.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61622.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF FADSDGDGRITG DA KFF +SNL R ELKQ+WAIA
Sbjct  1    MEIESVAAGSCSKENQLIYKEWFEFADSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYL FK+F++ MQLVSLAQ G+ I+ ++L++ VDF+N+ PP MEGL   +A KK 
Sbjct  61   DSKRQGYLAFKDFIVAMQLVSLAQTGHEISHEILNSDVDFKNINPPTMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  121  SSKSSDPNMNGSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009334825.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009334842.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=591

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 179/221 (81%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            + ++  PIS CSK H+KIYQEWF F DSD DGRIT  DA KFF +SNL+R+ELKQVWA+A
Sbjct  47   LNLETVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  106

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  LL++ VD  +L+PP MEGLDA L   KK
Sbjct  107  DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  166

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +  K NE + NG+  +Q SP+A WF   +S+KK+ LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  167  HLHKSNENKVNGTAVQQ-SPSALWFS-PESSKKIPLSSVTSIIDGLKRLYVQKLKPLEVT  224

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FN+FVSPL+ NSDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  225  YKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFVKHLLK  265



>ref|XP_008644157.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 ref|XP_008644158.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 gb|AFW69172.1| hypothetical protein ZEAMMB73_263235 [Zea mays]
Length=544

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P S CSK H+KIYQEWF+ AD+DGDGRITG DA KFF +S LSR +LKQVWAIA
Sbjct  1    MEIGQYPASGCSKEHQKIYQEWFALADADGDGRITGPDAIKFFGMSKLSRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D++RQGYLGF EFV  MQLVSLAQAGN IT D L  + D  +L PP MEGLDA LA  K 
Sbjct  61   DTRRQGYLGFSEFVTAMQLVSLAQAGNEITQDSL-KRDDLSSLNPPVMEGLDALLAKSKH  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               + +PE +G P  QS     WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVTY
Sbjct  120  LVKRVDPEMDGYPQEQSPLTNKWFS-SKSSKKIPLTAVTSVIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  KFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_009334826.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009334843.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=591

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 179/221 (81%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            + ++  PIS CSK H+KIYQEWF F DSD DGRIT  DA KFF +SNL+R+ELKQVWA+A
Sbjct  47   LNLETVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  106

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT  LL++ VD  +L+PP MEGLDA L   KK
Sbjct  107  DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  166

Query  366  YTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +  K NE + NG+  +Q SP+A WF   +S+KK+ LSSVTSI+DGLK+LY+Q LKPLEVT
Sbjct  167  HLHKSNENKVNGTAVQQ-SPSALWFS-PESSKKIPLSSVTSIIDGLKRLYVQKLKPLEVT  224

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FN+FVSPL+ NSDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  225  YKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFVKHLLK  265



>ref|XP_010466211.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIESVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYL FKEF++ MQLVSLAQ G+ I+ ++L++ VDF+N+ PP MEGL   +A KK 
Sbjct  61   DAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSDVDFQNINPPTMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++ + NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEVTY
Sbjct  121  SSKSSDLDINGSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_007142331.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
 gb|ESW14325.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
Length=543

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI  CSK H+ IY++WF+ ADSD DGRITG DATKFF++SNLSRQ+LKQVWAIA
Sbjct  1    MEFDPIPIGSCSKEHQAIYKDWFNCADSDSDGRITGSDATKFFSMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLGF +F+I MQLVSLAQ+G+AIT DL  + VDF NL+PP M+GLDA L  KK 
Sbjct  61   DTKRQGYLGFSDFIIAMQLVSLAQSGHAITPDLRTSDVDFTNLKPPVMDGLDALLVKKK-  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                 E + NGS   Q SP+++WF  SKS KKV LSSVTSI+DGLK+LY+  LKPLE TY
Sbjct  120  -NKHKEVDTNGSSQLQPSPSSNWFS-SKSTKKVPLSSVTSIIDGLKRLYLNKLKPLEATY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>emb|CBI35707.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 182/249 (73%), Gaps = 31/249 (12%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK ++KIYQEWF++ADSD DGRITG DATKFFA+SNLSR ELKQVWAIA
Sbjct  1    MEIASVPISSCSKHNQKIYQEWFNYADSDNDGRITGNDATKFFAMSNLSRSELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLL---------------------DAKVD  302
            DSKRQG+LGF+EF+  MQLVSLAQAGN IT D+L                     D +++
Sbjct  61   DSKRQGFLGFREFITAMQLVSLAQAGNEITSDILKTTGKQNNMRLAHCPTQGNDWDLRIN  120

Query  303  FE---------NLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksa  455
                       NLEPP MEGL+A LA  K  T+  E E NG    Q SP+A WF +SKS 
Sbjct  121  LLLTNTCRTLFNLEPPSMEGLNALLAKNKVSTNNGELELNGDSRPQPSPSAPWF-TSKSV  179

Query  456  kkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTG  635
            KK  L+SVTSI+DGLK+LY + LKPLEVTYR+NDFVSPLLT+SDFDA PMVMLLGQYSTG
Sbjct  180  KKAPLNSVTSIIDGLKRLYNEKLKPLEVTYRYNDFVSPLLTHSDFDAKPMVMLLGQYSTG  239

Query  636  KTTFIKHLL  662
            KTTFIKHLL
Sbjct  240  KTTFIKHLL  248



>gb|KJB69209.1| hypothetical protein B456_011G010900 [Gossypium raimondii]
Length=544

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 176/220 (80%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME  + PI  CSK H+KIY++WF+ ADSD DGR+TG DATKFFA+S LSRQELKQ+WAIA
Sbjct  1    MEASSLPIDSCSKEHQKIYRDWFNIADSDRDGRVTGNDATKFFAMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLG KEF++ MQL+S AQAG+ IT D+L +  D EN+  P MEG+DA LAAKK 
Sbjct  61   DSKRQGYLGLKEFIVAMQLISWAQAGHEITFDILKSSADLENIGLPAMEGVDA-LAAKKD  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            + +    + NGS   Q   +A WF +SKS+KK+  S+VTS+VDGLK+LYI+ LKPLE TY
Sbjct  120  FATNGVHDINGSNHHQVPASAKWF-TSKSSKKIPPSAVTSVVDGLKRLYIEKLKPLESTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  RFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  218



>gb|KJB69208.1| hypothetical protein B456_011G010900 [Gossypium raimondii]
Length=545

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME  + PI  CSK H+KIY++WF+ ADSD DGR+TG DATKFFA+S LSRQELKQ+WAIA
Sbjct  1    MEASSLPIDSCSKEHQKIYRDWFNIADSDRDGRVTGNDATKFFAMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLG KEF++ MQL+S AQAG+ IT D+L +  D EN+  P MEG+DA  A KK 
Sbjct  61   DSKRQGYLGLKEFIVAMQLISWAQAGHEITFDILKSSADLENIGLPAMEGVDALAAKKKD  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            + +    + NGS   Q   +A WF +SKS+KK+  S+VTS+VDGLK+LYI+ LKPLE TY
Sbjct  121  FATNGVHDINGSNHHQVPASAKWF-TSKSSKKIPPSAVTSVVDGLKRLYIEKLKPLESTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  219



>ref|XP_009111201.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Brassica 
rapa]
Length=546

 Score =   281 bits (719),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 177/221 (80%), Gaps = 2/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLA-AKK  362
            D+KRQGYLGFK+F++ MQLVSLAQ G+ I+ D+L + VDF+N+ PP MEGL   +A  K 
Sbjct  61   DAKRQGYLGFKDFIVAMQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKH  120

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
              +  N+   NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV 
Sbjct  121  SSSKSNDLSVNGSPSADASLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVA  179

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  YRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_009145651.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Brassica 
rapa]
Length=543

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 181/220 (82%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY++WF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP M+GL   L AKKK
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL-IVLMAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            ++ K+  + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV Y
Sbjct  120  HSPKSS-DPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  178  QFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLK  217



>ref|XP_010052900.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Eucalyptus 
grandis]
Length=455

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  +  CSK H++IYQEWF FADSDGDGRITG  ATKFFA+S LSRQELKQVWAIA
Sbjct  1    MEIKSGALGSCSKDHQRIYQEWFHFADSDGDGRITGNAATKFFAMSKLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   EF+I MQL+SLAQ G  +T   L  + D E ++PP MEGLDA +A  K 
Sbjct  61   DSKRQGFLSLHEFIIAMQLISLAQEGVELTPGSLKFEADVEKIDPPMMEGLDALVAKSKN  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVT  542
             T   +PE NGS P    P++ WF S    K  +   SVTSIVDGLKKLYI+ LKPLEV 
Sbjct  121  STVVVDPETNGSAPPVPPPSSQWFASKSGRKAQAPQYSVTSIVDGLKKLYIEKLKPLEVA  180

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  181  YRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>ref|XP_010508763.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=563

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI+A     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  19   MEIEAVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  78

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYL FKEF++ MQLVSLAQ G+ I+ ++L++ VDF+N+ PP MEGL   +A KK 
Sbjct  79   DAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSDVDFQNINPPTMEGLGVLMAKKKH  138

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++   NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  139  SSKSSDLSINGSPAADTSLTAQWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  197

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  198  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  237



>ref|XP_010487999.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIESVAAGSCSKENQLIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYL FKEF++ MQLVSLAQ G+ I+ ++L+++VDF+N+ PP MEGL   +A KK 
Sbjct  61   DAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSEVDFQNINPPTMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++ + NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  121  SSKSSDLDINGSPAADTSLTAQWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009603507.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603508.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603510.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 184/223 (83%), Gaps = 9/223 (4%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI+RCSK HEKIYQEWF FADSDGDGR+TG DAT F A+SNL R  LKQVWAIA
Sbjct  1    MEFDTCPINRCSKKHEKIYQEWFCFADSDGDGRLTGKDATNFLAMSNLPRDHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+T D L+A+VDFENL+ P +EGLD +L AKKK
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDFLNAEVDFENLQLPSLEGLD-RLLAKKK  119

Query  366  YTSKNEPEQNGS---PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLE  536
              +K  P+QNGS   P R     A+WF SSKS+KKVS + VTSI+DGLKKLY++ LKPLE
Sbjct  120  RVAKWVPDQNGSLVLPSR-----ANWFSSSKSSKKVSSNYVTSIIDGLKKLYVKKLKPLE  174

Query  537  VTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            VTY F+DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  175  VTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|NP_001058410.1| Os06g0687800 [Oryza sativa Japonica Group]
 dbj|BAD45606.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAD46062.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAF20324.1| Os06g0687800 [Oryza sativa Japonica Group]
 gb|EAZ38080.1| hypothetical protein OsJ_22427 [Oryza sativa Japonica Group]
 dbj|BAG93051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P S  SK H+K YQEWF+FADSDGDGRITG DA KFFA+S L R +LKQVWAIA
Sbjct  1    MEIGQHPASGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT D L  + D  +L PP M+GLDA L   K 
Sbjct  61   DSKRQGYLGFSEFVTAMQLVSLAQAGDEITQDSL-KRDDLGSLNPPTMDGLDALLVKSKH  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            +  + +P+ +G P  QS   + WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVTY
Sbjct  120  HAKRVDPDIDGFPQAQSPATSQWFS-SKSSKKIPLNAVTSVIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  KFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|EAZ02155.1| hypothetical protein OsI_24244 [Oryza sativa Indica Group]
Length=544

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P S  SK H+K YQEWF+FADSDGDGRITG DA KFFA+S L R +LKQVWAIA
Sbjct  1    MEIGQHPASGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQLVSLAQAG+ IT D L  + D  +L PP M+GLDA L   K 
Sbjct  61   DSKRQGYLGFSEFVTAMQLVSLAQAGDEITQDSL-KRDDLGSLNPPTMDGLDALLVKSKH  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            +  + +P+ +G P  QS   + WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVTY
Sbjct  120  HAKRVDPDIDGFPQAQSPATSQWFS-SKSSKKIPLNAVTSVIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  KFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|EYU27374.1| hypothetical protein MIMGU_mgv1a026674mg, partial [Erythranthe 
guttata]
Length=405

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 163/233 (70%), Positives = 187/233 (80%), Gaps = 15/233 (6%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+APISRCSK H+KIYQ+WFSFADSDGDGR+TG DATKFF+LSNL RQ+LK VWAIA
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGADATKFFSLSNLPRQDLKLVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLV+LAQAG+A+T D+L ++VDFENL+ P ++ L A    KK+
Sbjct  61   DSKRQGFLGFKEFITAMQLVTLAQAGHALTSDILSSEVDFENLQTPALDVLGALFTKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV--  539
             +  NEPEQNGSP  QSS AASWF SSKSAKK+SLSSVTSIVDGLK+LYIQ LKPL+   
Sbjct  121  LS--NEPEQNGSPQVQSSLAASWFSSSKSAKKISLSSVTSIVDGLKRLYIQKLKPLKQPI  178

Query  540  ---------TYRFNDFVSPL--LTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
                      + F D  + L   TNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  SLTTLFLPHCFCFFDIYNTLAAYTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  231



>ref|XP_008805597.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I ++PI  CS+ H+KIY+EWFS ADSDGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF+  MQLVSLAQAGN IT D L    + ++L+PP MEGLD  LA  K 
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDAL-THSELDSLKPPVMEGLDILLAKTKP  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+ P+ + S   Q S    WF  SKSAKK+ LSSVTSI+DGLK+LYI+ LKPLEVTY
Sbjct  120  SPKKSNPDPDVSSQPQVSLTTQWFS-SKSAKKIPLSSVTSIIDGLKRLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_008805596.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=549

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I ++PI  CS+ H+KIY+EWFS ADSDGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF+  MQLVSLAQAGN IT D L    + ++L+PP MEGLD  LA  K 
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDAL-THSELDSLKPPVMEGLDILLAKTKP  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+ P+ + S   Q S    WF  SKSAKK+ LSSVTSI+DGLK+LYI+ LKPLEVTY
Sbjct  120  SPKKSNPDPDVSSQPQVSLTTQWFS-SKSAKKIPLSSVTSIIDGLKRLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>ref|XP_010052899.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW77035.1| hypothetical protein EUGRSUZ_D01381 [Eucalyptus grandis]
Length=547

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  +  CSK H++IYQEWF FADSDGDGRITG  ATKFFA+S LSRQELKQVWAIA
Sbjct  1    MEIKSGALGSCSKDHQRIYQEWFHFADSDGDGRITGNAATKFFAMSKLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   EF+I MQL+SLAQ G  +T   L  + D E ++PP MEGLDA +A  K 
Sbjct  61   DSKRQGFLSLHEFIIAMQLISLAQEGVELTPGSLKFEADVEKIDPPMMEGLDALVAKSKN  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVT  542
             T   +PE NGS P    P++ WF S    K  +   SVTSIVDGLKKLYI+ LKPLEV 
Sbjct  121  STVVVDPETNGSAPPVPPPSSQWFASKSGRKAQAPQYSVTSIVDGLKKLYIEKLKPLEVA  180

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  181  YRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>gb|KJB13766.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=544

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI    I  CSK H+KIYQEWF+FADSD DGRITG DA KFF +SNLSR +LKQVWA A
Sbjct  1    MEIGTGRIGSCSKEHQKIYQEWFNFADSDNDGRITGNDAIKFFGMSNLSRPDLKQVWATA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEFV  MQLVSLAQ G+ I+ DLL+   DFEN++PP MEGLDA +  KK+
Sbjct  61   DSKRQGFLGFKEFVFAMQLVSLAQEGHQISHDLLNGD-DFENIKPPVMEGLDALIMRKKQ  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  +  E NGS   Q+SPA+ WF  SKS+KK+SLSSVTSI+DGLK+LY+Q LKPLEVTY
Sbjct  120  SSKSSSLESNGSSSNQTSPASQWFS-SKSSKKISLSSVTSIIDGLKRLYLQKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  HFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  218



>gb|KHG30640.1| EH domain-containing 1 [Gossypium arboreum]
Length=542

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 174/220 (79%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME  + PI  CSK H+KIY++WF+ ADSD DGR+TG D TKFFA+S LSRQELKQ+WAIA
Sbjct  1    MEASSLPIDSCSKEHQKIYRDWFNIADSDRDGRVTGNDGTKFFAMSKLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLG KEF++ MQL+S AQAG+ IT D+L  K+D EN+  P MEG+DA  A KK 
Sbjct  61   DSKRQGYLGLKEFIVAMQLISWAQAGHEITFDIL--KIDLENIGLPAMEGVDALAAKKKD  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            + +    + NGS   Q   +A WF +SKS+KK+  S+VTS+VDGLK+LYI+ LKPLE TY
Sbjct  119  FATNGVHDINGSNHHQVPASAKWF-TSKSSKKIPPSAVTSVVDGLKRLYIEKLKPLESTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  RFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  217



>ref|XP_008805595.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=544

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I ++PI  CS+ H+KIY+EWFS ADSDGDGRITG DA KFFA+S LSR ELKQVWA+A
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF+  MQLVSLAQAGN IT D L    + ++L+PP MEGLD  LA  K 
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDAL-THSELDSLKPPVMEGLDILLAKTKP  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+ P+ + S   Q S    WF  SKSAKK+ LSSVTSI+DGLK+LYI+ LKPLEVTY
Sbjct  120  SPKKSNPDPDVSSQPQVSLTTQWFS-SKSAKKIPLSSVTSIIDGLKRLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|KHN03510.1| EH domain-containing protein 1 [Glycine soja]
Length=545

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 170/213 (80%), Gaps = 1/213 (0%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK   K YQEWF+ ADSDGDGRITG DATKFFALSNLSR +LKQVWAIAD+KRQGY
Sbjct  8    IDSCSKEQLKTYQEWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIADAKRQGY  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV+ MQLV+LAQ G+ I  D+L  ++D EN++ P MEGLDA +A  K  T   +P
Sbjct  68   LGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALIAKTKSLTINAQP  127

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +  G+   Q  P  SW  + KS KK+ LS+VTSI+DGLK+LY++ LKPLEVTYRFNDFVS
Sbjct  128  DIFGTAQPQPFPLNSW-AAPKSVKKLPLSAVTSIIDGLKRLYVERLKPLEVTYRFNDFVS  186

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  187  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_003550477.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 170/213 (80%), Gaps = 1/213 (0%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK   K YQEWF+ ADSDGDGRITG DATKFFALSNLSR +LKQVWAIAD+KRQGY
Sbjct  8    IDSCSKEQLKTYQEWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIADAKRQGY  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV+ MQLV+LAQ G+ I  D+L  ++D EN++ P MEGLDA +A  K  T   +P
Sbjct  68   LGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALIAKTKSLTINAQP  127

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +  G+   Q  P  SW  + KS KK+ LS+VTSI+DGLK+LY++ LKPLEVTYRFNDFVS
Sbjct  128  DIFGTAQPQPFPLNSW-AAPKSVKKLPLSAVTSIIDGLKRLYVERLKPLEVTYRFNDFVS  186

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  187  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_008799457.1| PREDICTED: EH domain-containing protein 1-like [Phoenix dactylifera]
Length=544

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 173/219 (79%), Gaps = 2/219 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M++  +P   C++  + IYQ+WFS ADSDGDGR+TG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MDLVTSPKKSCTREQQNIYQQWFSVADSDGDGRVTGNDALKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSK QG+LGF+EF+I MQLV+LAQ G+ IT D+L   +D EN++PP MEGLD  LA  K+
Sbjct  61   DSKHQGFLGFQEFIIAMQLVALAQEGHEITQDVL-THLDLENIKPPVMEGLDILLAKNKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               +N+P  + SP  Q    A WF  SKS+KK+ L SVTSI+DGLKKLYI+ LKPLEVTY
Sbjct  120  SPKRNDPNVDESPQIQPPSPARWFS-SKSSKKIPLKSVTSIIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            RF+DFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  179  RFHDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>ref|XP_006296699.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
 gb|EOA29597.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
Length=545

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQ+WAIA
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFK+F++ MQLVSLAQ G+ I+ ++L++ VDF++++ P MEGL   +A KK 
Sbjct  61   DSKRQGYLGFKDFIVAMQLVSLAQTGHEISHEVLNSDVDFKDIKSPTMEGLGVLMAKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++   NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  121  SSKSSDLNINGSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>gb|KFK39351.1| hypothetical protein AALP_AA3G233100 [Arabis alpina]
Length=543

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY+EWF FADSDGDGRITG DA KFF+ SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSKSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP MEGL   ++ KK 
Sbjct  61   DSKRQGFLGFKEFIVAMQLVSLAQTGHEISHEVLQSDVDFQNMNPPTMEGLGVLMSKKKH  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +  ++P  NGSP   +S  A WF  SKS+KK+SLS+VTSIVDGLK+LYIQ +KPLEV Y
Sbjct  121  SSKSSDP--NGSPTADASLTAHWFS-SKSSKKISLSAVTSIVDGLKRLYIQKVKPLEVAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  QFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>ref|XP_003529656.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 170/213 (80%), Gaps = 1/213 (0%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK   K YQ+WF+ ADSDGDGRITG DATKFFALSNLSR +LKQVWAIAD+KRQGY
Sbjct  8    IDSCSKEQLKTYQDWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIADAKRQGY  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV+ MQLV+LAQ G+ I  D+L  ++D EN++ P MEGLDA +A  K  T   +P
Sbjct  68   LGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALIAKTKSLTVNAQP  127

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +  G+   Q  P  SW  + KS KK+ LS+VTSI+DGLK+LY++ LKPLEVTYRFNDFVS
Sbjct  128  DVFGTAIPQPLPLNSW-AAPKSVKKLPLSAVTSIIDGLKRLYVERLKPLEVTYRFNDFVS  186

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  187  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_009145649.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=544

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 181/221 (82%), Gaps = 4/221 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY++WF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAK-VDFENLEPPRMEGLDAQLAAKK  362
            D+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L +  VDF+N+ PP M+GL   L AKK
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDAVDFKNMNPPVMDGL-IVLMAKK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            K++ K+  + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV 
Sbjct  120  KHSPKSS-DPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVA  177

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  178  YQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLK  218



>ref|XP_009770782.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
sylvestris]
Length=543

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 183/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI++CSK HEKIYQEWF+FADSDGDGR+TG DAT F A+SNLSR  LKQVWAIA
Sbjct  1    MEFDTFPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLAMSNLSRDHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+T D L+A+VDFE L+ P MEGLD  L AKKK
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K  P++NGS     S  A+WF SSKSAKKVS + VTSI+DGLKKLY++ LKPLEVTY
Sbjct  120  RVAKWAPDRNGS--LMLSSGANWFSSSKSAKKVSSNYVTSIIDGLKKLYVKKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             F+DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  HFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_009770776.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770777.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770778.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 183/220 (83%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI++CSK HEKIYQEWF+FADSDGDGR+TG DAT F A+SNLSR  LKQVWAIA
Sbjct  1    MEFDTFPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLAMSNLSRDHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+T D L+A+VDFE L+ P MEGLD  L AKKK
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K  P++NGS     S  A+WF SSKSAKKVS + VTSI+DGLKKLY++ LKPLEVTY
Sbjct  120  RVAKWAPDRNGS--LMLSSGANWFSSSKSAKKVSSNYVTSIIDGLKKLYVKKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             F+DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  HFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_006467361.1| PREDICTED: EH domain-containing protein 1-like [Citrus sinensis]
Length=547

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 169/222 (76%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI  +PI+ CSK H+KIY+EWF  ADSDGDGRITG DATKF ALS LSRQELKQ+WA+A
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLALSKLSRQELKQIWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   EFV  M+LVSLAQAG  IT D+L +    EN EPP MEGL+  +A  K 
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  366  YTSKNEPEQNGSPPRQSS--PAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
                ++P  NGS   QS    +A WF +SKS KK   S+VTSI+DGLK+LY + LKPLE 
Sbjct  121  LKMDSKPAVNGSASVQSQILSSAQWF-TSKSVKKTPPSAVTSIIDGLKRLYNEKLKPLEA  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  TYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>ref|XP_006449830.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
 gb|ESR63070.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
Length=547

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 169/222 (76%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI  +PI+ CSK H+KIY+EWF  ADSDGDGRITG DATKF ALS LSRQELKQ+WA+A
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLALSKLSRQELKQIWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   EFV  M+LVSLAQAG  IT D+L +    EN EPP MEGL+  +A  K 
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  366  YTSKNEPEQNGSPPRQSS--PAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
                ++P  NGS   QS    +A WF +SKS KK   S+VTSI+DGLK+LY + LKPLE 
Sbjct  121  LKMDSKPAVNGSASVQSQILSSAQWF-TSKSVKKTPPSAVTSIIDGLKRLYNEKLKPLEA  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  TYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>ref|XP_006657273.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=545

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 173/221 (78%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRC-SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI   P S   SK H+K YQEWF+FADSDGDGRITG DA KFFA+S L R +LKQVWAI
Sbjct  1    MEIGQNPASGGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKRQGYLGF EFV  MQLV+LAQ G+ I+ D L  + D  NL PP M+GL+A L   K
Sbjct  61   ADSKRQGYLGFSEFVTAMQLVALAQVGDEISQDSL-KREDLGNLNPPTMDGLEALLMKSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
             +  + +P+ +G P  QSS  + WF  SKS+KK+ L++VTS++DGLKKLYI+ LKPLEVT
Sbjct  120  HHAKRVDPDSDGFPQAQSSATSQWFS-SKSSKKIPLTAVTSVIDGLKKLYIEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  YKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_003563453.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 170/221 (77%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAA-PISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI    P S CSK H+KIYQEWF+FADSDGDGRITG DA KFFA+S L R +LKQVWAI
Sbjct  1    MEIGGQYPGSSCSKEHQKIYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKR GYLGF EFV  MQLVSLAQAGN IT D L  + D  +L PP  EGLD  LA  K
Sbjct  61   ADSKRLGYLGFGEFVTAMQLVSLAQAGNEITQDSL-KRDDLSSLNPPVTEGLDVLLAKSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
                + +P+ +G P  Q      WF  SKS+KK+ L++VTS++DGLKKLY++ LKPLEVT
Sbjct  120  HLAKRVDPDIDGFPQAQPPSTNHWFS-SKSSKKIPLTAVTSVIDGLKKLYVEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  YKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009145650.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Brassica 
rapa]
Length=544

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 178/220 (81%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY++WF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP M+GL   L AKKK
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL-IVLMAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S    + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV Y
Sbjct  120  KHSPKSSDPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVAY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  179  QFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLK  218



>gb|KDO78396.1| hypothetical protein CISIN_1g008954mg [Citrus sinensis]
Length=547

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 168/222 (76%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI  +PI+ CSK H+KIY+EWF  ADSDGDGRITG DATKF  LS LSRQELKQ+WA+A
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   EFV  M+LVSLAQAG  IT D+L +    EN EPP MEGL+  +A  K 
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  366  YTSKNEPEQNGSPPRQSS--PAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
                ++P  NGS   QS    +A WF +SKS KK   S+VTSI+DGLK+LY + LKPLE 
Sbjct  121  LKMDSKPAVNGSASVQSQILSSAQWF-TSKSVKKTPPSAVTSIIDGLKRLYSEKLKPLEA  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDFVSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  TYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>ref|XP_011097835.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Sesamum 
indicum]
Length=538

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 173/210 (82%), Gaps = 6/210 (3%)
 Frame = +3

Query  33   RCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLG  212
            RCS+ H+KIYQ WF+F DSDGDGR+T  DA+KFF++SNL R +LKQ+WAIADSKRQG+L 
Sbjct  8    RCSQEHQKIYQTWFAFVDSDGDGRLTANDASKFFSMSNLPRPDLKQMWAIADSKRQGFLE  67

Query  213  FKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQ  392
            FKEFV+ MQLVSLAQAG+ +T D+L+ +VDFENL PP MEGLD  LA KK+ +   EPE 
Sbjct  68   FKEFVLAMQLVSLAQAGHTLTRDILNTEVDFENLPPPTMEGLDKLLAKKKRLS---EPE-  123

Query  393  NGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            NGS  RQSS + + F  S  + K+S +SVTSI+DGLK+LY++ LKPLE TY+FN+FVSP 
Sbjct  124  NGS-QRQSSSSVNLFH-SSKSSKMSGASVTSIIDGLKRLYMKKLKPLEDTYQFNNFVSPS  181

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  182  LTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  211



>ref|XP_010913401.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=543

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 172/220 (78%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I ++P+S CS+ H+KIY+EWFS ADSDGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MDIVSSPMSTCSREHQKIYKEWFSAADSDGDGRITGTDAIKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF+  MQLVSLAQAGN IT D L    + + L+PP MEGLD  L AK  
Sbjct  61   DSKRQGFLGLNEFITAMQLVSLAQAGNEITQDAL-THSELDLLKPPVMEGLDI-LLAKTT  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K+ P+ + S     S    WF  SKS KK+ LSSVTSI+DGLK+LYI+ LKPLEVTY
Sbjct  119  SPKKSNPDLDVSSQPPVSLTTQWFS-SKSTKKIPLSSVTSIIDGLKRLYIEKLKPLEVTY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_009398680.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M + ++ ++ C K  +KIYQEWFS AD DGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MNLVSSSVASCPKEKQKIYQEWFSVADKDGDGRITGNDALKFFAMSKLSRSELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L  +EF+  MQLV+LAQ G+ +T DLL+   D ENL+PP MEGLD +LA  K+
Sbjct  61   DSKRQGFLDLQEFINAMQLVALAQEGHEMTPDLLN-HADLENLKPPVMEGLDIRLAKSKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K++P  +  P  QS  +A WF  SKSAKK+   SVTSI+DGLKKLYI+ LKPLEVTY
Sbjct  120  SEKKSDPCSDVPPQPQSPASARWFN-SKSAKKIPSKSVTSIIDGLKKLYIEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  QFSDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  218



>ref|XP_007211540.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
 gb|EMJ12739.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
Length=537

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = +3

Query  21   APISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQ  200
             P+S C K ++K+YQEWF+  DSDGDGRITG +ATKFFALS LSRQELKQVWA AD KRQ
Sbjct  2    GPVSLCPKEYQKVYQEWFNLVDSDGDGRITGNEATKFFALSKLSRQELKQVWATADKKRQ  61

Query  201  GYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            G+LGF EF+  MQL+SLAQ  + +T D+L  +VD+EN+ PP MEGLDA L+AK K ++ N
Sbjct  62   GFLGFTEFITAMQLISLAQE-HELTPDILKTEVDWENINPPLMEGLDA-LSAKTKSSTTN  119

Query  381  EPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDF  560
              E NGS   QS P A WF  SKS KK+ L +VTSI DGLK+LY + LKPLE+TYRFNDF
Sbjct  120  GLEVNGS--IQSQPPAQWF-GSKSVKKLPLIAVTSITDGLKRLYNEKLKPLELTYRFNDF  176

Query  561  VSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            VSP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  177  VSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  211



>ref|XP_006352527.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI+RCSK +EKIYQEWFS ADSDGDGR+ G DAT F A+SNL R++LKQVWAIA
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEF+  MQLVSLAQAG+A+T D  +A VDFENL+PP MEGLD  L AKKK
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K  P+ NGS    S   A+WF SSKSAKKV  + VTSI+DGLKKLY + LKPLEV Y
Sbjct  120  RVAKWVPDGNGSLTLSSR--ANWFSSSKSAKKVPSNYVTSIIDGLKKLYAKKLKPLEVAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             ++DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  HYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_009393691.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = +3

Query  24   PISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQG  203
            P    SK   +IY EWFSFADSDGDGRITG DA KFF+LSNLSR +LKQ+WAIADSKRQG
Sbjct  4    PSYSTSKEQARIYNEWFSFADSDGDGRITGNDAIKFFSLSNLSRPDLKQIWAIADSKRQG  63

Query  204  YLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNE  383
            +LGF EFV  MQLV+LAQAGN IT D L A  D E L PP MEGLD  L+  K  T K +
Sbjct  64   FLGFGEFVTAMQLVALAQAGNEITQDTL-ANADLEKLNPPVMEGLDTLLSRNKASTKKID  122

Query  384  PEQN-GSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDF  560
            PE +  S P+       WF  SKSAKK+ LS VTSI+DGLK+LY++ LKPLEVTYRFNDF
Sbjct  123  PEIDVNSKPQNPPSTVQWFS-SKSAKKIPLSQVTSIIDGLKRLYVEKLKPLEVTYRFNDF  181

Query  561  VSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            VSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  182  VSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>ref|XP_010928404.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=545

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 173/220 (79%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M++  +P   C++  + IYQ+WFS ADSDGDGR+TG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MDLVTSPKKSCTREQQNIYQQWFSVADSDGDGRVTGNDALKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAA-KK  362
            DSKRQG+LGF+EF++ MQLV+LAQ G+ IT D+L   VD EN++PP M GLD  LA   K
Sbjct  61   DSKRQGFLGFQEFIVAMQLVALAQEGHEITQDVL-THVDLENVKPPVMGGLDILLAKFNK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            +   +++P  + +P  Q    A WF  SKS+KK+ L SVTSI+DGLKKLYI+ LKPLEVT
Sbjct  120  RSAKRDDPTVDEAPKTQPPSPARWFS-SKSSKKIPLKSVTSIIDGLKKLYIEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  179  YQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_011097837.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Sesamum 
indicum]
Length=537

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 172/210 (82%), Gaps = 7/210 (3%)
 Frame = +3

Query  33   RCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLG  212
            RCS+ H+KIYQ WF+F DSDGDGR+T  DA+KFF++SNL R +LKQ+WAIADSKRQG+L 
Sbjct  8    RCSQEHQKIYQTWFAFVDSDGDGRLTANDASKFFSMSNLPRPDLKQMWAIADSKRQGFLE  67

Query  213  FKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQ  392
            FKEFV+ MQLVSLAQAG+ +T D+L+ +VDFENL PP MEGLD  LA K+     +EPE 
Sbjct  68   FKEFVLAMQLVSLAQAGHTLTRDILNTEVDFENLPPPTMEGLDKLLAKKR----LSEPE-  122

Query  393  NGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            NGS  RQSS + + F  S  + K+S +SVTSI+DGLK+LY++ LKPLE TY+FN+FVSP 
Sbjct  123  NGS-QRQSSSSVNLFH-SSKSSKMSGASVTSIIDGLKRLYMKKLKPLEDTYQFNNFVSPS  180

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  181  LTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  210



>gb|EMT05303.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=545

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 171/221 (77%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDA-APISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI    P S CSK H+KIY++WF+ ADSDGDGRITG DA KFFA+S+L R +LKQVWAI
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIKFFAMSSLPRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKR GYLGF EF+  MQLVSLAQAGN I+ D L  + D  +  PP MEGLDAQLA  K
Sbjct  61   ADSKRLGYLGFGEFITAMQLVSLAQAGNEISQDSLQ-REDLISFNPPVMEGLDAQLAKSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
                + + + +G P  Q      WF  SKS+KK+ L++VTS++DGLK+LYI+ LKPLEVT
Sbjct  120  HLAKRVDQDMDGFPQAQGPSTNHWFN-SKSSKKIPLTAVTSVIDGLKRLYIEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  YKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_004951833.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=597

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 166/222 (75%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEI-DAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI  AA    CSK H++IY EWF+ AD DGDGR+TG DAT FF +S LSR +LKQVWAI
Sbjct  51   MEIARAAAGVACSKEHQRIYAEWFALADPDGDGRVTGADATSFFVMSGLSRADLKQVWAI  110

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKRQGYLGF EFV  MQLVSLAQAGN IT D L+ + D   L+PP MEG+D  +A  K
Sbjct  111  ADSKRQGYLGFAEFVTAMQLVSLAQAGNEITQDSLN-REDLSTLDPPVMEGVDELVARSK  169

Query  363  KYTSKNEPEQNGSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
                +  PE NG+P  Q+S    WF   S    ++ L++VTS++DGLK+LY++ LKPLEV
Sbjct  170  AVVKRVHPEDNGTPQVQASSIYHWFGSKSAQKAQMPLTAVTSVIDGLKRLYLEKLKPLEV  229

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             YRFNDF SPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  230  AYRFNDFASPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  271



>ref|NP_001045954.1| Os02g0158100 [Oryza sativa Japonica Group]
 dbj|BAD28029.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAD28174.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAF07868.1| Os02g0158100 [Oryza sativa Japonica Group]
 gb|EEC72529.1| hypothetical protein OsI_05922 [Oryza sativa Indica Group]
 gb|EEE56343.1| hypothetical protein OsJ_05448 [Oryza sativa Japonica Group]
Length=543

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 162/213 (76%), Gaps = 2/213 (1%)
 Frame = +3

Query  30   SRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYL  209
            S CSK H KIY  WF+ AD DGDGR+TG DATKFFA+S LSR +LKQVWAIAD+KRQG+L
Sbjct  6    SACSKEHHKIYAGWFAVADPDGDGRVTGADATKFFAMSGLSRADLKQVWAIADTKRQGFL  65

Query  210  GFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPE  389
            GF EFV  MQLVSLAQAG  IT D L  + D  +L+PP MEGLD  LA  K    +  PE
Sbjct  66   GFGEFVAAMQLVSLAQAGEEITQDSL-KREDLSSLDPPVMEGLDELLARSKAGVKRVHPE  124

Query  390  QNGSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +NG+P  Q   A SWF S  + K    L++VTS++DGLK+LY++ LKPLEV YRFNDF S
Sbjct  125  ENGAPQVQVHSANSWFSSKSAKKMQVPLTAVTSVIDGLKRLYVEKLKPLEVAYRFNDFAS  184

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  185  PLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  217



>ref|XP_011096032.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
 ref|XP_011096033.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=547

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PIS CSK   KIYQ WF+FADSD DGR+TG DAT FFA+SNLS+ ELKQVWAIA
Sbjct  1    MEIASGPISSCSKEQLKIYQTWFNFADSDRDGRLTGNDATSFFAMSNLSKHELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF   MQL+S AQ G  +T +LL + V  E L PP MEGLDA L   K 
Sbjct  61   DSKRQGFLGFKEFTTAMQLISFAQEGYELTSELLKSTVSLETLNPPYMEGLDALLEKNKG  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvsl-ssvtsIVDGLKKLYIQNLKPLEVT  542
              S    E NG+   Q +P  S F +    K     ++VTS++DGLK LY + LKPLE T
Sbjct  121  PVSNGNYETNGNIQVQPTPPKSLFSTHSKKKNNISLTAVTSVIDGLKILYNEKLKPLEAT  180

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFNDFVSP LT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  YRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  221



>ref|XP_008224739.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
 ref|XP_008224740.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
Length=537

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 170/213 (80%), Gaps = 5/213 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            +S C K ++K+YQEWF+  DSDGDGRITG +ATKFFALS LSRQELKQVWA AD KRQG+
Sbjct  4    VSLCPKEYQKVYQEWFNLVDSDGDGRITGNEATKFFALSKLSRQELKQVWATADKKRQGF  63

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF EF+  MQL+SLAQ  + +T D+L  +VD+EN+ PP MEGLDA L+AK K ++ N  
Sbjct  64   LGFTEFITAMQLISLAQE-HELTPDVLKTEVDWENINPPLMEGLDA-LSAKTKSSTTNGL  121

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            E NGS   QS P A WF  SKS KK+ L +VTSI DGLK+LY + LKPLE+TYRFNDFVS
Sbjct  122  EVNGS--IQSQPPAQWF-GSKSVKKLPLIAVTSITDGLKRLYNEKLKPLELTYRFNDFVS  178

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            P LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  PSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  211



>ref|XP_009145648.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=545

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK ++ IY++WF FADSDGDGRITG DA KFF++SNL R ELKQVWAIA
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAK-VDFENLEPPRMEGLDAQLAAKK  362
            D+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L +  VDF+N+ PP M+GL   L AKK
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDAVDFKNMNPPVMDGL-IVLMAKK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            K  S    + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV 
Sbjct  120  KKHSPKSSDPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVA  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  179  YQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLK  219



>ref|XP_009779278.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779279.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779280.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779281.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779282.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779283.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 179/220 (81%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D +PI++CSK HEKIYQEWF+FADSDGDGR+TG DAT F  +SNL R  LKQVWAIA
Sbjct  1    MEFDNSPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLEMSNLPRDHLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEF+  MQLVSLAQAG+A+T D L+A+VDFE L+ P MEGLD  L AKKK
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K  P++NGS    S   A+WF SSKS+KKV    VTSI+DGLKKLY++ LKPLEV Y
Sbjct  120  RVAKWAPDRNGSLVLSSR--ANWFSSSKSSKKVPSHYVTSIIDGLKKLYVKKLKPLEVAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             F+DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  HFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>gb|EMS68080.1| EH domain-containing protein 1 [Triticum urartu]
Length=545

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 171/221 (77%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDA-APISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI    P S CSK H+KIY++WF+ ADSDGDGRITG DA +FFA+S+L R +LKQVWAI
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIRFFAMSSLPRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKR GYLGF EF+  MQLVSLAQAGN I+ D L  + D  +  PP MEGLDAQLA  K
Sbjct  61   ADSKRLGYLGFGEFITAMQLVSLAQAGNEISQDSLQ-REDLISFNPPVMEGLDAQLAKSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
                + + + +G P  Q      WF  SKS+KK+ L++VTS++DGLK+LYI+ LKPLEVT
Sbjct  120  HLAKRVDQDMDGFPQAQGPSTNHWFN-SKSSKKIPLTAVTSVIDGLKRLYIEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  YKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>gb|KHN28769.1| EH domain-containing protein 1 [Glycine soja]
Length=822

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 169/213 (79%), Gaps = 1/213 (0%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK   K YQ+WF+ ADSDGDGRITG DATKF ALSNLSR +LKQVWAIAD+KRQGY
Sbjct  285  IDSCSKEQLKTYQDWFNLADSDGDGRITGNDATKFSALSNLSRSQLKQVWAIADAKRQGY  344

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV+ MQLV+LAQ G+ I  D+L  ++D EN++ P MEGLDA +A  K  T   +P
Sbjct  345  LGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALIAKTKSLTVNAQP  404

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +  G+   Q  P  SW  + KS KK+ LS+VTSI+DGLK+LY++ LKPLEVTYRFNDFVS
Sbjct  405  DVFGTAIPQPLPLNSW-AAPKSVKKLPLSAVTSIIDGLKRLYVERLKPLEVTYRFNDFVS  463

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  464  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  496



>ref|XP_002518408.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF43795.1| EH-domain-containing protein, putative [Ricinus communis]
Length=545

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI    +  CSK  + +Y++WF+ ADSDGDGRI+G DAT FFA SNLSR +LKQVWA+A
Sbjct  1    MEIGKGWMGSCSKEDQHLYKDWFNSADSDGDGRISGTDATNFFAFSNLSRHDLKQVWALA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  +QL+SLAQAG+ IT DLL +     N++PP MEG+DA L  K+ 
Sbjct  61   DSKRQGFLGFTEFIAALQLISLAQAGHEITSDLLKSTSSMGNIKPPVMEGIDALLTQKEG  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             T+ +EP  NG    QSS  A  +  SKS++K+ L +VTSI+DGLK+LYI+ LKPLEVTY
Sbjct  121  STTNSEPGINGFSQLQSSTTAQRYN-SKSSRKMPLIAVTSIIDGLKRLYIEKLKPLEVTY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF+SPLLTNS+FDA PMVMLLGQYSTGKTTFIKH+LR
Sbjct  180  RFNDFMSPLLTNSEFDAKPMVMLLGQYSTGKTTFIKHILR  219



>ref|XP_010675784.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   PI+ CSK   KIYQ+WF+FADSDGDGR+TG DA KFF +S+L R++LKQVWAIA
Sbjct  1    MEISGTPINLCSKESRKIYQDWFNFADSDGDGRLTGNDAIKFFGMSDLPREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LG +EF+  MQLVSLAQ+G+ I  DLL A+ D++ LEPP M+GL+ ++  KK 
Sbjct  61   DAKRQGFLGLQEFITAMQLVSLAQSGHTINQDLLIAEFDWDTLEPPSMQGLNEKITKKKS  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                +    N S   Q + ++ WF SS+S+KK+ LSSVTSI+DGLK LY QNLKPLE +Y
Sbjct  121  KLRSD--SGNESKKLQPTRSSHWFTSSRSSKKIQLSSVTSIIDGLKTLYNQNLKPLETSY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FN+F SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  HFNNFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  218



>ref|XP_007154001.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25995.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=392

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 171/213 (80%), Gaps = 3/213 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK     Y+EWF+ ADSDGDGRI+G DAT FF+LSNLSR +LKQVWAIAD+KRQG+
Sbjct  8    IHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIADAKRQGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFVI MQLV+LAQAG  I  D+ +A++D EN++ P MEGLDA +A  K   S  +P
Sbjct  68   LGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALIAKTKSLHS--QP  125

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            + +G+   Q     SW  + KSAKK+SLS+VTSI+DGLK+LY++ LKPLEVTY+FNDFVS
Sbjct  126  DASGTAQPQLLSLNSW-AAPKSAKKLSLSAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVS  184

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  185  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_007153999.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25993.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=406

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 171/213 (80%), Gaps = 3/213 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK     Y+EWF+ ADSDGDGRI+G DAT FF+LSNLSR +LKQVWAIAD+KRQG+
Sbjct  8    IHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIADAKRQGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFVI MQLV+LAQAG  I  D+ +A++D EN++ P MEGLDA +A  K   S  +P
Sbjct  68   LGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALIAKTKSLHS--QP  125

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            + +G+   Q     SW  + KSAKK+SLS+VTSI+DGLK+LY++ LKPLEVTY+FNDFVS
Sbjct  126  DASGTAQPQLLSLNSW-AAPKSAKKLSLSAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVS  184

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  185  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_006586764.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=539

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 168/209 (80%), Gaps = 2/209 (1%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK   K YQEWF+ ADSDGDGRI+G DATKFFALSNLSR +LKQ+WA+AD KRQG+LGF 
Sbjct  7    SKEETKTYQEWFNLADSDGDGRISGNDATKFFALSNLSRSQLKQLWALADVKRQGFLGFT  66

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNG  398
            EFV  MQLVSLAQAG  +  D+L  ++D EN++PP +EGLDA L A+   T    PE NG
Sbjct  67   EFVTAMQLVSLAQAGQELKSDILKTQIDKENIKPPVLEGLDA-LVAQMSLTISAPPEVNG  125

Query  399  SPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLT  578
            +P  Q  P   WF  SKS+KK+SL+SVTSI+DGLK+LYI+ LKPLEV Y++NDFVSPLLT
Sbjct  126  TPQPQVFPTNRWF-GSKSSKKLSLNSVTSIIDGLKRLYIERLKPLEVAYQYNDFVSPLLT  184

Query  579  NSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            N+DFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  185  NTDFDAKPMVMLLGQYSTGKTTFIKHLLK  213



>ref|XP_006646902.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 165/213 (77%), Gaps = 3/213 (1%)
 Frame = +3

Query  30   SRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYL  209
            S CSK H++IY  WF+ AD DGDGR+TG DAT+FFA+S LSR +LKQVWAIAD++RQG+L
Sbjct  6    SCCSKEHQRIYAGWFAVADPDGDGRVTGADATRFFAMSGLSRADLKQVWAIADTRRQGFL  65

Query  210  GFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPE  389
            GF EFV  MQLVSLAQAGN IT D L  + D  +L+PP M GLD +L A+ K   +  PE
Sbjct  66   GFGEFVAAMQLVSLAQAGNEITQDSL-KREDLSSLDPPVMAGLD-ELLARSKAVKRVHPE  123

Query  390  QNGSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            +NG+P  Q   A SWF S  + K    L++VTS++DGLK+LYI+ LKPLEV YRFNDF S
Sbjct  124  ENGTPQVQVPSANSWFSSKSAKKMQDPLTAVTSVIDGLKRLYIEKLKPLEVAYRFNDFAS  183

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  184  PLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  216



>ref|XP_002453335.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
 gb|EES06311.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
Length=547

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 163/222 (73%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEI-DAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI  AA    CSK H++IY EWF+ AD DGDGR+TG DAT FF +S LSR +LKQVWAI
Sbjct  1    MEIARAAAGVACSKEHQRIYAEWFALADPDGDGRVTGADATSFFGMSALSRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKRQGYLGF EFV  MQLVSLAQAGN IT D L  + D   L+PP MEG+D  LA  K
Sbjct  61   ADSKRQGYLGFAEFVTAMQLVSLAQAGNEITEDSL-KREDLSTLDPPVMEGVDGLLARSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
                +  P+ NG+   Q+     WF   +    ++ L++VTS++DGLK+LY++ LKPLEV
Sbjct  120  AVVKRIHPDDNGTAQVQAPSMYHWFGSKAAQKVQMPLTAVTSVIDGLKRLYVEKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             YR+NDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  AYRYNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|XP_006602183.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=541

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 173/220 (79%), Gaps = 5/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME+D  P   CSK ++ +Y+EWF++AD+DGDGR TG +A KFFA+SNLSRQELKQVWAIA
Sbjct  1    MELDIVPFDSCSKEYQNLYEEWFNYADADGDGRFTGNEAIKFFAMSNLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKR+GYLGFKEFVI MQLVSL Q G +IT DLL +     + +PP M+GLD  L  KK+
Sbjct  61   DSKREGYLGFKEFVIAMQLVSLGQCGYSITHDLLTSDA-MRHAKPPIMDGLDVLLTKKKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                   E + SPP   SP + WF ++KSAKKV  SSVTSIVDGLK+LY+Q LKPLEVTY
Sbjct  120  KQKDK--ELSVSPP-HPSPTSKWF-TAKSAKKVPASSVTSIVDGLKRLYLQKLKPLEVTY  175

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             +NDFVSPLLTNSDFDA PMV+LLGQYSTGKTTFIKH+L+
Sbjct  176  HYNDFVSPLLTNSDFDAKPMVLLLGQYSTGKTTFIKHMLK  215



>ref|XP_006352528.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
tuberosum]
Length=541

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 177/220 (80%), Gaps = 5/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI+RCSK +EKIYQEWFS ADSDGDGR+ G DAT F A+SNL R++LKQVWAIA
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEF+  MQLVSLAQAG+A+T D  +A VDFENL+PP MEGLD  L AKKK
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +K  P+ + +     S  A+WF SSKSAKKV  + VTSI+DGLKKLY + LKPLEV Y
Sbjct  120  RVAKWVPDGSLT----LSSRANWFSSSKSAKKVPSNYVTSIIDGLKKLYAKKLKPLEVAY  175

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             ++DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  176  HYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  215



>dbj|BAJ95881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 170/221 (77%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDA-APISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI    P S CSK H+KIY++WF+ ADSDGDGRITG DA +FFA+S+L R +LKQVWAI
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIRFFAMSSLPRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKR GYLGF EF+  MQLVSLAQ+GN I+ D L  + D  +  PP MEGLDA LA  K
Sbjct  61   ADSKRLGYLGFSEFITAMQLVSLAQSGNEISQDSLQ-REDLISFNPPVMEGLDALLAKSK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
                + + + +G P  Q      WF  SKS+KK+ L++VTS++DGLK+LYI+ LKPLEVT
Sbjct  120  HLAKRVDHDMDGFPQAQGPSTNHWFN-SKSSKKIPLTAVTSVIDGLKRLYIEKLKPLEVT  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  YKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>dbj|BAB02809.1| unnamed protein product [Arabidopsis thaliana]
Length=524

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 167/220 (76%), Gaps = 22/220 (10%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI++     CSK ++ IY+EWF F+DSDGDGRITG DA KFF +SNL R ELKQ+WAIA
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFSDSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP ME           
Sbjct  61   DSKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLISDVDFKNINPPTME-----------  109

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                      GSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV Y
Sbjct  110  ----------GSPAADTSLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAY  158

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  159  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  198



>ref|XP_004500109.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 178/220 (81%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+     CSK +  +YQEWF++ADSDGDGR TG +ATKFFA+S+LSRQELKQVWAIA
Sbjct  1    MEIDSIAFDSCSKENLTLYQEWFNYADSDGDGRFTGNEATKFFAMSHLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKR+GYLGFKEFVI MQLVSL Q+G++IT DLL   +  +N++PP+MEGLDA +A KK+
Sbjct  61   DSKREGYLGFKEFVISMQLVSLGQSGHSITHDLLTTDI-LQNIKPPQMEGLDALVAKKKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                   + N SP    SP+++WF  +KS KKV  SSVTSI+DGLK+LYIQ LKPLEV Y
Sbjct  120  KQKDK--DVNASPSPLPSPSSNWFS-AKSTKKVPASSVTSIIDGLKRLYIQKLKPLEVAY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            R+NDFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  177  RYNDFVSPLLNNSDFDAKPMVMLLGQYSTGKTTFIKHMLQ  216



>gb|KEH33921.1| EPS15-like domain protein [Medicago truncatula]
Length=543

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 177/220 (80%), Gaps = 6/220 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI   P    SK +  +YQEWF++AD+DGDGR TG +ATKFFA+SNLSRQELKQVWAIA
Sbjct  4    MEIVTVPNDSNSKENLTLYQEWFNYADADGDGRFTGTEATKFFAMSNLSRQELKQVWAIA  63

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKR+GYLGFKEFVI MQLVSL Q+G++IT DLL + +  +N++PP+MEGLDA +A KK+
Sbjct  64   DSKREGYLGFKEFVISMQLVSLGQSGHSITQDLLTSDL-IKNVKPPKMEGLDALVAKKKR  122

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                 +   +  P    SP+  WF  +KS+KK+S SSVTSI+DGLK+LYIQ LKPLEV Y
Sbjct  123  KHKDKDRSVSPLP----SPSDKWFS-AKSSKKISASSVTSIIDGLKRLYIQKLKPLEVAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  178  RFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLQ  217



>ref|XP_010327191.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 177/222 (80%), Gaps = 3/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME D  PI+RCSK +EKIYQEWFS ADSDGDGR+ G DAT F A+SNL R++LKQVWAIA
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEF+  MQLVSLAQAG+A+T D  +A VDFENL+PP MEGLD  L AKKK
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDG-LLAKKK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvs--lssvtsIVDGLKKLYIQNLKPLEV  539
              +K  P+ N +     S  A+WF SSKSAKKVS   + VTSI DGLKKLY + LKPLEV
Sbjct  120  RVAKWVPDSNEAGSLSLSSRANWFSSSKSAKKVSVPSNYVTSITDGLKKLYAKKLKPLEV  179

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             Y ++DFVSPLL NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  180  AYHYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLR  221



>gb|EYU33672.1| hypothetical protein MIMGU_mgv1a004199mg [Erythranthe guttata]
Length=539

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 175/219 (80%), Gaps = 7/219 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +A I RCSK H+KIYQ WFS+ DSDGDGR+T  DA+KFF +SNLSRQ+LKQVWAIA
Sbjct  1    MEIGSARIGRCSKEHQKIYQSWFSYVDSDGDGRLTANDASKFFTMSNLSRQDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D KRQG+LGF EFV  MQLVSLAQAG+ +T D+L ++VDFENL+PP MEGLDA L  KK+
Sbjct  61   DMKRQGFLGFNEFVAAMQLVSLAQAGHNLTSDILKSEVDFENLQPPAMEGLDALLPKKKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +     EQNGS   Q   AA+WF  S  + KVS + VTSIVDGLKKLY++ LKPLE TY
Sbjct  121  SSGA---EQNGS---QMQLAANWFS-SSKSAKVSSTPVTSIVDGLKKLYLKKLKPLETTY  173

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            +FNDFVSP L NSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  174  KFNDFVSPSLINSDFDAKPMVMLLGQYSTGKTTFIKHLL  212



>ref|XP_003574764.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 165/221 (75%), Gaps = 3/221 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI AA +  CSK H+KIY +WF+ AD DGDGR+TG DATKFFA+S LSR +LKQVWAIA
Sbjct  1    MEIAAAAVG-CSKEHQKIYADWFALADPDGDGRVTGSDATKFFAMSGLSRSDLKQVWAIA  59

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF   MQLVSLAQAG  IT + L  + D  +L+PP M+GLD  LA    
Sbjct  60   DSKRQGYLGFGEFAAAMQLVSLAQAGKEITQNSLKLE-DLSSLDPPVMKGLDELLARSMA  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
              +    E+N +P  Q+  A +WF   S    +  L++VTS+VDGLK+LY++ LKPLEV 
Sbjct  119  IVNVVRKEENDTPQVQAPFANNWFGSKSAKKMQTPLTAVTSVVDGLKRLYVEKLKPLEVA  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  YRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>dbj|BAJ86819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
            CSK H++IY +WF+ AD DGDGR+TG DATKFFA+S LSR +LKQVWAIADSKRQGYLGF
Sbjct  12   CSKEHQRIYADWFALADPDGDGRVTGADATKFFAMSGLSRADLKQVWAIADSKRQGYLGF  71

Query  216  KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQN  395
             EF   MQLVSLAQAGN IT D L  + D  + +PP M+GLD  LA      +   P++N
Sbjct  72   GEFAAAMQLVSLAQAGNEITQDSL-KREDLSSFDPPVMKGLDELLARSMAIVNVVRPQEN  130

Query  396  GSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            G+   Q+    SWF S  S K  + L++VTS++DGLK+LYI+ LKPLEV YRFNDF SPL
Sbjct  131  GTSQVQAPSTNSWFSSKSSKKIQTPLTAVTSVIDGLKRLYIEKLKPLEVAYRFNDFASPL  190

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  191  LTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|XP_003547274.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
 gb|KHN32982.1| EH domain-containing protein 1 [Glycine soja]
Length=539

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 167/209 (80%), Gaps = 2/209 (1%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK   K YQEWF  ADSDGDGRI+G DAT FFALSNLSR +LKQ+WA+AD KRQG+LGF 
Sbjct  7    SKEETKTYQEWFDLADSDGDGRISGNDATNFFALSNLSRSQLKQLWALADVKRQGFLGFT  66

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNG  398
            EFV  MQLVSLAQAG+ +  D+L  ++D EN++PP ++GL+A L A+K       PE NG
Sbjct  67   EFVTAMQLVSLAQAGHELNSDILKTQIDKENIKPPVLDGLEA-LVAQKSLAISAPPEVNG  125

Query  399  SPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLT  578
            +P  Q  P   WF  SKS+KK+SL+SVTSI+DGLK+LYI+ LKPLEV Y++NDFVSPLLT
Sbjct  126  TPQPQVFPTNRWF-GSKSSKKLSLNSVTSIIDGLKRLYIERLKPLEVAYQYNDFVSPLLT  184

Query  579  NSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            N+DFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  185  NTDFDAKPMVMLLGQYSTGKTTFIKHLLK  213



>gb|EMT01492.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=556

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 168/231 (73%), Gaps = 12/231 (5%)
 Frame = +3

Query  6    MEI-DAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEI  +A    CSK H++IY +WF+ AD DGDGR+TG DATKFFA+S LSR +LKQVWAI
Sbjct  1    MEIARSAAAVGCSKEHQRIYADWFAIADPDGDGRVTGADATKFFAMSGLSRADLKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            ADSKRQGYLGF EF   MQLVSLAQAGN IT D L  + D  +L+PP M+GLD  LA   
Sbjct  61   ADSKRQGYLGFGEFAAAMQLVSLAQAGNEITQDSL-KREDLSSLDPPEMKGLDELLARSM  119

Query  363  KYTSKNEPEQN---------GSPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLY  512
               +   P++N         G+P  Q+    SWF S  + K  + L++VTS++DGLK+LY
Sbjct  120  AIVNVVRPQENGNQSAPFSHGTPQVQAPSTNSWFSSKSAKKIQTPLTAVTSVIDGLKRLY  179

Query  513  IQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            I+ LKPLEV YRFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  IEKLKPLEVAYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  230



>ref|XP_010538746.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=543

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 159/215 (74%), Gaps = 4/215 (2%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            + PI  C+K H+KIY+EWF+ ADSDGD RI+G DAT FFA+S LSRQELKQVWA+ADSKR
Sbjct  6    SIPIGSCTKEHQKIYKEWFNIADSDGDDRISGNDATIFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ IT DLL   VD +++EPP +EGL+  L  K      
Sbjct  66   QGFLGLAEFITAMKLVSLAQDGHEITSDLLKGSVDIKSIEPPVLEGLE-NLKQKASKACT  124

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
            N  E+NG+   Q  P A WF+        +  +V +IVDGLK+LY + LKPLE+TY FND
Sbjct  125  NA-EENGATQPQVVPKAPWFK--SKPITKAPENVVTIVDGLKRLYNEKLKPLEMTYHFND  181

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  182  FASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  216



>ref|XP_007154000.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25994.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=543

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 171/213 (80%), Gaps = 3/213 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CSK     Y+EWF+ ADSDGDGRI+G DAT FF+LSNLSR +LKQVWAIAD+KRQG+
Sbjct  8    IHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIADAKRQGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFVI MQLV+LAQAG  I  D+ +A++D EN++ P MEGLDA +A  K   S  +P
Sbjct  68   LGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALIAKTKSLHS--QP  125

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            + +G+   Q     SW  + KSAKK+SLS+VTSI+DGLK+LY++ LKPLEVTY+FNDFVS
Sbjct  126  DASGTAQPQLLSLNSW-AAPKSAKKLSLSAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVS  184

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  185  PLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>gb|KHN40844.1| EH domain-containing protein 1 [Glycine soja]
Length=541

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 168/211 (80%), Gaps = 4/211 (2%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK   K YQEWF+ ADSDGDGRI+G DATKFFALSNLSR +LKQ+WA+AD KRQG+LGF 
Sbjct  7    SKEETKTYQEWFNLADSDGDGRISGNDATKFFALSNLSRSQLKQLWALADVKRQGFLGFT  66

Query  219  EFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQ  392
            EFV  MQLVSLAQAG  +  D+L   +K D EN++PP +EGLDA L A+   T    PE 
Sbjct  67   EFVTAMQLVSLAQAGQELKSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTISAPPEV  125

Query  393  NGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            NG+P  Q  P   WF  SKS+KK+SL+SVTSI+DGLK+LYI+ LKPLEV Y++NDFVSPL
Sbjct  126  NGTPQPQVFPTNRWF-GSKSSKKLSLNSVTSIIDGLKRLYIERLKPLEVAYQYNDFVSPL  184

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LTN+DFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  185  LTNTDFDAKPMVMLLGQYSTGKTTFIKHLLK  215



>ref|XP_004486203.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK     YQEWF+ ADSDGDGRI+G DATKFFALSNLSR +LKQ+WA++D+KRQG+LGF 
Sbjct  7    SKEETATYQEWFNLADSDGDGRISGNDATKFFALSNLSRPQLKQLWALSDTKRQGFLGFP  66

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNG  398
            EFV  MQLVSLAQAG  +  D+L  ++D EN++PP MEGLD  +A  K  T    PE N 
Sbjct  67   EFVTAMQLVSLAQAGYELNSDILQTQMDKENVQPPVMEGLDTLVAKTKSLTISVPPEVNV  126

Query  399  SPPRQSSPAASWFQssksakkvs-lssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLL  575
            +   Q     SWF S   + K     +VTSIVDGLK+LYI+ LKPLEVTYR+NDFVSPLL
Sbjct  127  TVQPQPFTTNSWFTSKSKSSKKLPPYAVTSIVDGLKRLYIERLKPLEVTYRYNDFVSPLL  186

Query  576  TNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  187  TNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>ref|XP_010455719.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 160/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+I M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSKQKASKTN  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N     Q +  A W++    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  VDVEDNVVTQPQVTAKAPWYK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_006396726.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
 gb|ESQ38179.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
Length=544

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 159/215 (74%), Gaps = 3/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA++DSKR
Sbjct  6    AISIGTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVSDSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ +T DLL   VD +++EPP +EGL+  ++ +K     
Sbjct  66   QGFLGLAEFITAMKLVSLAQEGHEVTPDLLKGSVDMKSVEPPVLEGLENIVSKQKSSNPY  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N + P Q +    WF+    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  TDDEDNVTQP-QVTAKVPWFK--SKSVIKPQVNVVTIVDGLKRLYAEKLKPLEVTYRFND  182

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  183  FASPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>ref|XP_009390977.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M + A+  + CSK  +KIYQ+WF++AD DGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   +F+  MQLV+LAQAG  IT D+L +  D ENL+ P MEGLDA LA  K+
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVL-SHADLENLKLPVMEGLDALLAKSKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
               K++   + SP      +A+WF  SK++KKV LSSVTSI+DGLKKLYI+ LKPLEV Y
Sbjct  120  SAKKSDHRLDASPQHLLPASAAWFN-SKASKKVPLSSVTSIIDGLKKLYIEKLKPLEVAY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FN+FVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  QFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  218



>ref|XP_010538744.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538745.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            + PI  C+K H+KIY+EWF+ ADSDGD RI+G DAT FFA+S LSRQELKQVWA+ADSKR
Sbjct  6    SIPIGSCTKEHQKIYKEWFNIADSDGDDRISGNDATIFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ IT DLL   VD +++EPP +EGL+       K  + 
Sbjct  66   QGFLGLAEFITAMKLVSLAQDGHEITSDLLKGSVDIKSIEPPVLEGLENLKQKASKACTN  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             E    G+   Q  P A WF+        +  +V +IVDGLK+LY + LKPLE+TY FND
Sbjct  126  AEENVAGATQPQVVPKAPWFK--SKPITKAPENVVTIVDGLKRLYNEKLKPLEMTYHFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|NP_001266688.1| EH-domain-containing protein 1 [Zea mays]
 gb|ACG43126.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
            C K H++IY EWF+ AD DGDGR+TG DAT FFA+S LSR +LKQVWAIADS+RQGYLGF
Sbjct  12   CCKEHQRIYAEWFALADPDGDGRVTGADATSFFAMSALSRADLKQVWAIADSRRQGYLGF  71

Query  216  KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQN  395
             EFV  MQLVSLAQAGN IT D L  + D   L+PP MEG+D  LA  K    +  P+ N
Sbjct  72   AEFVTAMQLVSLAQAGNEITQDSL-KREDLSTLDPPVMEGVDELLARSKAVVKRVHPDDN  130

Query  396  GSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            G+   Q+     WF   S    ++ L++VTS++DGLK+LY++ LKPLEV YR+NDF  PL
Sbjct  131  GTTQAQAPSIYHWFGSKSAQKVQMPLTAVTSVIDGLKRLYVEKLKPLEVAYRYNDFSHPL  190

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LTNSDF+A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  191  LTNSDFEAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|NP_001140588.1| uncharacterized protein LOC100272658 [Zea mays]
 gb|ACF84132.1| unknown [Zea mays]
 gb|AFW66483.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
            C K H++IY EWF+ AD DGDGR+TG DAT FFA+S LSR +LKQVWAIADS+RQGYLGF
Sbjct  12   CCKEHQRIYAEWFALADPDGDGRVTGADATSFFAMSALSRADLKQVWAIADSRRQGYLGF  71

Query  216  KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQN  395
             EFV  MQLVSLAQAGN IT D L  + D   L+PP MEG+D  LA  K    +  P+ N
Sbjct  72   AEFVTAMQLVSLAQAGNEITQDSL-KREDLSTLDPPVMEGVDELLARSKAVVKRVHPDDN  130

Query  396  GSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            G+   Q+     WF   S    ++ L++VTS++DGLK+LY++ LKPLEV YR+NDF  PL
Sbjct  131  GTTQAQAPSIYHWFGSKSAQKVQMPLTAVTSVIDGLKRLYVEKLKPLEVAYRYNDFSHPL  190

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LTNSDF+A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  191  LTNSDFEAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|XP_010433120.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDG ++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGSCLKEHQKIYKEWFNIADSDGDGHVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+I M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSKQKSSKTN  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N + P Q +  A W++    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  VDVEDNVTQP-QVTAKAPWYK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  182

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  183  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>gb|KJB45560.1| hypothetical protein B456_007G312100 [Gossypium raimondii]
Length=510

 Score =   259 bits (662),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 154/220 (70%), Gaps = 36/220 (16%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI A  I  CSK H+KIY+EWF  ADSD DGR+TG +A  F ++SNLSRQELKQVWAIA
Sbjct  1    MEIGAPRIGSCSKEHQKIYKEWFDVADSDNDGRVTGNNAINFLSMSNLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGFKEFVI MQLVSL Q GN ++ D+L   VDFEN++PP+MEGLD  +   ++
Sbjct  61   DSKRQGYLGFKEFVIAMQLVSLVQDGNELSHDILKGDVDFENVKPPKMEGLDELI---QR  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            Y S                                  VTSI DGLKKLY + LKPLEVTY
Sbjct  118  YLSN---------------------------------VTSIQDGLKKLYTRKLKPLEVTY  144

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKH+L+
Sbjct  145  CFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHMLK  184



>ref|XP_009114593.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=545

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  +  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISMGTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LV+LAQ G+ IT DLL   VD  ++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAY  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N + P+     A WF+    A      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  ADDEDNVTQPQVVKEKAPWFK--SKAIIKPQVNVVTIVDGLKRLYAEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_002874791.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51050.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY++WF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGTCLKEHQKIYKDWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ IT DLL   VD +++E P +EGL+  ++  K   + 
Sbjct  66   QGFLGLSEFITAMKLVSLAQEGHEITSDLLKGSVDMKSVELPVLEGLENVVSKLKVAKTN  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E+N     Q +  A WF+    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  VDVEENVVTKPQVTAKAPWFK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_010433113.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDG ++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGSCLKEHQKIYKEWFNIADSDGDGHVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+I M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSKQKSSKTN  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N     Q +  A W++    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  VDVEDNVVTQPQVTAKAPWYK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_004293342.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 169/220 (77%), Gaps = 3/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  CSK H+KIY++WF+F DSDGDGRITG +  KFFA+S LSR ELKQVWA A
Sbjct  1    MEIGSGPIGSCSKEHQKIYRDWFNFVDSDGDGRITGNEGAKFFAMSKLSRPELKQVWASA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EF+  MQL+S AQ  + ++ D+L  +VD+EN++PP MEG+DA L    K
Sbjct  61   DSKRQGFLGFSEFITAMQLISFAQ-DHELSPDVLKTEVDWENIKPPVMEGVDA-LMTYTK  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
             +S N    NG+    + P+A    +SKS K++  ++VTSIVDGLK+LYI+ LKPLE  Y
Sbjct  119  NSSTNGVAMNGNGITHNQPSAER-TASKSVKRLPPNAVTSIVDGLKRLYIEKLKPLEAAY  177

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF +PLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  178  RFNDFGNPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  217



>ref|XP_006352380.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=547

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 165/224 (74%), Gaps = 7/224 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + P++  +K  EKIYQ WF+FADSDGDGRITG DA K F+LSNLS+ ELKQVWAIA
Sbjct  1    MEIVSVPVASFTKEDEKIYQNWFNFADSDGDGRITGNDAIKLFSLSNLSKPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EFV  MQL+SLAQ G+ ++ DLL +K + E L PP MEGLDA  +    
Sbjct  61   DSKRQGFLGFNEFVTAMQLISLAQDGSELSSDLLKSKANMELLSPPSMEGLDALFSKTSG  120

Query  366  YTSKNEPEQNGS----PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPL  533
               KN    NG+    PP   SP   + + S+   + SL++VTS+ DGLKKLY + LKPL
Sbjct  121  SLMKNLSGTNGTIQVLPP---SPINMFSRKSRKKIQPSLTAVTSVTDGLKKLYNEKLKPL  177

Query  534  EVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            E+TYRFNDF SP LT SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  178  ELTYRFNDFASPALTESDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|XP_006287437.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
 gb|EOA20335.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
Length=545

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGSCLKEHQKIYKEWFTIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ IT DLL   VD +++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLAEFITAMKLVSLAQEGHEITSDLLKGSVDMKSVELPVLEGLENVVSKQKASKTH  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E +     Q +  A W++    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  126  VDVEDDVVTQPQVTAKAPWYK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>emb|CDX94536.1| BnaC09g23000D [Brassica napus]
Length=547

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LV+LAQ G+ IT DLL   VD + +E P +EGL+  + +K+K +  
Sbjct  66   QGFLGLTEFITAMKLVTLAQEGHEITSDLLKGSVDMKTVELPVLEGLENVVVSKQKASKA  125

Query  378  NEPEQNG--SPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRF  551
               +++   + P+  +  A WF+    A      +V +IVDGLK+LY + LKPLEVTYRF
Sbjct  126  YAVDEDNVVTQPQAVTAKAPWFK--SKAIIKPQVNVVTIVDGLKRLYAEKLKPLEVTYRF  183

Query  552  NDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            NDF SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  NDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  220



>ref|XP_010455720.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 160/215 (74%), Gaps = 3/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+I M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  + ++K   + 
Sbjct  66   QGFLGLAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLE-NVVSQKASKTN  124

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N     Q +  A W++    +      +V +IVDGLK+LY + LKPLEVTYRFND
Sbjct  125  VDVEDNVVTQPQVTAKAPWYK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFND  182

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  183  FASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>ref|XP_004507655.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Cicer 
arietinum]
Length=542

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 6/214 (3%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CS      YQ+WF+FADSDGDGRI+G DATKFFALSNLSR +LKQVWAIAD+KR+G+
Sbjct  8    IGSCSNEQRNTYQQWFNFADSDGDGRISGNDATKFFALSNLSRPQLKQVWAIADTKRKGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV  MQL+S+ QAG  +  D+L  ++D EN++PP M+G+DA +A  +      + 
Sbjct  68   LGFEEFVTAMQLISVGQAGYDLNSDILKTEIDNENIKPPVMDGIDALVAKTESSAINAQS  127

Query  387  EQNGS-PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFV  563
            ++ G+  PR   P +S     KS KK+ L++VTSI+DGLK+LY+  LKPLEVTYRFNDFV
Sbjct  128  DEFGTGQPRPFPPVSS-----KSVKKLPLNAVTSIIDGLKRLYVDRLKPLEVTYRFNDFV  182

Query  564  SPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  183  SPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  216



>ref|XP_009390978.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M + A+  + CSK  +KIYQ+WF++AD DGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   +F+  MQLV+LAQAG  IT D+L +  D ENL+ P MEGLDA LA ++ 
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVL-SHADLENLKLPVMEGLDALLAVRQL  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S+   + + SP      +A+WF  SK++KKV LSSVTSI+DGLKKLYI+ LKPLEV Y
Sbjct  120  LLSEISDDVSASPQHLLPASAAWFN-SKASKKVPLSSVTSIIDGLKKLYIEKLKPLEVAY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FN+FVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  179  QFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  218



>ref|NP_974517.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|AEE82530.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=545

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 159/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKRQG+
Sbjct  9    IGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGF  68

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LG  EF+  M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  ++ +K   +  + 
Sbjct  69   LGLSEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVDV  128

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            E N + P Q +    WF+    +      +V +IVDGLK+LY + LKPLEVTYRFNDF S
Sbjct  129  EDNVTKP-QVTAKTPWFK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFNDFAS  185

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            P+LT+SDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  186  PVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLL  217



>ref|XP_004507654.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Cicer 
arietinum]
Length=567

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 6/214 (3%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  CS      YQ+WF+FADSDGDGRI+G DATKFFALSNLSR +LKQVWAIAD+KR+G+
Sbjct  8    IGSCSNEQRNTYQQWFNFADSDGDGRISGNDATKFFALSNLSRPQLKQVWAIADTKRKGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV  MQL+S+ QAG  +  D+L  ++D EN++PP M+G+DA +A  +      + 
Sbjct  68   LGFEEFVTAMQLISVGQAGYDLNSDILKTEIDNENIKPPVMDGIDALVAKTESSAINAQS  127

Query  387  EQNGS-PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFV  563
            ++ G+  PR   P +S     KS KK+ L++VTSI+DGLK+LY+  LKPLEVTYRFNDFV
Sbjct  128  DEFGTGQPRPFPPVSS-----KSVKKLPLNAVTSIIDGLKRLYVDRLKPLEVTYRFNDFV  182

Query  564  SPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  183  SPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  216



>ref|XP_004145425.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   257 bits (657),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I+  SK H KI+ EWF  ADSDGDGR+TG DA +FF++S+LSR ELKQVWA+A
Sbjct  1    MEIGSGAIASSSKEHLKIFHEWFGLADSDGDGRVTGNDAIQFFSMSHLSRAELKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQL+SLAQAG  +  D+L      E ++ P  EGLDA     K+
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDILKKAAGMEEIKLPVPEGLDALAVKTKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                ++PE NG+      P+  WF ++KS  K+S ++VTSI+DGLKKLY + LKPLE TY
Sbjct  121  LAISSQPETNGTFQPMPPPSTPWF-ATKSGSKISHTAVTSIIDGLKKLYNEKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_007145728.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
 gb|ESW17722.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
Length=540

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 173/220 (79%), Gaps = 6/220 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME+   P+    K ++ +Y+EWF++ADSDGDGR TG +A KFF +SNLSRQELKQ+WAIA
Sbjct  1    MELAIVPVDSSFKDNQTLYEEWFNYADSDGDGRFTGHEAIKFFTMSNLSRQELKQIWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKR+GYLGFKEFV  MQLVSL Q G +IT DLL + V   +++PP M+GLDA +A K++
Sbjct  61   DSKREGYLGFKEFVTAMQLVSLGQCGYSITHDLLTSDV-MRHVKPPTMDGLDALVAKKRR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                   + + SP  Q SPA++WF  +KS KKV  SSVTSIVDGLK+LY+Q LKPLEV Y
Sbjct  120  KNKDK--DLSVSP--QPSPASNWF-LAKSVKKVPSSSVTSIVDGLKRLYLQKLKPLEVAY  174

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            R+NDFVSPLLTNSDFDA PM++LLGQYSTGKTTFIKH+LR
Sbjct  175  RYNDFVSPLLTNSDFDAKPMILLLGQYSTGKTTFIKHMLR  214



>emb|CDY16689.1| BnaA09g20670D [Brassica napus]
Length=546

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISIGTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LV+LAQ G+ IT DLL   VD  ++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAY  125

Query  378  NEPEQN-GSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFN  554
             + E N  + P+     A WF+    A      +V +IVDGLK+LY + LKPLEVTYRFN
Sbjct  126  ADDEDNVVTQPQVVKEKAPWFK--SKAIIKPQVNVVTIVDGLKRLYAEKLKPLEVTYRFN  183

Query  555  DFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            DF SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  DFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  219



>ref|NP_567299.2| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 sp|B3LF48.1|EHD2_ARATH RecName: Full=EH domain-containing protein 2; Short=AtEHD2 [Arabidopsis 
thaliana]
 gb|ACE79044.1| At4g05520 [Arabidopsis thaliana]
 gb|AEE82529.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=546

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 157/212 (74%), Gaps = 2/212 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKRQG+
Sbjct  9    IGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGF  68

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LG  EF+  M+LVSLAQ G+ IT DLL   +D +++E P +EGL+  ++ +K   +  + 
Sbjct  69   LGLSEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVDV  128

Query  387  EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVS  566
            E N     Q +    WF+    +      +V +IVDGLK+LY + LKPLEVTYRFNDF S
Sbjct  129  EDNVVTKPQVTAKTPWFK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTYRFNDFAS  186

Query  567  PLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            P+LT+SDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  187  PVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_004157728.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 163/220 (74%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I+  SK H KI+ EWF  ADSDGDGR+TG DA +FF++S+LSR ELKQVWA+A
Sbjct  1    MEIGSGAIASSSKEHLKIFHEWFGLADSDGDGRVTGNDAIQFFSMSHLSRAELKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQL+SLAQAG  +  D+L      E ++ P +EGLDA     K+
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDILKKAAGMEEIKLPVLEGLDALAVKTKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                ++ E NG+      P+  WF ++KS  K+S ++VTSI+DGLKKLY + LKPLE TY
Sbjct  121  LAISSQHETNGTFQPMPPPSTPWF-ATKSGSKISHTAVTSIIDGLKKLYNEKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_011000650.1| PREDICTED: EH domain-containing protein 1-like [Populus euphratica]
Length=545

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +3

Query  9    EIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIAD  188
            EI  +  S  SK  ++IY+EWF+  DSDGDGR+TG DATKFF++SNLSRQ+LKQVWA+AD
Sbjct  3    EIGKSAGSSFSKEQQQIYKEWFNLVDSDGDGRLTGNDATKFFSMSNLSRQQLKQVWALAD  62

Query  189  SKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKY  368
            SKRQG+LGF EFV  MQLVSLAQAG+ +T D +      E+++PP M+G+DA L AK K 
Sbjct  63   SKRQGFLGFTEFVTAMQLVSLAQAGHELTPDTIKTASKMEDVKPPLMDGIDA-LLAKNKS  121

Query  369  TSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYR  548
            +  +E + NGS   +       F  +KS++K+ L++VTSI+DGLK+LYI+ LKPLE TYR
Sbjct  122  SRISENDINGSTQLRLPTGTPQF-GAKSSRKMPLNAVTSIIDGLKRLYIEKLKPLEATYR  180

Query  549  FNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            FNDFVSPLLT SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  181  FNDFVSPLLTTSDFDARPMVMLLGQYSTGKTTFIKHLLR  219



>ref|XP_009114592.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=546

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  +  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKR
Sbjct  6    AISMGTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LV+LAQ G+ IT DLL   VD  ++E P +EGL+  ++ +K   + 
Sbjct  66   QGFLGLTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAY  125

Query  378  NEPEQN-GSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFN  554
             + E N  + P+     A WF+    A      +V +IVDGLK+LY + LKPLEVTYRFN
Sbjct  126  ADDEDNVVTQPQVVKEKAPWFK--SKAIIKPQVNVVTIVDGLKRLYAEKLKPLEVTYRFN  183

Query  555  DFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            DF SP+LTNSDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  DFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  219



>ref|XP_007147670.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
 gb|ESW19664.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
Length=535

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 163/207 (79%), Gaps = 2/207 (1%)
 Frame = +3

Query  45   AHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEF  224
            +  K YQEWF+ ADSDGDGRI+G +ATKFFALSNLSR +LKQ+W +AD KRQG+LGF EF
Sbjct  5    SRSKEYQEWFNLADSDGDGRISGNEATKFFALSNLSRSQLKQLWTLADVKRQGFLGFPEF  64

Query  225  VIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSP  404
            V  MQLVSLAQAG  +  D+L  +VD EN++PP +EGLDA L A+K  T     + NG  
Sbjct  65   VTAMQLVSLAQAGQELNSDILKTQVDKENIKPPVLEGLDA-LLAQKNLTITTLSDVNGIA  123

Query  405  PRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNS  584
              Q  P   WF  SKS+KK+ L+SVTSI+DGLK+LYI+ LKPLEV YR+NDFVSPLLTN+
Sbjct  124  QPQVLPTNWWF-GSKSSKKLPLNSVTSIIDGLKRLYIERLKPLEVAYRYNDFVSPLLTNT  182

Query  585  DFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            DFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  183  DFDAKPMVMLLGQYSTGKTTFIKHLLR  209



>gb|KFK32206.1| hypothetical protein AALP_AA6G211000 [Arabis alpina]
Length=545

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 2/215 (1%)
 Frame = +3

Query  18   AAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKR  197
            A  I+ C K H+KIY+EWF+ ADSDGDGR++G DATKFF +S LSRQELKQVWAIADSKR
Sbjct  6    AISINTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFTMSKLSRQELKQVWAIADSKR  65

Query  198  QGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK  377
            QG+LG  EF+  M+LVSLAQ G+ I  +LL + +D +++E P +EGL+  ++ +K     
Sbjct  66   QGFLGLAEFITAMKLVSLAQEGHEINSELLKSAIDMKSVELPVLEGLENVISKQKTSKQY  125

Query  378  NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFND  557
             + E N     Q +  A WF+    +      +V +IVDGLKKLY + LKPLEVTYRFND
Sbjct  126  TDVEDNVVSQPQVTAKAPWFK--SKSIIKPQVNVVTIVDGLKKLYNEKLKPLEVTYRFND  183

Query  558  FVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            F SP+LT+SDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  184  FASPVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLL  218



>ref|XP_003594167.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES64418.1| calcium-binding EF hand protein [Medicago truncatula]
Length=540

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK     YQ+WF+ ADSDGDGRI+G +ATKFFALSNLSR +LKQ+WA+AD+KRQG+LGF 
Sbjct  7    SKEETATYQQWFNLADSDGDGRISGNEATKFFALSNLSRSQLKQLWALADNKRQGFLGFS  66

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNG  398
            EFV  MQLVSLAQAG  +  D+L  ++D EN++PP +EGLD  +A  KK T     E N 
Sbjct  67   EFVTAMQLVSLAQAGYELNSDILKIQMDKENVKPPVIEGLDTLVAQTKKLTITTPSEVNV  126

Query  399  SPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLT  578
            +   Q     SWF +SKS+KK+  S+VTSIVDGLK+LY + LKPLEV YR+NDFVSPLLT
Sbjct  127  TSKPQPFLPNSWF-TSKSSKKLPPSAVTSIVDGLKRLYTEKLKPLEVAYRYNDFVSPLLT  185

Query  579  NSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            NSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  186  NSDFDAKPMVMLLGQYSTGKTTFIKHLLK  214



>ref|XP_004250246.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME+ + P++  +K  EKIYQ WF+FADSDGDGRITG DA K F+LSNLS+ ELKQVWAIA
Sbjct  1    MEVVSVPVASFTKEEEKIYQNWFNFADSDGDGRITGNDAIKLFSLSNLSKAELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGF EFV  MQL+SLAQ G+ ++ DLL +K + E L PP MEGLDA  +    
Sbjct  61   DSKRQGFLGFNEFVTAMQLISLAQDGSELSPDLLKSKANMELLSPPSMEGLDALSSKTNG  120

Query  366  YTSKNEPEQNGS-PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
               K+    NG+   R  SP   + + S+   + SL++VTS+ DGLKKLY + LKPLE+T
Sbjct  121  SLMKDLSGTNGTIQVRPPSPINMFSRKSRKKIQPSLTAVTSVTDGLKKLYNEKLKPLELT  180

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            YRFN+F SP LT SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  YRFNEFSSPALTESDFDAKPMVMLLGQYSTGKTTFIKHLLK  221



>ref|XP_008458980.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=545

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I   SK   KI+QEWF  ADSDGDGR+TG DA +FF++S+LSR ELKQVWA+A
Sbjct  1    MEIGSGAIGSSSKHQLKIFQEWFGLADSDGDGRVTGNDAIQFFSMSHLSRGELKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EFV  MQL+SLAQAG  +  D+L      E ++ P +EGLDA     K+
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDILKKAAGMEEIKLPVLEGLDALAVKSKR  120

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                ++ E NG+      P+  WF +SKS  K+S ++VTSI+DGLKKLY + LKPLE TY
Sbjct  121  LAVSSQHETNGTFQPMPPPSTPWF-ASKSGSKISHTAVTSIIDGLKKLYNEKLKPLEATY  179

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  180  RFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  219



>ref|XP_009769722.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=548

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI ++ IS CSK  +KIYQ WF+F DSDGDGRITG DATK F+LSNLSR ELKQVWAIA
Sbjct  1    MEIVSSSISSCSKEDQKIYQNWFNFVDSDGDGRITGNDATKLFSLSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LGF EFV  MQL+SLAQ G  ++ DLL +K + E L PP MEGLDA L+++K 
Sbjct  61   DTKRQGFLGFNEFVTAMQLISLAQEGRELSSDLLRSKANMEYLSPPSMEGLDALLSSQKT  120

Query  366  -YTSKNEPEQNGSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
              +S  + E NG+   Q  P  + F + S+   + SL++VTS+ DGLK+LY + LKPLE+
Sbjct  121  DGSSMKKIETNGTIQLQPLPPINLFSRKSRKKIQPSLTAVTSVTDGLKRLYNEKLKPLEL  180

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDF SP LT SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  TYRFNDFASPALTESDFDAKPMVMLLGQYSTGKTTFIKHLLK  222



>ref|XP_009626939.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=548

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI ++ IS CSK  +KIYQ WF+F DSDGDGRITG DATK F+LSNLSR ELKQVWAIA
Sbjct  1    MEIVSSSISSCSKDDQKIYQNWFNFVDSDGDGRITGNDATKLFSLSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LGF EFV  MQL+SLAQ G  ++ DLL +K + E L PP MEGLDA L+++K 
Sbjct  61   DTKRQGFLGFNEFVTAMQLISLAQEGRELSSDLLRSKANMEFLSPPSMEGLDALLSSQKT  120

Query  366  Y-TSKNEPEQNGSPPRQSSPAASWF-QssksakkvslssvtsIVDGLKKLYIQNLKPLEV  539
              +S  + E NG+   Q  P  + F + S+   + SL++VTS+ DGLK+LY + LKPLE+
Sbjct  121  NGSSMKKIETNGTIQLQPPPPINLFSRKSRKKIQPSLTAVTSVTDGLKRLYNEKLKPLEL  180

Query  540  TYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            TYRFNDF SP LT SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  181  TYRFNDFASPALTESDFDAKPMVMLLGQYSTGKTTFIKHLLK  222



>ref|XP_009401415.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 165/210 (79%), Gaps = 3/210 (1%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
             SK ++KIYQ WFSFADSDGDGR+TG DA KFFA+SNL R +LKQVWAIADS+RQGYLGF
Sbjct  8    ISKENDKIYQNWFSFADSDGDGRLTGTDAIKFFAMSNLPRGDLKQVWAIADSRRQGYLGF  67

Query  216  KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQN  395
            KEFVI M+LVSLAQ GN IT   L A  D E + PP MEGLD  L+  K    + +PEQ+
Sbjct  68   KEFVIAMKLVSLAQEGNEITQVAL-AHADLEKVNPPVMEGLDTFLSTNKPSIKEIDPEQD  126

Query  396  GSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLL  575
             +   Q +P   WF  +KS KK+ LSSVTSI+DGL++LYIQ LKPLEVTY+F+DF S LL
Sbjct  127  VNSQPQ-TPKLQWF-GTKSTKKIPLSSVTSIIDGLERLYIQKLKPLEVTYQFSDFGSSLL  184

Query  576  TNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            T+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  185  TSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  214



>ref|XP_009390979.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=539

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 170/220 (77%), Gaps = 7/220 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M + A+  + CSK  +KIYQ+WF++AD DGDGRITG DA KFFA+S LSR ELKQVWAIA
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+L   +F+  MQLV+LAQAG  IT D+L +  D ENL+ P MEGLDA LA    
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVL-SHADLENLKLPVMEGLDALLA----  115

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S+   + + SP      +A+WF  SK++KKV LSSVTSI+DGLKKLYI+ LKPLEV Y
Sbjct  116  -LSEISDDVSASPQHLLPASAAWFN-SKASKKVPLSSVTSIIDGLKKLYIEKLKPLEVAY  173

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +FN+FVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  174  QFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  213



>ref|XP_006652990.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 165/220 (75%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +   + Y  WFS AD DGDGR+TG DA KFFA+SNLSR +LKQVWAIA
Sbjct  1    MGSDSPPTRWGPREQRETYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D+L A  D + L+PP MEGLD +L  KK 
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDIL-AHADLDMLKPPTMEGLDKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
            Y SK+        P +S  +A+WF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  118  YVSKSHSNIVVCHPSESPASANWFN-SKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>ref|XP_003610495.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES92692.1| calcium-binding EF hand protein [Medicago truncatula]
Length=542

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 163/214 (76%), Gaps = 6/214 (3%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   S  H + YQ+WF  ADSDGDGRI+G DA KFFALSNLSR +LKQVWAIAD+KRQG+
Sbjct  8    IHSSSNEHIETYQQWFILADSDGDGRISGNDAIKFFALSNLSRPQLKQVWAIADTKRQGF  67

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF+EFV  MQL+S+ QAG  +  D+L  ++D E ++ P MEG+D  +A K   T   +P
Sbjct  68   LGFEEFVTAMQLISVGQAGYDLNSDILKTQIDNEKIKLPVMEGIDVLVANKASSTINAQP  127

Query  387  EQNGS-PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFV  563
            +  G+  PR   P AS     KS KK+ LS+VTSI+DGLKKLY++ LKPLEVTYRFNDFV
Sbjct  128  DLFGTGQPRPFPPVAS-----KSVKKLPLSAVTSIIDGLKKLYVERLKPLEVTYRFNDFV  182

Query  564  SPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            SP+LT+SDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  183  SPVLTDSDFDAKPMVMLLGQYSTGKTTFIKHLLR  216



>emb|CAN67909.1| hypothetical protein VITISV_034695 [Vitis vinifera]
Length=546

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 162/227 (71%), Gaps = 14/227 (6%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEID+ PIS CSK ++ IYQEWF+FADSD DGRITG DA KFF +SNL R +LKQVWAIA
Sbjct  1    MEIDSGPISSCSKQNQMIYQEWFNFADSDSDGRITGNDAIKFFXMSNLPRPDLKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LG KEF+  MQLVSLAQAG+AIT DLL ++    +L           +  KK+
Sbjct  61   DTKRQGFLGXKEFITAMQLVSLAQAGHAITQDLLHSEGKHSDL-------FIKNIXKKKR  113

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQ-------ssksakkvslssvtsIVDGLKKLYIQNL  524
                ++P+ NG      +   +             +  +V LSSVTSI+DGLK+LYIQ L
Sbjct  114  AHKTSDPDINGKKFXIFNNNNTIIAFILLAQVHCLAMMQVPLSSVTSIIDGLKRLYIQKL  173

Query  525  KPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            KPLEVTYRFNDF SPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  174  KPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  220



>ref|XP_008384122.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=541

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +     C K H+KIYQEWF+  DSDGDGRITG + TKFFA+S LSR+ELKQVWAI 
Sbjct  1    MEIGSGRTGVCPKEHQKIYQEWFNLVDSDGDGRITGNEXTKFFAMSKLSREELKQVWAIX  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQG+LGF EFV  MQ++SLAQ  +  + D+L   VD+EN++PP +EGLD  L AK K
Sbjct  61   DTKRQGFLGFSEFVTAMQMISLAQE-HEXSPDILKTAVDWENIKPPVIEGLD-DLIAKTK  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +    E NG+   Q  P+   F  SKSAKK+  ++VTSIVDGLK+LY + LKPLE+ Y
Sbjct  119  SLTTYGVEVNGTA--QFQPSVQRF-GSKSAKKLPPNAVTSIVDGLKRLYNEKLKPLELAY  175

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SP LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  176  RFNDFASPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  215



>ref|XP_002316591.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE97203.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=525

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 155/219 (71%), Gaps = 22/219 (10%)
 Frame = +3

Query  9    EIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIAD  188
            EI  +  S  SK  ++IY+EWF+ ADSDGDGR TG DATKFFA+SNLSRQ+LKQVWA+AD
Sbjct  3    EIGKSAGSSFSKEQQQIYKEWFNLADSDGDGRFTGNDATKFFAMSNLSRQQLKQVWALAD  62

Query  189  SKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKY  368
            SKRQG+LG  EFV  MQLVSLAQAG+ +T D +      E+++PP M+G+DA LA     
Sbjct  63   SKRQGFLGLTEFVTAMQLVSLAQAGHELTPDTIKTASKMEDVKPPLMDGIDALLAV----  118

Query  369  TSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYR  548
               +   Q G+   +  P  +               VTSI+DGLK+LYI+ LKPLE TY 
Sbjct  119  ---SGTPQVGAKSSRKMPLNA---------------VTSIIDGLKRLYIEKLKPLEATYH  160

Query  549  FNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  161  FNDFVSPLLTNSDFDARPMVMLLGQYSTGKTTFIKHLLR  199



>ref|XP_003579456.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=548

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 163/214 (76%), Gaps = 4/214 (2%)
 Frame = +3

Query  24   PISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQG  203
            P+    K    +Y  WF  AD DGDGR+TG DA KFFA+SNL+R ELKQVWAIADSKRQG
Sbjct  13   PVRWGLKEQRSVYLRWFYIADDDGDGRVTGKDALKFFAMSNLARDELKQVWAIADSKRQG  72

Query  204  YLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNE  383
            YLGF EF+  MQLVSLAQAG  I+ D + A  D +NL+PP MEGLD +L  KKK  +++ 
Sbjct  73   YLGFAEFMAAMQLVSLAQAGQEISKDTI-AHADLDNLQPPTMEGLDKKL--KKKSANRSS  129

Query  384  PEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFV  563
             +     P +S  ++SWF  SKS KK++L SVTSI+DGLKK YI+ L+PLE TY++NDFV
Sbjct  130  SDITAYHPTESPLSSSWFN-SKSGKKITLKSVTSIIDGLKKSYIEKLRPLEKTYQYNDFV  188

Query  564  SPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            SPLLT+SDFDA PM+MLLGQYSTGKTTF+KHLL+
Sbjct  189  SPLLTSSDFDAKPMIMLLGQYSTGKTTFVKHLLK  222



>gb|AEV41109.1| putative EH-domain-containing protein 1 [Oryza officinalis]
Length=542

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +     Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAIA
Sbjct  1    MGSDSPPKKWGLREQRDAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L A  D E L PP MEGLD +L  KK 
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTL-AHADLERLLPPTMEGLDKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK+  +     P +   +A+WF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  118  SVSKSHSDIIARHPSELPASANWFN-SKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>ref|XP_009357509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME  +     C K H+KIYQEWF+  DSDGDGRITG +ATKFFA+S LSR+ELKQVWAIA
Sbjct  1    MENGSGRTGVCPKEHQKIYQEWFNLVDSDGDGRITGNEATKFFAMSKLSREELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D KRQG+LGF EF+  MQ++SLAQ  + ++ D+L   VD+EN++PP +EGLD  L AK K
Sbjct  61   DMKRQGFLGFSEFITAMQMISLAQE-HELSPDVLKTAVDWENIKPPVIEGLD-DLIAKTK  118

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +    E NG+   Q  P+   F  SKSAKK+  ++VTSIVDGLK+LY + LKPLE+ Y
Sbjct  119  SLTTYGVEVNGTA--QFQPSVQRF-GSKSAKKLPPNAVTSIVDGLKRLYNEKLKPLELAY  175

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF SP L NSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  176  RFNDFASPSLINSDFDAKPMVMLLGQYSTGKTTFIKHLLR  215



>gb|AEV40966.1| putative EH-domain-containing protein 1 [Oryza punctata]
Length=542

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +     Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAI+
Sbjct  1    MGSDSPPKKWGLREQRDTYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIS  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L A  D E L PP MEGLD +L  KK 
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTL-AHADLERLLPPTMEGLDKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK+  +     P +   +A+WF  SKS KK+ L SVTS++DGLKK YI+ L+PLE TY
Sbjct  118  SVSKSHSDIVARHPSEVPASANWFN-SKSGKKIPLRSVTSVIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>gb|AEV41063.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +     Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAIA
Sbjct  1    MGSDSPPKKWGLREQRDAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L A  D E L PP MEGLD +L  KK 
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTL-AHADLERLLPPTMEGLDKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK+  +     P +   +A+WF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  118  SVSKSYSDIIARHPSELPASANWFN-SKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>emb|CDY29816.1| BnaC05g31740D [Brassica napus]
Length=526

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 164/208 (79%), Gaps = 2/208 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADS-DGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEID+     CSK ++ IY++WF FADS DGDGRITG DA KFF++SNL R ELKQVWAI
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSADGDGRITGNDAIKFFSMSNLPRPELKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            AD+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP M+GL   +A KK
Sbjct  61   ADAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGLIVLMAKKK  120

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            K  S    + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV 
Sbjct  121  KKHSPKSSDPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVA  179

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQY  626
            Y+FNDFVSPLLTNSDFDA PMVMLLG +
Sbjct  180  YQFNDFVSPLLTNSDFDAKPMVMLLGAH  207



>ref|NP_001054202.1| Os04g0669300 [Oryza sativa Japonica Group]
 emb|CAE02814.2| OSJNBa0043A12.19 [Oryza sativa Japonica Group]
 dbj|BAF16116.1| Os04g0669300 [Oryza sativa Japonica Group]
 gb|EEC78218.1| hypothetical protein OsI_17853 [Oryza sativa Indica Group]
 gb|EEE61874.1| hypothetical protein OsJ_16560 [Oryza sativa Japonica Group]
Length=542

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +   + Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAIA
Sbjct  1    MGSDSPPKKWGLREQREAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L A  D E L PP MEGLD +L  K  
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTL-AHADLETLLPPTMEGLDKKL--KNN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK+  +     P +   +A+WF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  118  SMSKSNSDIVVRHPSELPASANWFN-SKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>gb|AEV41016.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +     Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAI+
Sbjct  1    MGSDSPPKKWGLREQRDTYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIS  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L A+ D E L PP MEGLD +L  KK 
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTL-ARADLERLLPPTMEGLDKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK+  +     P +   +A+WF  SKS +K+ L SVTS++DGLKK YI+ L+PLE TY
Sbjct  118  SVSKSHSDIVARHPSEVPASANWFN-SKSGRKIPLRSVTSVIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDF   PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFDDFVSPLLTSSDFHGKPMVMLLGQYSTGKTTFIKHLLK  216



>emb|CDY25408.1| BnaA05g18760D [Brassica napus]
Length=525

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADS-DGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEID+     CSK ++ IY++WF FADS DGDGRITG DA KFF++SNL R ELKQVWAI
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSADGDGRITGSDAIKFFSMSNLPRPELKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKK  362
            AD+KRQGYLGFKEF++ MQLVSLAQ G+ I+ ++L + VDF+N+ PP M+GL   L AKK
Sbjct  61   ADAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL-IVLMAKK  119

Query  363  KYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
            K  S    + NGSP   +S  A WF  SKS+KK+SLSSVTSI+DGLK+LYIQ LKPLEV 
Sbjct  120  KKHSPKSSDPNGSPAADASLTAHWFS-SKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVA  178

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQY  626
            Y+FNDFVSPLLTNSDFDA PMVMLLG +
Sbjct  179  YQFNDFVSPLLTNSDFDAKPMVMLLGAH  206



>ref|XP_010090952.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB41537.1| EH domain-containing protein 1 [Morus notabilis]
Length=510

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 156/220 (71%), Gaps = 36/220 (16%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI + PI  C+K H+K+YQEWF+ ADSDGDGRITG DATKFFA+S LSRQELKQVWAIA
Sbjct  1    MEIGSGPIGPCTKEHQKMYQEWFNLADSDGDGRITGNDATKFFAMSKLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LG  EF+  MQLVSLAQAG+ +T ++             ++ G+         
Sbjct  61   DSKRQGFLGLTEFITAMQLVSLAQAGHELTPEI------------HKIAGI---------  99

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                           Q  P+  WF  SKS KK+ L++VTSI+DGLK+LY++ LKPLEVTY
Sbjct  100  --------------AQPQPSTQWF-PSKSVKKLPLNAVTSIIDGLKRLYMEKLKPLEVTY  144

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDF +P LTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  145  RFNDFSTPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  184



>ref|XP_002447292.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
 gb|EES11620.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
Length=542

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D++P     K     Y +WF+ AD DGDGR+TG DA +FFA+SNLS+ ELKQVWAIA
Sbjct  1    MGPDSSPKKWSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I  D L +  D E L+ P MEGL  +L  KK 
Sbjct  61   DSKRQGYLGFFEFMTAMQLVSLAQAGNEINQDTL-SNSDLERLQLPTMEGLAKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              SK E       P +S  +ASWF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  118  SGSKGESAIVACHPSESPISASWFN-SKSGKKIPLKSVTSIIDGLKKSYIEKLRPLEKTY  176

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPL+T+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  QFHDFVSPLMTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216



>ref|XP_001772546.1| predicted protein [Physcomitrella patens]
 gb|EDQ62588.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            +K  E+ Y+ WF +AD+DGDGR+TG DA KFF+LS L R ELKQVWAIAD KRQG+LGFK
Sbjct  10   TKQDEEKYRHWFDYADADGDGRLTGDDAVKFFSLSQLPRAELKQVWAIADVKRQGFLGFK  69

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAA--KKKYTSKNEPEQ  392
            EFV  MQ++SL Q+GN I  D+L    D E +  P M GL   L+   +   +S      
Sbjct  70   EFVSAMQVISLLQSGNDIGPDIL-KNADLEKIGAPTMVGLVELLSKGLRGSKSSNGSIHS  128

Query  393  NGSPPRQ-SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSP  569
            NGS P+Q +S  + WF+     + +S  SVTSIVDGLKKLYI+ LKPLEVTYRFNDFVSP
Sbjct  129  NGSSPQQQASQTSQWFREKTPRRSLSSVSVTSIVDGLKKLYIEKLKPLEVTYRFNDFVSP  188

Query  570  LLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             LT SDFDA P VMLLGQYSTGKTTFIKHLLR
Sbjct  189  TLTESDFDAKPQVMLLGQYSTGKTTFIKHLLR  220



>ref|NP_001167939.1| uncharacterized protein LOC100381653 [Zea mays]
 gb|ACN26585.1| unknown [Zea mays]
 tpg|DAA35458.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=543

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 160/221 (72%), Gaps = 5/221 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D++P     K     Y +WF+ AD DGDGR+TG DA +FFA+SNLS+ ELKQVWAIA
Sbjct  1    MGPDSSPKKLSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I  D L    D E L+ P M+GL  +L  KK 
Sbjct  61   DSKRQGYLGFYEFMTAMQLVSLAQAGNEINQDTL-PNADLEKLQLPTMDGLAKKL--KKN  117

Query  366  YTSKNEPEQNGSPPRQS-SPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVT  542
              SK E       P ++ +  ASWF  SKS KK+ L SVTSIVDGLKK YI+ L+PLE T
Sbjct  118  SGSKVESAIVACHPSEAPTMTASWFN-SKSGKKIPLKSVTSIVDGLKKSYIEKLRPLEKT  176

Query  543  YRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            Y+F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  177  YQFHDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217



>gb|EYU27756.1| hypothetical protein MIMGU_mgv1a004743mg [Erythranthe guttata]
Length=512

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 144/220 (65%), Gaps = 34/220 (15%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            ME  +  +  C+K   K+YQ WF+  DSD DGR+T  DAT+FFA+S+L++ ELKQVWAIA
Sbjct  1    MEFVSEKMDTCTKEQLKLYQNWFTSVDSDRDGRLTANDATEFFAMSHLTKPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KRQGYLG KEF+  MQL+SLAQ G+ +T  LL + V  E L PP MEGLDA L     
Sbjct  61   DTKRQGYLGLKEFITAMQLISLAQEGHELTSSLLRSTVYLETLSPPYMEGLDAFL-----  115

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                   E   S P  +S                      ++DGLK+LY + LKPLE TY
Sbjct  116  -------ENQTSLPSVTS----------------------VIDGLKRLYNEKLKPLEATY  146

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP LT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  147  RFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLQ  186



>tpg|DAA35457.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=541

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D++P     K     Y +WF+ AD DGDGR+TG DA +FFA+SNLS+ ELKQVWAIA
Sbjct  1    MGPDSSPKKLSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I  D L    D E L+ P M+GL  +L +  K
Sbjct  61   DSKRQGYLGFYEFMTAMQLVSLAQAGNEINQDTL-PNADLEKLQLPTMDGLAKKLNSGSK  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              S          P  +   ASWF  SKS KK+ L SVTSIVDGLKK YI+ L+PLE TY
Sbjct  120  VESAIVACHPSEAPTMT---ASWFN-SKSGKKIPLKSVTSIVDGLKKSYIEKLRPLEKTY  175

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  176  QFHDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  215



>emb|CDY50093.1| BnaC01g32680D [Brassica napus]
Length=531

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADS-DGDGRITGGDATKFFALSNLSRQELKQVWAI  182
            MEID+     CSK ++ IY+EWF FADS DGDGRITG DA KFF++SNL R ELKQVWAI
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSADGDGRITGSDAIKFFSMSNLPRPELKQVWAI  60

Query  183  ADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLD----AKVDFENLEPPRMEGLDAQL  350
            AD+KRQGYLGFK+F++ MQLVSLAQ G+ I+ D+L     A     N+ PP MEGL   +
Sbjct  61   ADAKRQGYLGFKDFIVAMQLVSLAQTGHEISHDVLHSDGMATKALINMNPPVMEGLGVLM  120

Query  351  A-AKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLK  527
            A  K   +  ++   NGSP   +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LK
Sbjct  121  AKKKHSSSKSSDLNVNGSPSADASLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLK  179

Query  528  PLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQY  626
            PLEV YRFNDFVSPLLTNSDFDA PMVMLLG +
Sbjct  180  PLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGAH  212



>emb|CDO98110.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
            CSK H+KIYQ+WF+ ADSDGDGR+TG DATK FA+SNLSR ELKQVWA+ADSK+QG+LG 
Sbjct  13   CSKDHQKIYQDWFNLADSDGDGRLTGNDATKIFAMSNLSRPELKQVWALADSKKQGFLGL  72

Query  216  KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQN  395
             EF+  MQL++LAQ G  I   LL  K    NL  P MEGL A  A    +      +  
Sbjct  73   TEFITAMQLIALAQKGREINSALLKNK---GNLNLPVMEGLAALQAVSTSFHFSIVKKNA  129

Query  396  GSPPRQSSPAASWFQssksakkvslss-vtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPL  572
            G+   Q SP     +   + K +S  + VTS+ DGLK+LY + L+PLEVTY FNDF SPL
Sbjct  130  GTAELQCSPLVKLSKRKSAKKSLSSVAPVTSVTDGLKRLYNEKLRPLEVTYHFNDFGSPL  189

Query  573  LTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            LTNSDFDA PMVMLLGQYSTGKTTFIK+LL
Sbjct  190  LTNSDFDAKPMVMLLGQYSTGKTTFIKYLL  219



>emb|CDY50090.1| BnaC01g32650D [Brassica napus]
Length=570

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 163/252 (65%), Gaps = 46/252 (18%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQ-----  170
            MEID+     CSK ++ IY+EWF FADSDGDGRITG DA KFF++SNL R ELKQ     
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQFFGVS  60

Query  171  ---------------------------------------VWAIADSKRQGYLGFKEFVIG  233
                                                   VWAIAD+KRQGYLGFK+F++ 
Sbjct  61   VNENSCCSFRRSYADADAVLITDADLNADAVPSSMKRTRVWAIADAKRQGYLGFKDFIVA  120

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLA-AKKKYTSKNEPEQNGSPPR  410
            MQLVSLAQ G+ I+ D+L + VDF+N+ PP MEGL   +A  K   +  N+   NGSP  
Sbjct  121  MQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKHSSSKSNDLSVNGSPSA  180

Query  411  QSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDF  590
             +S  A WF  SKS+KK+SLSSVTSIVDGLK+LYIQ LKPLEV YRFNDFVSPLLTNSDF
Sbjct  181  DASLTAHWFS-SKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDF  239

Query  591  DAXPMVMLLGQY  626
            DA PMVMLLG +
Sbjct  240  DAKPMVMLLGAH  251



>emb|CDP04464.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 159/248 (64%), Gaps = 33/248 (13%)
 Frame = +3

Query  18   AAPIS-RCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSK  194
            + PI+  CSK H+KIYQ WF+FADSDGDGR+TG DATK FA+SNLSR ELKQVWA+ADSK
Sbjct  6    SVPITYSCSKDHQKIYQYWFNFADSDGDGRLTGNDATKIFAMSNLSRPELKQVWALADSK  65

Query  195  RQGYLGFKEFVIGMQLVSLAQAGNAITVDLL-------------------DAKVD-----  302
            +QG+LG  EF+  MQL++LAQ G+ I   LL                   + K+      
Sbjct  66   KQGFLGLTEFITAMQLIALAQEGHEINSALLKNAGKRRISKEQYIQLHLNNFKISVKIFL  125

Query  303  -------FENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakk  461
                    E+L  P MEGL A  A       K + E NG+   QS+P     +   + K 
Sbjct  126  CLVFLAVLESLNLPVMEGLAALQAKTNVSPVKEKLEGNGTAELQSNPLVKLSKRKSAKKS  185

Query  462  vslss-vtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGK  638
            +S  + VTS+ DGLK+LY + L+PLEVTY FNDF SPLLTNSDFDA PMVMLLGQYSTGK
Sbjct  186  LSSVAPVTSVTDGLKRLYNEKLRPLEVTYHFNDFGSPLLTNSDFDAKPMVMLLGQYSTGK  245

Query  639  TTFIKHLL  662
            TTFIKHLL
Sbjct  246  TTFIKHLL  253



>ref|XP_002970092.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
 gb|EFJ29216.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
Length=544

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 164/220 (75%), Gaps = 2/220 (1%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I +      +K  E++Y++WF FAD DGDGRITG DA KFF+LS L R  LKQVWA+A
Sbjct  1    MDILSVRSVHYAKQDEQMYKQWFDFADEDGDGRITGADAVKFFSLSQLPRSHLKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEFV  MQ+++LAQ GN I+ D+L  + D + + PP MEGL+  + A+K+
Sbjct  61   DSKRQGFLGFKEFVAAMQIIALAQLGNEISADMLRDR-DVDEISPPNMEGLEQMILARKR  119

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                 +   NG+ P+  +  A WF ++K  +K+  +SVTS+VDGLKKLY++ LKPLEVTY
Sbjct  120  APPTGDVFTNGTSPQLQAETAQWF-ATKQPRKIPSTSVTSVVDGLKKLYLEKLKPLEVTY  178

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RF+DFVSP LT SDFD  PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  RFHDFVSPTLTESDFDCKPMVMLLGQYSTGKTTFIKHLLR  218



>gb|EPS69769.1| hypothetical protein M569_04997, partial [Genlisea aurea]
Length=401

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 136/212 (64%), Gaps = 36/212 (17%)
 Frame = +3

Query  36   CSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGF  215
            CSK   K YQ WF+FADSD DGR+T  +AT F ++S LS+ ELKQ+WAIADS+RQG+L F
Sbjct  1    CSKEELKFYQTWFNFADSDRDGRLTANEATIFLSMSGLSKPELKQIWAIADSRRQGFLDF  60

Query  216  KEFVIGMQLVSLAQAGNAITVDLLD--AKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPE  389
            KEF+  MQL+SLAQ G  IT D+L    K + E + PP MEGLDA +     + +     
Sbjct  61   KEFISAMQLISLAQEGRVITADILKITVKANLEKVSPPHMEGLDALIEGNTSFNA-----  115

Query  390  QNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSP  569
                                         VTS++DGLK LY + LKPLE TY+FNDFVSP
Sbjct  116  -----------------------------VTSVIDGLKMLYNEKLKPLEATYQFNDFVSP  146

Query  570  LLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             LT SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  147  FLTASDFDAKPMVMLLGQYSTGKTTFIKHLLQ  178



>ref|XP_007145730.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
 gb|ESW17724.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
Length=538

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 20/226 (9%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M ++  PI    + ++ +Y+EWF++AD+DGDGR TG +A K F +SNLSRQELKQVWAIA
Sbjct  1    MGLEIVPIDSTFEDYQTLYEEWFNYADADGDGRFTGKEAIKLFTMSNLSRQELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D+KR+GYLGFKEFV  MQLVSL Q G +IT DLL +    +  +PP MEGLDA +A KK+
Sbjct  61   DTKREGYLGFKEFVTAMQLVSLGQCGYSITHDLLTSDA-MKYAKPPTMEGLDALVAKKKR  119

Query  366  YTSKNEP------EQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLK  527
                 E           SP  Q SPA++WF  +KS K+VS SSVTSI+DGL         
Sbjct  120  KHKDKESSVSLTYSHAVSP--QPSPASNWFS-AKSTKEVSASSVTSIIDGL---------  167

Query  528  PLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
             LEV Y +NDFVSPLLTNSDFDA P+++LLGQYSTGKTTFIKH+L+
Sbjct  168  -LEVAYNYNDFVSPLLTNSDFDAKPLILLLGQYSTGKTTFIKHMLQ  212



>ref|XP_009402015.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 135/212 (64%), Gaps = 38/212 (18%)
 Frame = +3

Query  30   SRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYL  209
            S  S+ H++IY +WFSF DSD DGRIT  DA  FFA+SNL R+ LKQ+WA ADSKR+GYL
Sbjct  5    SLISEEHDRIYGKWFSFVDSDRDGRITETDAICFFAMSNLPRRVLKQIWATADSKRKGYL  64

Query  210  GFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPE  389
            GFKEF   M+LV+LAQAGN IT D L A  D + L PP M GLD  L   K  T      
Sbjct  65   GFKEFATAMKLVALAQAGNEITQDSL-AHADLQKLNPPMMGGLDTLLNINKHSTK-----  118

Query  390  QNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSP  569
                                            ++DGLK+LY Q L+ LE+TY+FN+F SP
Sbjct  119  --------------------------------VIDGLKRLYSQKLELLEITYQFNEFASP  146

Query  570  LLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  147  LLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  178



>ref|XP_002974220.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
 gb|EFJ24442.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
Length=540

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 154/218 (71%), Gaps = 6/218 (3%)
 Frame = +3

Query  12   IDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADS  191
            ++  P+   SK  E  Y+ WF + D+DGDGRITG DA KFFA+S L + +LKQVWA+ADS
Sbjct  1    MEVLPLREISKQDEAGYKRWFEYVDADGDGRITGADAVKFFAMSKLPKSDLKQVWAMADS  60

Query  192  KRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYT  371
             RQGYLG KEF+  MQ++S+AQ+G  +T D+L  + D+EN+  P ME ++  +   +K T
Sbjct  61   NRQGYLGLKEFITAMQIISVAQSGVELTGDVL-KRTDWENIGMPSMELVEDHIREGRKLT  119

Query  372  SKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRF  551
             + E ++      +  P+ + +   K+ +KVS  + TSI+DGLKKLY + LKPLE+ Y+F
Sbjct  120  PEVEVQE-----VEPKPSFTNWLFQKTPQKVSQDTATSIIDGLKKLYFEKLKPLEMAYQF  174

Query  552  NDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            NDFV P LT SDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  175  NDFVLPALTESDFDAKPMVMLLGQYSTGKTTFLKHLLK  212



>ref|XP_008363998.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=286

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = +3

Query  168  QVWAIADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQ  347
            +VWAIADSKRQGYLGF EFV  MQLVS AQAG+ IT  LL++ V  E+L+PP MEGLDA 
Sbjct  12   KVWAIADSKRQGYLGFSEFVAAMQLVSHAQAGHDITHGLLNSNVGLESLKPPVMEGLDAL  71

Query  348  LAAKKKYTSK-NEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNL  524
            L A KK+  K NE + NG+   Q SP+A WF    S K    S  + I+DGLK+LY+Q L
Sbjct  72   LLANKKHLPKSNENKVNGTAVVQQSPSALWFSPESSKKIPLSSVTS-IIDGLKRLYVQKL  130

Query  525  KPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            KPLEVTY+FN+FVSPL+TN DFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  131  KPLEVTYKFNNFVSPLMTNGDFDAKPMVMLLGQYSTGKTTFIKHLLK  177



>gb|AAD48968.1|AF147263_10 contains similarity to Pfam family PF00036 - EF hand; score=11.7, 
E=0.66,N=1 [Arabidopsis thaliana]
 emb|CAB81094.1| AT4g05520 [Arabidopsis thaliana]
Length=514

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 151/230 (66%), Gaps = 21/230 (9%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I  C K H+KIY+EWF+ ADSDGDGR++G DATKFFA+S LSRQELKQVWA+ADSKRQG+
Sbjct  9    IGSCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGF  68

Query  207  LGF-------KEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            LG        K+ +  +Q  S AQ    + + L +++   +++E P +EGL+  ++ +K 
Sbjct  69   LGLSDSSHWHKKDMKLLQTFSKAQVSGKLHLKLFESR-GSDSVELPVLEGLENVVSKQKV  127

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              +  + E N     Q +    WF+    +      +V +IVDGLK+LY + LKPLEVTY
Sbjct  128  SKTNVDVEDNVVTKPQVTAKTPWFK--SKSIIKPQVNVVTIVDGLKRLYTEKLKPLEVTY  185

Query  546  RFNDFVSPL-----------LTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            RFNDF SP+           LT+SDFDA PMVMLLGQYSTGKTTFIKHLL
Sbjct  186  RFNDFASPVLVSNILTVSETLTSSDFDAKPMVMLLGQYSTGKTTFIKHLL  235



>emb|CAJ86083.1| H0818H01.5 [Oryza sativa Indica Group]
 emb|CAJ86201.1| B0811B10.21 [Oryza sativa Indica Group]
Length=555

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 144/220 (65%), Gaps = 34/220 (15%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M  D+ P     +   + Y  WFS AD DGDGR+TG DA KFFA+SNLSR ELKQVWAIA
Sbjct  1    MGSDSPPKKWGLREQREAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQGYLGF EF+  MQLVSLAQAGN I+ D L   V                      
Sbjct  61   DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTLAHAV----------------------  98

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                         P +   +A+WF  SKS KK+ L SVTSI+DGLKK YI+ L+PLE TY
Sbjct  99   -----------RHPSELPASANWFN-SKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTY  146

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F+DFVSPLLT+SDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  147  QFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  186



>gb|EMT24958.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=457

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 141/208 (68%), Gaps = 34/208 (16%)
 Frame = +3

Query  42   KAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKE  221
            K    +Y  WF  AD D DGR+TG DA KFFA+S LSR++LKQVWAIADSKRQGYLGF E
Sbjct  17   KEQRSVYLRWFYLADDDADGRLTGKDALKFFAMSKLSREDLKQVWAIADSKRQGYLGFTE  76

Query  222  FVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGS  401
            F+  MQLVSLAQAG  I+ D L                      A   Y           
Sbjct  77   FMTAMQLVSLAQAGQDISQDTL----------------------AHAAYH----------  104

Query  402  PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTN  581
             P Q+S +A+WF  SKS KK+++ SVTSI+DGLKK YI+ L+PLE TY++NDFVSPLLT+
Sbjct  105  -PVQTSMSANWFN-SKSGKKIAMKSVTSIIDGLKKAYIEKLRPLEKTYQYNDFVSPLLTS  162

Query  582  SDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            SDFDA PM+MLLGQYSTGKTTFIKHLL+
Sbjct  163  SDFDAKPMIMLLGQYSTGKTTFIKHLLK  190



>ref|XP_002985697.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
 gb|EFJ13275.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
Length=558

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 155/233 (67%), Gaps = 18/233 (8%)
 Frame = +3

Query  12   IDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADS  191
            ++A P+   SK  E  Y+ WF + D+DGDGRITG DA KFFA+S L + +LKQVWA+ADS
Sbjct  1    MEALPLREISKQDEAGYKRWFEYVDADGDGRITGADAVKFFAMSKLPKSDLKQVWAMADS  60

Query  192  KRQGYLGFKEFVIGMQLVSLAQAGNAITVDLL--------------DAKVDFENLEPPRM  329
             RQGYLG KEF+  MQ++S+AQ+G  +T D+L              D+  D+EN+  P M
Sbjct  61   NRQGYLGLKEFITAMQIISVAQSGVELTGDVLKRTGKQAAFMQMSYDSFADWENIGMPSM  120

Query  330  EGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASW-FQssksakkvslssvtsIVDGLKK  506
            E ++  +  +    ++N  +Q  +         +W FQ  K+ +KVS  + TSI+DGLKK
Sbjct  121  ELVEDHIRVRLP-VAQNSQDQLCALLEPKPSFTNWLFQ--KTPQKVSQDTATSIIDGLKK  177

Query  507  LYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LY + LKPLE+ Y+FNDFV P LT SDFDA PMVMLLGQYSTGKTTF+KHLL+
Sbjct  178  LYFEKLKPLEMAYQFNDFVLPALTESDFDAKPMVMLLGQYSTGKTTFLKHLLK  230



>ref|XP_002985283.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
 gb|EFJ13777.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
Length=552

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 160/228 (70%), Gaps = 10/228 (4%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            M+I +      +K  E++Y++WF FAD DGDGRITG DA KFF+LS L R  LKQVWA+A
Sbjct  1    MDILSVRSVHYAKQDEQMYKQWFDFADEDGDGRITGADAVKFFSLSQLPRSHLKQVWAVA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAK--  359
            DSKRQG+LGFKEFV  MQ+++LAQ GN I+ D+L  + D + + PP MEGL+  +     
Sbjct  61   DSKRQGFLGFKEFVAAMQIIALAQLGNEISADMLRDR-DVDEISPPNMEGLEQMILVCFL  119

Query  360  ------KKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQN  521
                    ++  +      + P+  +  A WF ++K  +K+  +SVTS+VDGLKKLY++ 
Sbjct  120  SSSIFVYDFSFSDMNFTVCTSPQLQAETAQWF-ATKQPRKIPSTSVTSVVDGLKKLYLEK  178

Query  522  LKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LKPLEVTYRF+DFVSP LT SDFD  PMVMLLGQYSTGKTTFIKHLLR
Sbjct  179  LKPLEVTYRFHDFVSPTLTESDFDCKPMVMLLGQYSTGKTTFIKHLLR  226



>ref|XP_009589164.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009589165.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=469

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSLAQAG+ +T DLL+A+V+FENL+PP +EGLD  L AKKK   K+EPEQNG+P  Q
Sbjct  1    MQLVSLAQAGHPVTSDLLNAEVNFENLQPPTLEGLDL-LQAKKKRAPKSEPEQNGNPTVQ  59

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
            SS  A+WF SS S KKVSL+SVTSI+DGLKKLYIQ LKPLEV YRFNDFVSP LTNSDFD
Sbjct  60   SSVTANWFSSSTSVKKVSLTSVTSIIDGLKKLYIQKLKPLEVAYRFNDFVSPFLTNSDFD  119

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLLR
Sbjct  120  AKPMVMLLGQYSTGKTTFIKHLLR  143



>ref|XP_001784382.1| predicted protein [Physcomitrella patens]
 gb|EDQ50787.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 147/220 (67%), Gaps = 25/220 (11%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI ++ +   +K  E+ Y++WF +AD+DGDGR+TG DA KFF++S L R ELKQVWAIA
Sbjct  1    MEILSSRVG--TKQDEQAYRKWFEYADTDGDGRLTGNDAVKFFSISELPRAELKQVWAIA  58

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            D KRQG+LGFKEFV  MQ++SLAQ G  I  D+L    D EN+ PP M GL+        
Sbjct  59   DEKRQGFLGFKEFVSAMQVISLAQLGKDINPDIL-KNSDLENISPPTMTGLE--------  109

Query  366  YTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
                   E              W       + +S  +VTSIVDGLKKLY++ LKPLEV Y
Sbjct  110  -------ELILYLRLILLHGIGW-------QTLSAIAVTSIVDGLKKLYLEKLKPLEVAY  155

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            RFNDFVSP+LT+SDFDA P VMLLGQYSTGKTTFIKHLLR
Sbjct  156  RFNDFVSPILTDSDFDAKPQVMLLGQYSTGKTTFIKHLLR  195



>ref|XP_009598340.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=470

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK   K+EP+QNGS P  
Sbjct  1    MQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKKPMPKSEPDQNGSAPVP  60

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
            S+PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLEV Y FNDFVSPLL NSDFD
Sbjct  61   SAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLANSDFD  120

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  121  AKPMVMLLGQYSTGKTTFIKHLLK  144



>ref|XP_009776641.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=470

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSLAQAG+A+T DLL+A VDFENL PP MEGLD  LA KKK   K+EP+QNGS P  
Sbjct  1    MQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKKPMPKSEPDQNGSAPVP  60

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
            ++PA SWF SSKSAKKVSL+SVTSIVDGLKKLYIQ LKPLE+ Y FNDFVSPLL NSDFD
Sbjct  61   TAPATSWFSSSKSAKKVSLTSVTSIVDGLKKLYIQKLKPLEIAYHFNDFVSPLLANSDFD  120

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  121  AKPMVMLLGQYSTGKTTFIKHLLK  144



>ref|XP_008371039.1| PREDICTED: EH domain-containing protein 3-like isoform X1 [Malus 
domestica]
Length=185

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 125/179 (70%), Gaps = 19/179 (11%)
 Frame = +3

Query  138  LSNLSRQELKQVWAIADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLE  317
            +S LSR+ELKQVWAIAD+KRQG++GF EFV  MQ++SLAQ   + T D+L   VD+EN +
Sbjct  1    MSRLSREELKQVWAIADTKRQGFVGFSEFVTAMQMISLAQDHES-TPDILKTTVDWENNK  59

Query  318  PPRMEGLDAQLAAKKKYTS---KNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsI  488
            PP +EGLD  +A  K  T+   +   ++ GS   +  P  +               VTSI
Sbjct  60   PPVIEGLDDLVAKTKSLTTYGVEVNVQRFGSKSAKKLPLNA---------------VTSI  104

Query  489  VDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            VDGLK++Y + LKPLE+ YRFNDF SPLLT+SDFD+ PMVMLLGQYSTGKTTFIKHLLR
Sbjct  105  VDGLKRMYNEKLKPLELAYRFNDFASPLLTDSDFDSKPMVMLLGQYSTGKTTFIKHLLR  163



>gb|KHG22957.1| EH domain-containing 1 [Gossypium arboreum]
Length=452

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  6    MEIDAAPISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIA  185
            MEI +  I  CSK H+KIYQEWF+FADSD DGRITG DA KFF +SNLSR +LKQVWA A
Sbjct  1    MEIGSGRIGSCSKEHQKIYQEWFNFADSDNDGRITGNDAIKFFGISNLSRPDLKQVWATA  60

Query  186  DSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKK  365
            DSKRQG+LGFKEFV  MQLVSLAQ G+ I+ DLL+  VDFEN++PP MEGLD  +  KK+
Sbjct  61   DSKRQGFLGFKEFVFAMQLVSLAQEGHQISHDLLNGDVDFENIKPPVMEGLDTLIMRKKQ  120

Query  366  YTSKNEPEQNGS  401
             +     E NG+
Sbjct  121  SSKSISLESNGA  132



>gb|AIE88276.1| hypothetical protein OG_BBa0063K01.7 [Oryza glaberrima]
Length=487

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 117/193 (61%), Gaps = 40/193 (21%)
 Frame = +3

Query  87   SDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEFVIGMQLVSLAQAGN  266
            S GDGR+TG DA KFFA+SNLSR ELKQVWAIADSKRQGYLGF EF+  MQ         
Sbjct  9    SHGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSEFMTAMQ---------  59

Query  267  AITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQss  446
                                          KK   SK+  +     P +   +A+WF S 
Sbjct  60   ------------------------------KKNSMSKSNSDIVVRHPSELPASANWFNSK  89

Query  447  ksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQY  626
               K    S  + I+DGLKK YI+ L+PLE TY+F+DFVSPLLT+SDFDA PMVMLLGQY
Sbjct  90   SGKKIPLRSVTS-IIDGLKKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQY  148

Query  627  STGKTTFIKHLLR  665
            STGKTTFIKHLL+
Sbjct  149  STGKTTFIKHLLK  161



>ref|XP_009111206.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Brassica 
rapa]
Length=470

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK-NEPEQNGSPPR  410
            MQLVSLAQ G+ I+ D+L + VDF+N+ PP MEGL   +A KK  +SK N+   NGSP  
Sbjct  1    MQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKHSSSKSNDLSVNGSPSA  60

Query  411  QSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDF  590
             +S  A WF S  S K    S  + IVDGLK+LYIQ LKPLEV YRFNDFVSPLLTNSDF
Sbjct  61   DASLTAHWFSSKSSKKISLSSVTS-IVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDF  119

Query  591  DAXPMVMLLGQYSTGKTTFIKHLLR  665
            DA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  120  DAKPMVMLLGQYSTGKTTFIKHLLK  144



>ref|XP_008370549.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=476

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  237  QLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK-NEPEQNGSPPRQ  413
            QLVS AQAG+ IT  LL++ V  E+L+ P MEGLDA L A KK+  K NE + NG+   Q
Sbjct  8    QLVSHAQAGHDITHGLLNSNVGLESLKXPVMEGLDALLLANKKHLPKSNENKVNGTAVVQ  67

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
             SP+A WF    S K    S  + I+DGLK+LY+Q LKPLEVTY+FN+FVSPL+TN DFD
Sbjct  68   QSPSALWFSPESSKKIPLSSVTS-IIDGLKRLYVQKLKPLEVTYKFNNFVSPLMTNGDFD  126

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  127  AKPMVMLLGQYSTGKTTFIKHLLK  150



>ref|XP_006585913.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X2 [Glycine max]
Length=246

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEP  386
            LGF EFV  MQLVSLAQ G  +  D+L  ++D EN++PP +EGLDA L A+   T    P
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQIDKENIKPPVLEGLDA-LVAQMSLTINAPP  132

Query  387  EQNGS  401
            E NG+
Sbjct  133  EVNGA  137



>ref|XP_005851211.1| hypothetical protein CHLNCDRAFT_33853 [Chlorella variabilis]
 gb|EFN59109.1| hypothetical protein CHLNCDRAFT_33853 [Chlorella variabilis]
Length=568

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 129/208 (62%), Gaps = 5/208 (2%)
 Frame = +3

Query  51   EKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEFVI  230
            +++Y  WF  AD+D DGR+TG DA +FF  S L+R+ L +VWA +D KRQG+L F  FV 
Sbjct  37   QELYWRWFQMADTDRDGRLTGADAVRFFERSGLARELLAKVWANSDHKRQGFLDFHAFVR  96

Query  231  GMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSK----NEPEQNG  398
             ++LVSLAQ+   +++D   A +    +EPPR+ GL+   AA             P    
Sbjct  97   ALELVSLAQSTGEVSMDTY-ANMQSAGIEPPRLRGLETDPAAPATAPHASALPRRPAGAE  155

Query  399  SPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLT  578
            S P  +S AA + +  K    +S    TSI +GLKK+Y   ++PLE +Y+F  F SPLL+
Sbjct  156  SSPSPASAAAMFGRKGKRRAALSTKDCTSITEGLKKIYFHKIRPLEESYKFGHFFSPLLS  215

Query  579  NSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
              DF+A P V+LLGQYSTGK+TFIK+LL
Sbjct  216  EGDFEAKPSVLLLGQYSTGKSTFIKYLL  243



>ref|XP_007515068.1| unnamed protein product [Bathycoccus prasinos]
 emb|CCO15308.1| unnamed protein product [Bathycoccus prasinos]
Length=548

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 128/220 (58%), Gaps = 13/220 (6%)
 Frame = +3

Query  45   AHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEF  224
            A EK+Y++WF   D+D DGRITG DA  FF+ S+L++Q L +VW  AD  RQGYL    F
Sbjct  6    ADEKLYRQWFPLCDTDNDGRITGNDAVVFFSKSSLNQQALAKVWGCADLNRQGYLDKDGF  65

Query  225  VIGMQLVSLAQAGNAITVDLLDAKVDFENLEPP--RMEGLDAQLAAKK---KYTSKNEPE  389
            +  M++++LAQ G + +V  L  +++    E P  +MEGLD     K+    +TS     
Sbjct  66   IRAMRVIALAQIGVSPSVANLQTELERRQGEMPLAKMEGLDETSGRKEDDDDFTSNPFMA  125

Query  390  QNGSPPRQSSPAASWF--------QssksakkvslssvtsIVDGLKKLYIQNLKPLEVTY  545
              G   +     AS          +  K   KV   +VT IVDGLK LY   +KPLE  Y
Sbjct  126  SPGEKIKDGRNKASNMLGGGAQTKKEKKRQAKVDAKTVTGIVDGLKLLYKTKIKPLEEAY  185

Query  546  RFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            +F  F  PLLT+ DFD  P V+LLGQYSTGKTTFI+HLL+
Sbjct  186  KFGSFYGPLLTDGDFDGKPNVLLLGQYSTGKTTFIQHLLK  225



>ref|XP_006585914.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X3 [Glycine max]
 ref|XP_006585915.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X4 [Glycine max]
Length=241

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            LGF EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T   
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINA  132

Query  381  EPEQNGS  401
             PE NG+
Sbjct  133  PPEVNGA  139



>ref|XP_006585916.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X5 [Glycine max]
 ref|XP_006585917.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X6 [Glycine max]
Length=236

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            LGF EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T   
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINA  132

Query  381  EPEQNGS  401
             PE NG+
Sbjct  133  PPEVNGA  139



>ref|XP_006585912.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X1 [Glycine max]
Length=248

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            LGF EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T   
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINA  132

Query  381  EPEQNGS  401
             PE NG+
Sbjct  133  PPEVNGA  139



>ref|XP_006585922.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X11 [Glycine max]
Length=196

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            LGF EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T   
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINA  132

Query  381  EPEQN  395
             PE++
Sbjct  133  PPEEH  137



>ref|XP_006585919.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X8 [Glycine max]
 ref|XP_006585920.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X9 [Glycine max]
 ref|XP_006585921.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X10 [Glycine max]
Length=201

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  14   IESRSKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  73

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKN  380
            LGF EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T   
Sbjct  74   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINA  132

Query  381  EPEQN  395
             PE++
Sbjct  133  PPEEH  137



>ref|XP_009603511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=467

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 9/147 (6%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGS---P  404
            MQLVSLAQAG+A+T D L+A+VDFENL+ P +EGLD +L AKKK  +K  P+QNGS   P
Sbjct  1    MQLVSLAQAGHAVTSDFLNAEVDFENLQLPSLEGLD-RLLAKKKRVAKWVPDQNGSLVLP  59

Query  405  PRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNS  584
             R     A+WF SSKS+KKVS + VTSI+DGLKKLY++ LKPLEVTY F+DFVSPLL NS
Sbjct  60   SR-----ANWFSSSKSSKKVSSNYVTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANS  114

Query  585  DFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            DFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  115  DFDAKPMVMLLGQYSTGKTTFIKHLLR  141



>ref|XP_006585918.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
isoform X7 [Glycine max]
Length=215

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            SK   K YQEWF+  DSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+LGF 
Sbjct  18   SKEETKTYQEWFNLVDSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGFLGFT  77

Query  219  EFVIGMQLVSLAQAGNAITVDLL--DAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPE  389
            EFV  MQLVSLAQ G  +  D+L   +K D EN++PP +EGLDA L A+   T    PE
Sbjct  78   EFVTAMQLVSLAQVGQELNSDILKTQSKFDKENIKPPVLEGLDA-LVAQMSLTINAPPE  135



>ref|XP_009770779.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 118/144 (82%), Gaps = 3/144 (2%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSLAQAG+A+T D L+A+VDFE L+ P MEGLD  L AKKK  +K  P++NGS    
Sbjct  1    MQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDG-LLAKKKRVAKWAPDRNGS--LM  57

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
             S  A+WF SSKSAKKVS + VTSI+DGLKKLY++ LKPLEVTY F+DFVSPLL NSDFD
Sbjct  58   LSSGANWFSSSKSAKKVSSNYVTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANSDFD  117

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLLR
Sbjct  118  AKPMVMLLGQYSTGKTTFIKHLLR  141



>ref|XP_002946165.1| hypothetical protein VOLCADRAFT_55400 [Volvox carteri f. nagariensis]
 gb|EFJ53160.1| hypothetical protein VOLCADRAFT_55400 [Volvox carteri f. nagariensis]
Length=476

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 109/201 (54%), Gaps = 16/201 (8%)
 Frame = +3

Query  60   YQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEFVIGMQ  239
            Y  WF  ADSD DGR+TGGDA  FF  S L R+ L  VW +A+ +R GYL    F   M 
Sbjct  9    YDRWFQSADSDRDGRVTGGDAVAFFGRSGLPREVLATVWELANDRRLGYLDRMAFHKAMD  68

Query  240  LVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSS  419
            L+SLAQ+G  +T D   A++D      P M GL     A  K          G     S 
Sbjct  69   LISLAQSGQPVTKDGYLAQIDAGGFRLPTMAGLS---DADGKPIDAAPAAPVGGAIYGSK  125

Query  420  PAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAX  599
            P               +   TS++DGLK++Y   ++PLE  ++F  F SPLL  SDF+A 
Sbjct  126  PVP-------------MKVCTSVIDGLKQIYFTKVRPLEEQFKFGHFFSPLLNESDFEAK  172

Query  600  PMVMLLGQYSTGKTTFIKHLL  662
            P V+LLGQYSTGKTTFIK+LL
Sbjct  173  PSVLLLGQYSTGKTTFIKYLL  193



>ref|XP_006452453.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65693.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=438

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +3

Query  327  MEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKK  506
            MEGLD  LA K+  +  ++P  NGS   Q SP+A+WF S  S K    S  + I+DGLK+
Sbjct  1    MEGLDKLLANKRHSSKTSDPNLNGSLQPQPSPSANWFSSKSSKKISMSSVTS-IIDGLKR  59

Query  507  LYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            LYIQ LKPLEVTYRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLLR
Sbjct  60   LYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  112



>ref|XP_009779284.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009779285.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSLAQAG+A+T D L+A+VDFE L+ P MEGLD  L AKKK  +K  P++NGS    
Sbjct  1    MQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDG-LLAKKKRVAKWAPDRNGSLVLS  59

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
            S   A+WF SSKS+KKV    VTSI+DGLKKLY++ LKPLEV Y F+DFVSPLL NSDFD
Sbjct  60   SR--ANWFSSSKSSKKVPSHYVTSIIDGLKKLYVKKLKPLEVAYHFSDFVSPLLANSDFD  117

Query  594  AXPMVMLLGQYSTGKTTFIKHLLR  665
            A PMVMLLGQYSTGKTTFIKHLL+
Sbjct  118  AKPMVMLLGQYSTGKTTFIKHLLK  141



>ref|XP_003055188.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60440.1| predicted protein [Micromonas pusilla CCMP1545]
Length=526

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 121/217 (56%), Gaps = 39/217 (18%)
 Frame = +3

Query  51   EKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEFVI  230
            E +Y+ WF  AD D DGR+TG DA +FF  S L ++ L +VW +AD+ RQG+LG ++FV 
Sbjct  11   EVLYRGWFPLADDDADGRVTGADAVRFFGRSGLPKEILARVWQLADANRQGFLGPEQFVK  70

Query  231  GMQLVSLAQAGN------AITVDLLDA-------KVDFENLEPPRMEGLDAQLAAKKKYT  371
             ++++++AQ+ +      +IT D L A         D    EP  +  L+ + AA   + 
Sbjct  71   ALRVIAMAQSASGGADAKSITADALAAFMARDDDDDDANKGEPLPLAKLEGRDAANGNHG  130

Query  372  SKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRF  551
             KN         R S+  A+                 SIVD LK+LY   ++P+E   +F
Sbjct  131  KKN---------RMSAKTAT-----------------SIVDSLKELYKTKVRPVEEALKF  164

Query  552  NDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
              F SPLLT+ DF+  P V+LLGQYSTGKTTFIKHLL
Sbjct  165  GSFYSPLLTDGDFEGKPNVLLLGQYSTGKTTFIKHLL  201



>gb|KHG01502.1| EH domain-containing 1 [Gossypium arboreum]
Length=475

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +3

Query  234  MQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQ  413
            MQLVSL Q GN ++ D+L   VDFEN++PP+MEGLD  +  KK  ++ ++P+ +G+ PRQ
Sbjct  1    MQLVSLVQDGNELSHDILKGDVDFENVKPPKMEGLDELIQKKKNPSNSSKPDSDGNSPRQ  60

Query  414  SSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFD  593
            +S    WF S  S + +S  +   I DGLKKLY + LKPLEVTY FNDFVSPLLTNSDFD
Sbjct  61   ASITTQWFSSKPSKRYLSNVTS--IQDGLKKLYTRKLKPLEVTYCFNDFVSPLLTNSDFD  118

Query  594  AXPMVMLLGQY  626
            A PMVMLLG +
Sbjct  119  AKPMVMLLGAH  129



>gb|KHN38606.1| Epidermal growth factor receptor substrate 15 like [Glycine soja]
Length=223

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 85/134 (63%), Gaps = 24/134 (18%)
 Frame = +3

Query  27   ISRCSKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGY  206
            I   SK   K YQEWF+ ADSDGDGRI+G D TKFFALSNLSR +LK++WA+AD KRQG+
Sbjct  3    IESRSKEETKTYQEWFNLADSDGDGRISGNDTTKFFALSNLSRSQLKRLWALADVKRQGF  62

Query  207  LGFKEFVIGMQLVSLAQAGNAITVDLLDAK------------------------VDFENL  314
            LGF EFV  MQLVSLAQ G  +  D+L  +                        VD EN+
Sbjct  63   LGFTEFVTAMQLVSLAQVGQELNSDILKTQSKCTFIIFPSSLEIAKMTLFPFITVDKENI  122

Query  315  EPPRMEGLDAQLAA  356
            +PP +EGLDA +A+
Sbjct  123  KPPVLEGLDALVAS  136



>ref|XP_005643284.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18740.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
Length=540

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 115/207 (56%), Gaps = 13/207 (6%)
 Frame = +3

Query  48   HEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFKEFV  227
            +E  + EWF  AD D DG++TG DA +FF  S L R  L +VW++ADS R+GYL  K F 
Sbjct  18   NEHKFAEWFRVADKDADGKLTGADAVRFFERSGLPRDLLAKVWSLADSSRRGYLDVKGFS  77

Query  228  IGMQLVSLAQAGNAITVDLLDAKVDFEN--LEPPRMEGLDAQLAAKKKYTSKNEPEQNGS  401
              M L+S+AQ    ++ +      +     L PP+M G++ Q +     T  +  +    
Sbjct  78   KAMDLISVAQETGEVSAEAYTQAWNEVGGILPPPQMVGIEDQASTPSSMTPGSARKSGWG  137

Query  402  PPRQSSPAASWFQssksakkvslssvtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTN  581
              R +  +           ++S +  TSIVDGLK +Y   ++PLE  Y+F  F S  L  
Sbjct  138  RSRTTKKS-----------RLSTAECTSIVDGLKLIYFTKIRPLEEMYKFGAFFSSYLNE  186

Query  582  SDFDAXPMVMLLGQYSTGKTTFIKHLL  662
            SDF A P V+LLGQYSTGKTTFIKHLL
Sbjct  187  SDFYAKPSVLLLGQYSTGKTTFIKHLL  213



>ref|XP_006406402.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47855.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=443

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +3

Query  312  LEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIV  491
            + PP MEGL   +A KK  +  ++P  NGSP   +S  A WF S  S K    S  + IV
Sbjct  1    MNPPIMEGLGVLMAKKKHSSKSSDPSVNGSPAADTSLTAHWFSSKSSKKISLSSVTS-IV  59

Query  492  DGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLLR  665
            DGLK+LYIQ LKPLEV YRFNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFIKHLL+
Sbjct  60   DGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLK  117



>ref|XP_011402336.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
 gb|KFM29283.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
Length=598

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 119/240 (50%), Gaps = 34/240 (14%)
 Frame = +3

Query  39   SKAHEKIYQEWFSFADSDGDGRITGGDATKFFALSNLSRQELKQVWAIADSKRQGYLGFK  218
            S +++++Y  WF  AD+DGDGR+TG DA  FF  S L R  L +VWA AD  R+G+L   
Sbjct  20   SVSNDELYLSWFQTADTDGDGRLTGPDAVTFFQRSGLQRDALAKVWAAADYSRRGFLDLP  79

Query  219  EFVIGMQLVSLAQAGNAITVDLLDAKVDFENLEPPRMEGLDAQLAAKKKYT---------  371
             F   M+L+S+AQ    +  +    +     + PPRM GL+ + A    +T         
Sbjct  80   AFAKAMELISVAQRTGKVGGEAY-TQAKAMGVAPPRMAGLEKK-AGPGSHTERGGINPFG  137

Query  372  ----SKNEPEQNGSPPRQSSP-------------------AASWFQssksakkvslssvt  482
                S++ P    SPP    P                     S    S     ++     
Sbjct  138  GAESSESTPRLASSPPVGVPPFKLAFPPQAEASSHPSTARTTSRRHQSLRRPVMTTKEAV  197

Query  483  sIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKHLL  662
             I +GLK +Y   ++PLE  Y+F  F SPLL+  DF+A P V+LLGQYSTGK+TFIK LL
Sbjct  198  GISEGLKNIYFNKIRPLEDGYKFGHFFSPLLSAGDFEAKPSVLLLGQYSTGKSTFIKFLL  257



>ref|XP_010252586.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=450

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 92/123 (75%), Gaps = 11/123 (9%)
 Frame = +3

Query  297  VDFENLEPPRMEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslss  476
            +D ENL PP MEGL   +A  K+           +P +  S  A+WF SS+S+KK+ L+S
Sbjct  13   IDLENLNPPVMEGLTILMAKIKQ-----------APKKPESEKANWFSSSRSSKKLFLNS  61

Query  477  vtsIVDGLKKLYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLGQYSTGKTTFIKH  656
            VTSIVDGLKKLY + LKPLEVTY FNDFVSPLLTNSDFDA PMVMLLGQYSTGKTTFI H
Sbjct  62   VTSIVDGLKKLYTEKLKPLEVTYHFNDFVSPLLTNSDFDARPMVMLLGQYSTGKTTFITH  121

Query  657  LLR  665
            LL+
Sbjct  122  LLK  124



>emb|CDP13785.1| unnamed protein product [Coffea canephora]
Length=107

 Score =   123 bits (308),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = +3

Query  327  MEGLDAQLAAKKKYTSKNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsIVDGLKK  506
            MEGLDA L AKKK+T K+E EQNG P  QSSP+A+WF SSKSAKKVSLSSVTSI+DGLKK
Sbjct  1    MEGLDA-LLAKKKHTPKSELEQNGIPQLQSSPSANWFSSSKSAKKVSLSSVTSIIDGLKK  59

Query  507  LYIQNLKPLEVTYRFNDFVSPLLTNSDFDAXPMVMLLG  620
            LY+Q LKPLE TYRFNDFV PLLTNSDFDA PMVM+ G
Sbjct  60   LYVQKLKPLEATYRFNDFVPPLLTNSDFDAKPMVMVFG  97



>ref|XP_008371040.1| PREDICTED: uncharacterized protein LOC103434458 isoform X2 [Malus 
domestica]
Length=180

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 19/149 (13%)
 Frame = +3

Query  138  LSNLSRQELKQVWAIADSKRQGYLGFKEFVIGMQLVSLAQAGNAITVDLLDAKVDFENLE  317
            +S LSR+ELKQVWAIAD+KRQG++GF EFV  MQ++SLAQ   + T D+L   VD+EN +
Sbjct  1    MSRLSREELKQVWAIADTKRQGFVGFSEFVTAMQMISLAQDHES-TPDILKTTVDWENNK  59

Query  318  PPRMEGLDAQLAAKKKYTS---KNEPEQNGSPPRQSSPAASWFQssksakkvslssvtsI  488
            PP +EGLD  +A  K  T+   +   ++ GS   +  P  +               VTSI
Sbjct  60   PPVIEGLDDLVAKTKSLTTYGVEVNVQRFGSKSAKKLPLNA---------------VTSI  104

Query  489  VDGLKKLYIQNLKPLEVTYRFNDFVSPLL  575
            VDGLK++Y + LKPLE+ YRFNDF SPLL
Sbjct  105  VDGLKRMYNEKLKPLELAYRFNDFASPLL  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960