BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020D23

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003612250.1|  Prolyl 4-hydroxylase alpha-2 subunit               249   7e-80   
ref|XP_009622125.1|  PREDICTED: probable prolyl 4-hydroxylase 10        252   7e-80   Nicotiana tomentosiformis
ref|XP_009776785.1|  PREDICTED: probable prolyl 4-hydroxylase 10        249   1e-78   Nicotiana sylvestris
ref|XP_003612249.1|  Prolyl 4-hydroxylase alpha-2 subunit               248   2e-78   Medicago truncatula
gb|KDO71357.1|  hypothetical protein CISIN_1g023009mg                   241   7e-77   Citrus sinensis [apfelsine]
emb|CDP01844.1|  unnamed protein product                                244   9e-77   Coffea canephora [robusta coffee]
ref|XP_004512179.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    244   1e-76   
gb|KJB43229.1|  hypothetical protein B456_007G190600                    241   1e-76   Gossypium raimondii
gb|KHN35999.1|  Prolyl 4-hydroxylase subunit alpha-1                    244   1e-76   Glycine soja [wild soybean]
ref|NP_001242522.1|  uncharacterized protein LOC100806046               243   2e-76   
ref|XP_006425362.1|  hypothetical protein CICLE_v10026208mg             241   6e-76   
gb|ACU17088.1|  unknown                                                 239   8e-76   Glycine max [soybeans]
ref|XP_009801759.1|  PREDICTED: probable prolyl 4-hydroxylase 10        241   9e-76   Nicotiana sylvestris
ref|XP_009587704.1|  PREDICTED: probable prolyl 4-hydroxylase 10        241   9e-76   Nicotiana tomentosiformis
gb|KJB43228.1|  hypothetical protein B456_007G190600                    241   1e-75   Gossypium raimondii
gb|KDO71356.1|  hypothetical protein CISIN_1g023009mg                   240   1e-75   Citrus sinensis [apfelsine]
ref|XP_006467023.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    241   1e-75   Citrus sinensis [apfelsine]
ref|XP_006425363.1|  hypothetical protein CICLE_v10026208mg             241   1e-75   Citrus clementina [clementine]
gb|KDO71351.1|  hypothetical protein CISIN_1g023009mg                   241   2e-75   Citrus sinensis [apfelsine]
gb|KJB43227.1|  hypothetical protein B456_007G190600                    240   2e-75   Gossypium raimondii
ref|XP_003538892.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    238   3e-74   Glycine max [soybeans]
ref|XP_010113287.1|  Prolyl 4-hydroxylase subunit alpha-1               238   3e-74   Morus notabilis
ref|XP_006467024.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    237   4e-74   Citrus sinensis [apfelsine]
gb|KDO71350.1|  hypothetical protein CISIN_1g023009mg                   236   7e-74   Citrus sinensis [apfelsine]
ref|XP_006340784.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    234   5e-73   Solanum tuberosum [potatoes]
ref|XP_006343343.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    234   6e-73   Solanum tuberosum [potatoes]
ref|XP_004234520.1|  PREDICTED: probable prolyl 4-hydroxylase 10        234   1e-72   Solanum lycopersicum
ref|XP_010465981.1|  PREDICTED: probable prolyl 4-hydroxylase 10 ...    231   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010444842.1|  PREDICTED: probable prolyl 4-hydroxylase 10        230   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004232524.1|  PREDICTED: probable prolyl 4-hydroxylase 10        229   8e-71   Solanum lycopersicum
ref|XP_009112275.1|  PREDICTED: probable prolyl 4-hydroxylase 10        229   9e-71   Brassica rapa
gb|EYU30384.1|  hypothetical protein MIMGU_mgv1a011046mg                228   2e-70   Erythranthe guttata [common monkey flower]
dbj|BAB10411.1|  prolyl 4-hydroxylase, alpha subunit-like protein       226   4e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81416.1|  BnaC09g08270D                                          227   5e-70   
ref|XP_002866777.1|  oxidoreductase                                     226   5e-70   
ref|XP_004291329.1|  PREDICTED: probable prolyl 4-hydroxylase 3         227   5e-70   Fragaria vesca subsp. vesca
ref|NP_201407.4|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    226   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280909.1|  hypothetical protein CARUB_v10026902mg             225   3e-69   Capsella rubella
ref|XP_008387906.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    223   9e-69   
ref|XP_008387904.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    223   1e-68   
gb|KHG30312.1|  Prolyl 4-hydroxylase subunit alpha-1                    223   1e-68   Gossypium arboreum [tree cotton]
ref|XP_006393794.1|  hypothetical protein EUTSA_v10004714mg             223   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009149624.1|  PREDICTED: probable prolyl 4-hydroxylase 3         221   2e-68   
gb|KDO71358.1|  hypothetical protein CISIN_1g023009mg                   219   2e-68   Citrus sinensis [apfelsine]
ref|XP_010550487.1|  PREDICTED: probable prolyl 4-hydroxylase 10        221   6e-68   Tarenaya hassleriana [spider flower]
gb|KDP23952.1|  hypothetical protein JCGZ_25340                         221   6e-68   Jatropha curcas
emb|CAN64470.1|  hypothetical protein VITISV_014644                     221   7e-68   Vitis vinifera
ref|NP_001190630.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    219   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530636.1|  prolyl 4-hydroxylase alpha subunit, putative       221   8e-68   Ricinus communis
ref|XP_002263060.1|  PREDICTED: probable prolyl 4-hydroxylase 10        221   9e-68   Vitis vinifera
emb|CDY29362.1|  BnaA06g14340D                                          220   2e-67   Brassica napus [oilseed rape]
ref|XP_002893096.1|  oxidoreductase                                     219   4e-67   
emb|CDY51328.1|  BnaCnng20650D                                          219   4e-67   Brassica napus [oilseed rape]
ref|NP_564109.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    219   7e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61711.1|  putative prolyl 4-hydroxylase, alpha subunit            218   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266900.1|  PREDICTED: probable prolyl 4-hydroxylase 3         218   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_006305481.1|  hypothetical protein CARUB_v10009921mg             218   1e-66   Capsella rubella
ref|XP_010480555.1|  PREDICTED: probable prolyl 4-hydroxylase 3         216   7e-66   
ref|XP_011079010.1|  PREDICTED: probable prolyl 4-hydroxylase 10        216   2e-65   Sesamum indicum [beniseed]
ref|XP_010477260.1|  PREDICTED: probable prolyl 4-hydroxylase 3         215   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008440878.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    214   3e-65   Cucumis melo [Oriental melon]
ref|XP_007046593.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    214   4e-65   
ref|XP_010498461.1|  PREDICTED: probable prolyl 4-hydroxylase 3         214   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_004134841.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    214   5e-65   Cucumis sativus [cucumbers]
ref|XP_004158845.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    214   5e-65   
ref|XP_010459709.1|  PREDICTED: probable prolyl 4-hydroxylase 3         214   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007046594.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    214   8e-65   
gb|KJB48236.1|  hypothetical protein B456_008G061800                    212   1e-64   Gossypium raimondii
ref|XP_010266054.1|  PREDICTED: probable prolyl 4-hydroxylase 3         213   1e-64   Nelumbo nucifera [Indian lotus]
gb|EPS71884.1|  hypothetical protein M569_02873                         213   1e-64   Genlisea aurea
ref|XP_010033532.1|  PREDICTED: probable prolyl 4-hydroxylase 10        213   2e-64   Eucalyptus grandis [rose gum]
gb|KJB48235.1|  hypothetical protein B456_008G061800                    213   2e-64   Gossypium raimondii
gb|EPS63604.1|  iron ion binding / oxidoreductase/ oxidoreductase...    211   6e-64   Genlisea aurea
ref|XP_007157869.1|  hypothetical protein PHAVU_002G104900g             209   3e-63   Phaseolus vulgaris [French bean]
ref|XP_009334602.1|  PREDICTED: probable prolyl 4-hydroxylase 3         208   7e-63   Pyrus x bretschneideri [bai li]
ref|XP_010683036.1|  PREDICTED: probable prolyl 4-hydroxylase 10        208   7e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009386075.1|  PREDICTED: probable prolyl 4-hydroxylase 3         207   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07346.1|  unnamed protein product                                207   3e-62   Coffea canephora [robusta coffee]
gb|KHG25174.1|  phy-2: Prolyl 4-hydroxylase subunit alpha-2             208   3e-62   Gossypium arboreum [tree cotton]
ref|XP_010536435.1|  PREDICTED: probable prolyl 4-hydroxylase 3         207   3e-62   Tarenaya hassleriana [spider flower]
gb|KHG25173.1|  P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1           208   5e-62   Gossypium arboreum [tree cotton]
gb|KDO75955.1|  hypothetical protein CISIN_1g0230532mg                  203   7e-62   Citrus sinensis [apfelsine]
ref|XP_007202401.1|  hypothetical protein PRUPE_ppa009475mg             205   1e-61   Prunus persica
ref|XP_008242010.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    205   2e-61   Prunus mume [ume]
ref|XP_008221210.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    204   5e-61   Prunus mume [ume]
ref|XP_002869059.1|  oxidoreductase                                     204   5e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_010029633.1|  PREDICTED: probable prolyl 4-hydroxylase 10        204   9e-61   Eucalyptus grandis [rose gum]
gb|EYU36811.1|  hypothetical protein MIMGU_mgv1a011044mg                203   1e-60   Erythranthe guttata [common monkey flower]
gb|KDO75954.1|  hypothetical protein CISIN_1g0230532mg                  202   1e-60   Citrus sinensis [apfelsine]
ref|XP_008377129.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    202   1e-60   Malus domestica [apple tree]
ref|XP_004287769.1|  PREDICTED: probable prolyl 4-hydroxylase 10        202   2e-60   Fragaria vesca subsp. vesca
ref|XP_007223346.1|  hypothetical protein PRUPE_ppa009548mg             202   3e-60   
ref|XP_006449333.1|  hypothetical protein CICLE_v10016152mg             201   3e-60   Citrus clementina [clementine]
emb|CDY54327.1|  BnaCnng26730D                                          201   3e-60   Brassica napus [oilseed rape]
ref|XP_006828848.1|  hypothetical protein AMTR_s00001p00155640          201   3e-60   
emb|CDX96644.1|  BnaA08g21870D                                          201   4e-60   
ref|XP_009363441.1|  PREDICTED: probable prolyl 4-hydroxylase 10        201   8e-60   Pyrus x bretschneideri [bai li]
ref|XP_010446875.1|  PREDICTED: prolyl 4-hydroxylase 5-like             201   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008393737.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    200   1e-59   Malus domestica [apple tree]
ref|XP_009110235.1|  PREDICTED: probable prolyl 4-hydroxylase 3         200   1e-59   Brassica rapa
ref|XP_011022255.1|  PREDICTED: probable prolyl 4-hydroxylase 10        200   1e-59   Populus euphratica
ref|XP_010548243.1|  PREDICTED: prolyl 4-hydroxylase 5                  200   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_009397948.1|  PREDICTED: probable prolyl 4-hydroxylase 3         199   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004171765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    199   3e-59   
ref|XP_002285898.1|  PREDICTED: probable prolyl 4-hydroxylase 3         198   6e-59   Vitis vinifera
ref|XP_006577956.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    196   3e-58   Glycine max [soybeans]
ref|XP_006383041.1|  hypothetical protein POPTR_0005s10980g             196   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_008456388.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    196   3e-58   Cucumis melo [Oriental melon]
ref|XP_006577957.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    196   3e-58   Glycine max [soybeans]
ref|XP_008456383.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    196   4e-58   Cucumis melo [Oriental melon]
ref|XP_009337076.1|  PREDICTED: probable prolyl 4-hydroxylase 10        196   6e-58   Pyrus x bretschneideri [bai li]
ref|XP_011003088.1|  PREDICTED: probable prolyl 4-hydroxylase 3         195   1e-57   Populus euphratica
ref|XP_010100124.1|  Prolyl 4-hydroxylase subunit alpha-2               194   2e-57   Morus notabilis
emb|CDY07826.1|  BnaC03g47960D                                          194   2e-57   Brassica napus [oilseed rape]
ref|XP_009344824.1|  PREDICTED: probable prolyl 4-hydroxylase 10        194   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_002307750.2|  oxidoreductase family protein                      193   6e-57   
ref|XP_010437420.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    192   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008337965.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    192   1e-56   Malus domestica [apple tree]
gb|KGN60775.1|  hypothetical protein Csa_2G009620                       192   1e-56   Cucumis sativus [cucumbers]
ref|XP_002510597.1|  prolyl 4-hydroxylase alpha subunit, putative       192   2e-56   
ref|XP_010266902.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    192   2e-56   
ref|XP_007136121.1|  hypothetical protein PHAVU_009G019600g             192   2e-56   Phaseolus vulgaris [French bean]
ref|XP_010266901.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    192   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_003570489.1|  PREDICTED: probable prolyl 4-hydroxylase 3         192   3e-56   Brachypodium distachyon [annual false brome]
gb|ABK24739.1|  unknown                                                 191   7e-56   Picea sitchensis
ref|XP_006285542.1|  hypothetical protein CARUB_v10006984mg             190   8e-56   Capsella rubella
ref|XP_003603827.1|  Prolyl 4-hydroxylase alpha-2 subunit               190   9e-56   Medicago truncatula
ref|XP_010437419.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    189   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009109263.1|  PREDICTED: prolyl 4-hydroxylase 5-like             189   2e-55   Brassica rapa
ref|XP_009798871.1|  PREDICTED: probable prolyl 4-hydroxylase 3         189   3e-55   Nicotiana sylvestris
gb|KDP36874.1|  hypothetical protein JCGZ_08165                         188   5e-55   Jatropha curcas
ref|XP_008809399.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    187   5e-55   
ref|XP_006425365.1|  hypothetical protein CICLE_v10026208mg             186   6e-55   
emb|CDY24822.1|  BnaA08g14880D                                          188   7e-55   Brassica napus [oilseed rape]
ref|XP_010940405.1|  PREDICTED: probable prolyl 4-hydroxylase 3         188   8e-55   Elaeis guineensis
ref|XP_009121088.1|  PREDICTED: prolyl 4-hydroxylase 5-like             188   8e-55   Brassica rapa
ref|XP_007017902.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    187   8e-55   Theobroma cacao [chocolate]
emb|CDY20811.1|  BnaC07g06600D                                          187   9e-55   Brassica napus [oilseed rape]
ref|XP_008456352.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    187   1e-54   
emb|CDY24364.1|  BnaA07g02890D                                          187   1e-54   Brassica napus [oilseed rape]
ref|XP_007156206.1|  hypothetical protein PHAVU_003G267200g             187   1e-54   Phaseolus vulgaris [French bean]
ref|XP_007017904.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    187   1e-54   
dbj|BAK01841.1|  predicted protein                                      188   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO71354.1|  hypothetical protein CISIN_1g023009mg                   186   1e-54   Citrus sinensis [apfelsine]
ref|XP_008809395.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    187   2e-54   Phoenix dactylifera
ref|XP_009620049.1|  PREDICTED: probable prolyl 4-hydroxylase 3         187   2e-54   Nicotiana tomentosiformis
gb|KHG08442.1|  Prolyl 4-hydroxylase subunit alpha-1                    187   2e-54   Gossypium arboreum [tree cotton]
ref|XP_011083428.1|  PREDICTED: probable prolyl 4-hydroxylase 3         187   2e-54   Sesamum indicum [beniseed]
ref|XP_006342080.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    186   2e-54   Solanum tuberosum [potatoes]
gb|EPS68098.1|  hypothetical protein M569_06675                         186   3e-54   Genlisea aurea
ref|XP_004954469.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    187   3e-54   Setaria italica
gb|KJB29665.1|  hypothetical protein B456_005G112700                    186   4e-54   Gossypium raimondii
ref|XP_004238387.1|  PREDICTED: probable prolyl 4-hydroxylase 3         186   5e-54   Solanum lycopersicum
ref|XP_008809398.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    186   5e-54   Phoenix dactylifera
ref|XP_004139389.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    185   6e-54   
ref|XP_011014780.1|  PREDICTED: probable prolyl 4-hydroxylase 10        184   1e-53   Populus euphratica
ref|XP_008778312.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    185   1e-53   
ref|XP_008778322.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    185   1e-53   Phoenix dactylifera
ref|NP_195306.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    184   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KHN09058.1|  Prolyl 4-hydroxylase subunit alpha-2                    184   2e-53   Glycine soja [wild soybean]
ref|XP_010667434.1|  PREDICTED: probable prolyl 4-hydroxylase 3         184   3e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG14293.1|  Prolyl 4-hydroxylase subunit alpha-2                    184   3e-53   Gossypium arboreum [tree cotton]
ref|XP_010918436.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    183   4e-53   Elaeis guineensis
gb|KDO75956.1|  hypothetical protein CISIN_1g0230532mg                  179   4e-53   Citrus sinensis [apfelsine]
ref|XP_006648159.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    183   5e-53   Oryza brachyantha
gb|KJB59734.1|  hypothetical protein B456_009G269000                    183   6e-53   Gossypium raimondii
gb|KJB59733.1|  hypothetical protein B456_009G269000                    182   7e-53   Gossypium raimondii
emb|CDY29194.1|  BnaA06g25630D                                          182   8e-53   Brassica napus [oilseed rape]
ref|XP_006581148.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    182   9e-53   Glycine max [soybeans]
gb|AFW63914.1|  hypothetical protein ZEAMMB73_179176                    180   9e-53   
dbj|BAD23054.1|  putative prolyl 4-hydroxylase                          183   1e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KCW68010.1|  hypothetical protein EUGRSUZ_F01696                     180   1e-52   Eucalyptus grandis [rose gum]
ref|XP_011074717.1|  PREDICTED: probable prolyl 4-hydroxylase 3         182   1e-52   Sesamum indicum [beniseed]
ref|XP_010918438.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    182   1e-52   Elaeis guineensis
ref|XP_002453082.1|  hypothetical protein SORBIDRAFT_04g038020          182   1e-52   Sorghum bicolor [broomcorn]
ref|XP_002884079.1|  oxidoreductase                                     182   2e-52   
ref|XP_008347372.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    177   2e-52   
gb|EEE58093.1|  hypothetical protein OsJ_08962                          184   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150771.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X2       181   3e-52   Brassica rapa
ref|XP_004167095.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    180   3e-52   
ref|XP_010539828.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    181   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_006409254.1|  hypothetical protein EUTSA_v10022796mg             181   4e-52   Eutrema salsugineum [saltwater cress]
ref|XP_009392830.1|  PREDICTED: probable prolyl 4-hydroxylase 3         181   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010489402.1|  PREDICTED: prolyl 4-hydroxylase 5                  181   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010514697.1|  PREDICTED: prolyl 4-hydroxylase 5-like             181   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006380560.1|  hypothetical protein POPTR_0007s09270g             180   5e-52   
ref|NP_001241695.1|  prolyl 4-hydroxylase 8-5                           181   7e-52   
ref|XP_009150770.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X1       180   7e-52   Brassica rapa
ref|NP_001159002.1|  prolyl 4-hydroxylase alpha-2 subunit               181   7e-52   Zea mays [maize]
ref|XP_003574128.1|  PREDICTED: probable prolyl 4-hydroxylase 3         180   8e-52   Brachypodium distachyon [annual false brome]
gb|EEC74283.1|  hypothetical protein OsI_09531                          182   1e-51   Oryza sativa Indica Group [Indian rice]
dbj|BAJ85763.1|  predicted protein                                      180   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_179363.1|  prolyl 4-hydroxylase 5                                179   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65040.1|  putative prolyl 4-hydroxylase, alpha subunit            179   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467565.1|  PREDICTED: prolyl 4-hydroxylase 5                  179   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010061109.1|  PREDICTED: probable prolyl 4-hydroxylase 3         180   2e-51   Eucalyptus grandis [rose gum]
ref|NP_001151238.1|  LOC100284871                                       179   2e-51   Zea mays [maize]
gb|AGP04976.1|  prolyl-4-hydroxylase 6_b                                178   3e-51   Physcomitrella patens
ref|NP_001241694.1|  prolyl 4-hydroxylase 8-4                           179   3e-51   
ref|XP_006298248.1|  hypothetical protein CARUB_v10014309mg             178   5e-51   Capsella rubella
gb|AGP04975.1|  prolyl-4-hydroxylase 6_a                                179   7e-51   Physcomitrella patens
tpg|DAA49454.1|  TPA: hypothetical protein ZEAMMB73_536273              175   1e-50   
gb|KJB58041.1|  hypothetical protein B456_009G191400                    177   1e-50   Gossypium raimondii
gb|KJB58040.1|  hypothetical protein B456_009G191400                    176   1e-50   Gossypium raimondii
ref|XP_009418644.1|  PREDICTED: probable prolyl 4-hydroxylase 3         177   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467008.1|  hypothetical protein SORBIDRAFT_01g018200          177   2e-50   Sorghum bicolor [broomcorn]
ref|XP_010063298.1|  PREDICTED: probable prolyl 4-hydroxylase 3         174   3e-50   
gb|EEE51215.1|  hypothetical protein OsJ_32038                          174   3e-50   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE92293.1|  putative prolyl 4-hydroxylase, alpha subunit           176   3e-50   Cryptomeria japonica
gb|KCW70504.1|  hypothetical protein EUGRSUZ_F03711                     175   7e-50   Eucalyptus grandis [rose gum]
ref|XP_010432226.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    175   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010432224.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    175   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_003520105.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    175   8e-50   Glycine max [soybeans]
ref|NP_001064962.1|  Os10g0497800                                       175   1e-49   
ref|NP_001131953.1|  uncharacterized protein LOC100193348               174   2e-49   Zea mays [maize]
ref|XP_010935631.1|  PREDICTED: probable prolyl 4-hydroxylase 3         174   2e-49   Elaeis guineensis
ref|XP_009394475.1|  PREDICTED: probable prolyl 4-hydroxylase 3         174   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL58274.1|AC068923_16  putative prolyl 4-hydroxylase, alpha s...    175   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802391.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    174   3e-49   
tpg|DAA49456.1|  TPA: hypothetical protein ZEAMMB73_536273              175   3e-49   
ref|XP_010266056.1|  PREDICTED: probable prolyl 4-hydroxylase 3         173   4e-49   
ref|XP_008802369.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    172   1e-48   Phoenix dactylifera
ref|XP_003629229.1|  Prolyl 4-hydroxylase alpha-2 subunit               171   1e-48   Medicago truncatula
ref|XP_010432225.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    172   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010432223.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    172   2e-48   Camelina sativa [gold-of-pleasure]
gb|KHN00440.1|  Prolyl 4-hydroxylase subunit alpha-1                    176   3e-48   Glycine soja [wild soybean]
ref|XP_009149614.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    169   5e-48   Brassica rapa
emb|CDX69169.1|  BnaC01g02840D                                          170   5e-48   
emb|CAA21467.1|  putative protein                                       169   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149485.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    169   2e-47   Brassica rapa
ref|XP_010531576.1|  PREDICTED: prolyl 4-hydroxylase 5-like             170   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_006661912.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   3e-47   Oryza brachyantha
ref|XP_004487245.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    168   3e-47   Cicer arietinum [garbanzo]
emb|CDX75528.1|  BnaA01g01740D                                          166   1e-46   
ref|XP_006386160.1|  hypothetical protein POPTR_0002s01820g             162   4e-45   
ref|XP_006836966.1|  hypothetical protein AMTR_s00098p00020560          158   2e-44   
ref|XP_010266057.1|  PREDICTED: probable prolyl 4-hydroxylase 10        160   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_003629231.1|  Prolyl 4-hydroxylase alpha-2 subunit               159   4e-44   Medicago truncatula
ref|XP_003629236.1|  Prolyl 4-hydroxylase alpha-2 subunit               160   4e-44   
gb|AET03711.2|  prolyl 4-hydroxylase alpha subunit, putative            157   8e-44   Medicago truncatula
gb|KJB59735.1|  hypothetical protein B456_009G269000                    158   2e-43   Gossypium raimondii
gb|KJB59736.1|  hypothetical protein B456_009G269000                    157   3e-43   Gossypium raimondii
ref|XP_006598732.1|  PREDICTED: uncharacterized protein LOC100782...    157   4e-43   Glycine max [soybeans]
gb|AGP04974.1|  prolyl-4-hydroxylase 5                                  157   5e-43   Physcomitrella patens
ref|XP_004982729.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    157   5e-43   Setaria italica
ref|XP_001754091.1|  predicted protein                                  154   7e-43   
ref|XP_001782374.1|  predicted protein                                  153   2e-42   
ref|NP_001242181.1|  uncharacterized protein LOC100782154               154   4e-42   Glycine max [soybeans]
ref|XP_009388317.1|  PREDICTED: probable prolyl 4-hydroxylase 3         150   6e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003629237.1|  Prolyl 4-hydroxylase alpha-2 subunit               154   6e-42   Medicago truncatula
ref|XP_002970251.1|  hypothetical protein SELMODRAFT_411114             153   6e-42   
ref|XP_002978409.1|  hypothetical protein SELMODRAFT_418273             153   7e-42   
gb|AFK45565.1|  unknown                                                 150   1e-41   Lotus japonicus
ref|XP_003520111.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    153   2e-41   Glycine max [soybeans]
ref|XP_003603823.1|  Prolyl 4-hydroxylase alpha-2 subunit               144   5e-38   
gb|AES74074.2|  prolyl 4-hydroxylase alpha-like protein                 144   6e-38   Medicago truncatula
ref|NP_001241692.1|  prolyl 4-hydroxylase 8-2                           140   8e-38   
gb|EMT22590.1|  Prolyl 4-hydroxylase subunit alpha-1                    141   2e-37   
ref|XP_002964648.1|  hypothetical protein SELMODRAFT_82355              140   3e-37   
ref|XP_002989495.1|  hypothetical protein SELMODRAFT_129912             139   4e-37   
emb|CDY41627.1|  BnaC03g62570D                                          140   1e-36   Brassica napus [oilseed rape]
ref|XP_008460837.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    138   2e-36   Cucumis melo [Oriental melon]
ref|XP_005649922.1|  hypothetical protein COCSUDRAFT_35772              137   4e-36   Coccomyxa subellipsoidea C-169
ref|XP_010539831.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    136   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_010437417.1|  PREDICTED: probable prolyl 4-hydroxylase 11        137   2e-35   
gb|AES74073.2|  prolyl 4-hydroxylase alpha-like protein                 135   2e-33   Medicago truncatula
ref|XP_010451038.1|  PREDICTED: probable prolyl 4-hydroxylase 11        130   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003603822.1|  Prolyl 4-hydroxylase alpha-2 subunit               134   9e-33   
ref|XP_006412057.1|  hypothetical protein EUTSA_v10027274mg             128   3e-32   
emb|CDP15792.1|  unnamed protein product                                127   4e-32   Coffea canephora [robusta coffee]
ref|XP_002869058.1|  predicted protein                                  127   6e-32   
ref|XP_007017903.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    127   6e-32   
ref|XP_005847166.1|  hypothetical protein CHLNCDRAFT_35843              127   7e-32   Chlorella variabilis
ref|XP_009149920.1|  PREDICTED: probable prolyl 4-hydroxylase 11 ...    125   3e-31   Brassica rapa
emb|CDX75531.1|  BnaA01g01710D                                          124   4e-31   
ref|XP_009149766.1|  PREDICTED: probable prolyl 4-hydroxylase 11 ...    124   6e-31   
ref|XP_009149700.1|  PREDICTED: probable prolyl 4-hydroxylase 11 ...    125   8e-31   Brassica rapa
ref|XP_009149860.1|  PREDICTED: probable prolyl 4-hydroxylase 11 ...    124   8e-31   Brassica rapa
ref|XP_006357128.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    124   3e-30   Solanum tuberosum [potatoes]
ref|XP_004233344.1|  PREDICTED: probable prolyl 4-hydroxylase 6         123   4e-30   
gb|EYU17561.1|  hypothetical protein MIMGU_mgv1a0210091mg               120   9e-30   
ref|XP_004233694.1|  PREDICTED: probable prolyl 4-hydroxylase 6         122   1e-29   
ref|NP_195307.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    121   1e-29   
ref|XP_006285846.1|  hypothetical protein CARUB_v10007325mg             117   3e-29   
ref|XP_009766050.1|  PREDICTED: probable prolyl 4-hydroxylase 6         120   6e-29   
gb|AFK48224.1|  unknown                                                 117   6e-29   
ref|XP_004151664.1|  PREDICTED: uncharacterized protein LOC101218099    115   7e-29   
emb|CDX75529.1|  BnaA01g01730D                                          119   1e-28   
gb|KDD75173.1|  hypothetical protein H632_c828p0                        119   1e-28   
ref|XP_011008369.1|  PREDICTED: probable prolyl 4-hydroxylase 6         119   2e-28   
gb|EAY92230.1|  hypothetical protein OsI_13950                          115   2e-28   
ref|XP_008458700.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    119   2e-28   
ref|XP_009617950.1|  PREDICTED: probable prolyl 4-hydroxylase 6         119   2e-28   
gb|KDP45441.1|  hypothetical protein JCGZ_09690                         119   2e-28   
gb|KHG25059.1|  Prolyl 4-hydroxylase subunit alpha-1                    119   3e-28   
ref|XP_007032350.1|  Oxoglutarate/iron-dependent oxygenase              118   3e-28   
gb|KJB75782.1|  hypothetical protein B456_012G057800                    118   3e-28   
ref|XP_002954156.1|  hypothetical protein VOLCADRAFT_82641              118   4e-28   
ref|XP_008230700.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    118   4e-28   
ref|XP_006482512.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    118   4e-28   
ref|XP_007215695.1|  hypothetical protein PRUPE_ppa008787mg             118   6e-28   
ref|XP_003629235.1|  Prolyl 4-hydroxylase alpha-2 subunit               115   7e-28   
pdb|3GZE|A  Chain A, Algal Prolyl 4-hydroxylase Complexed With Zi...    115   7e-28   
pdb|2JIG|A  Chain A, Crystal Structure Of Chlamydomonas Reinhardt...    115   7e-28   
ref|XP_008812322.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    115   8e-28   
ref|XP_008812321.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    115   8e-28   
pdb|2JIJ|A  Chain A, Crystal Structure Of The Apo Form Of Chlamyd...    115   8e-28   
gb|ACU19077.1|  unknown                                                 117   9e-28   
ref|XP_003543632.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    117   1e-27   
ref|XP_004981380.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    117   1e-27   
ref|XP_001775487.1|  predicted protein                                  116   1e-27   
gb|KDO71355.1|  hypothetical protein CISIN_1g023009mg                   114   1e-27   
ref|XP_004302371.1|  PREDICTED: probable prolyl 4-hydroxylase 7         117   1e-27   
ref|XP_009403988.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    114   1e-27   
ref|XP_006419737.1|  hypothetical protein CICLE_v10005535mg             116   1e-27   
gb|KDO74949.1|  hypothetical protein CISIN_1g022406mg                   116   2e-27   
ref|XP_008365392.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl 4-hyd...    116   2e-27   
ref|XP_004148682.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    116   2e-27   
ref|XP_010242572.1|  PREDICTED: probable prolyl 4-hydroxylase 4         116   2e-27   
gb|EPS61415.1|  type 2 proly 4-hydroxylase                              116   2e-27   
emb|CDP20599.1|  unnamed protein product                                116   2e-27   
ref|XP_004168311.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    116   2e-27   
ref|XP_010033232.1|  PREDICTED: probable prolyl 4-hydroxylase 7         116   2e-27   
ref|XP_006431045.1|  hypothetical protein CICLE_v10012224mg             116   2e-27   
ref|XP_005644366.1|  hypothetical protein COCSUDRAFT_25518              116   2e-27   
ref|XP_001697425.1|  predicted protein                                  115   2e-27   
ref|XP_002516833.1|  prolyl 4-hydroxylase alpha subunit, putative       115   2e-27   
gb|KDO72422.1|  hypothetical protein CISIN_1g021056mg                   116   2e-27   
gb|KJB40817.1|  hypothetical protein B456_007G078100                    116   3e-27   
ref|XP_010091922.1|  Prolyl 4-hydroxylase subunit alpha-1               116   3e-27   
ref|XP_002324024.1|  hypothetical protein POPTR_0017s11150g             115   3e-27   
ref|NP_001051610.1|  Os03g0803500                                       115   3e-27   
gb|AGP04972.1|  prolyl-4-hydroxylase 2                                  116   3e-27   
ref|XP_010255777.1|  PREDICTED: probable prolyl 4-hydroxylase 6         115   4e-27   
ref|XP_003564301.1|  PREDICTED: probable prolyl 4-hydroxylase 6         115   4e-27   
ref|XP_008812319.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    115   4e-27   
gb|KDP40054.1|  hypothetical protein JCGZ_02052                         115   4e-27   
ref|XP_008341521.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    115   5e-27   
ref|XP_007151176.1|  hypothetical protein PHAVU_004G024300g             115   6e-27   
ref|XP_002517437.1|  prolyl 4-hydroxylase alpha subunit, putative       114   7e-27   
ref|XP_002281420.1|  PREDICTED: probable prolyl 4-hydroxylase 6         114   8e-27   
ref|XP_009335795.1|  PREDICTED: probable prolyl 4-hydroxylase 7         115   8e-27   
ref|XP_010932926.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    114   8e-27   
gb|EYU34687.1|  hypothetical protein MIMGU_mgv1a023388mg                114   9e-27   
gb|AAT84604.1|  prolyl 4-hydroxylase                                    114   9e-27   
ref|XP_011098556.1|  PREDICTED: probable prolyl 4-hydroxylase 7         114   1e-26   
ref|XP_008379308.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    114   1e-26   
ref|XP_009403981.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    114   1e-26   
ref|XP_010554021.1|  PREDICTED: probable prolyl 4-hydroxylase 7         114   1e-26   
ref|XP_003618430.1|  Prolyl 4-hydroxylase subunit alpha-2               114   1e-26   
ref|XP_004139390.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    114   1e-26   
ref|XP_004159836.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    114   1e-26   
ref|XP_003554232.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    114   1e-26   
gb|KGN57053.1|  hypothetical protein Csa_3G150820                       114   1e-26   
ref|XP_004134175.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    114   1e-26   
emb|CDO98947.1|  unnamed protein product                                114   1e-26   
ref|XP_006291518.1|  hypothetical protein CARUB_v10017667mg             114   1e-26   
gb|EMS63951.1|  Prolyl 4-hydroxylase subunit alpha-1                    113   2e-26   
emb|CDZ79740.1|  putative proline hydroxylase                           112   2e-26   
ref|XP_002467256.1|  hypothetical protein SORBIDRAFT_01g022150          113   2e-26   
gb|ACN35795.1|  unknown                                                 110   2e-26   
ref|XP_008438765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    113   2e-26   
pdb|2V4A|A  Chain A, Crystal Structure Of The Semet-Labeled Proly...    112   2e-26   
ref|XP_011006089.1|  PREDICTED: probable prolyl 4-hydroxylase 4         113   2e-26   
ref|XP_010272176.1|  PREDICTED: probable prolyl 4-hydroxylase 7         113   2e-26   
ref|NP_001241862.1|  prolyl 4-hydroxylase 2-1 precursor                 111   3e-26   
ref|XP_006356692.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    112   3e-26   
ref|XP_002947321.1|  hypothetical protein VOLCADRAFT_120451             116   3e-26   
ref|XP_002312720.1|  oxidoreductase family protein                      112   3e-26   
gb|ACR34708.1|  unknown                                                 110   3e-26   
ref|XP_002975178.1|  hypothetical protein SELMODRAFT_174666             112   4e-26   
ref|XP_003631980.1|  PREDICTED: probable prolyl 4-hydroxylase 4         112   4e-26   
gb|KJB30037.1|  hypothetical protein B456_005G128400                    112   5e-26   
ref|XP_002977584.1|  hypothetical protein SELMODRAFT_106693             112   5e-26   
ref|XP_009760981.1|  PREDICTED: probable prolyl 4-hydroxylase 4         112   5e-26   
ref|XP_010029258.1|  PREDICTED: probable prolyl 4-hydroxylase 7         112   6e-26   
ref|XP_004229482.1|  PREDICTED: probable prolyl 4-hydroxylase 4         112   6e-26   
ref|XP_009602696.1|  PREDICTED: probable prolyl 4-hydroxylase 4         112   6e-26   
gb|AAN60234.1|  unknown                                                 109   6e-26   
ref|XP_004489361.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    112   6e-26   
gb|ABI79328.1|  prolyl 4-hydroxylase                                    112   7e-26   
gb|EEC76363.1|  hypothetical protein OsI_13952                          116   7e-26   
ref|XP_006842809.1|  hypothetical protein AMTR_s00081p00029310          112   7e-26   
ref|XP_007035415.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    111   7e-26   
gb|KDO50528.1|  hypothetical protein CISIN_1g027393mg                   110   9e-26   
ref|XP_009604218.1|  PREDICTED: probable prolyl 4-hydroxylase 4         111   9e-26   
ref|XP_002877112.1|  predicted protein                                  111   1e-25   
ref|XP_009390813.1|  PREDICTED: prolyl 4-hydroxylase 1-like isofo...    110   1e-25   
ref|XP_004241065.1|  PREDICTED: probable prolyl 4-hydroxylase 4         111   1e-25   
ref|XP_002877111.1|  oxidoreductase                                     111   1e-25   
ref|NP_189490.2|  Oxoglutarate/iron-dependent oxygenase                 111   1e-25   
ref|XP_002463711.1|  hypothetical protein SORBIDRAFT_01g004670          111   1e-25   
ref|NP_001169835.1|  prolyl 4-hydroxylase 2 precursor                   111   1e-25   
ref|XP_003571778.1|  PREDICTED: probable prolyl 4-hydroxylase 7         111   1e-25   
tpg|DAA42462.1|  TPA: hypothetical protein ZEAMMB73_637248              109   1e-25   
gb|AAO42145.1|  putative prolyl 4-hydroxylase                           110   1e-25   
ref|XP_009111597.1|  PREDICTED: probable prolyl 4-hydroxylase 7         111   1e-25   
emb|CDY00131.1|  BnaC09g01700D                                          111   2e-25   
ref|XP_011090892.1|  PREDICTED: probable prolyl 4-hydroxylase 4         110   2e-25   
ref|XP_010279264.1|  PREDICTED: probable prolyl 4-hydroxylase 4         111   2e-25   
gb|EYU34124.1|  hypothetical protein MIMGU_mgv1a008232mg                111   2e-25   
ref|NP_001241865.1|  prolyl 4-hydroxylase 5-1                           108   2e-25   
ref|XP_004167094.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    111   2e-25   
ref|XP_005852090.1|  hypothetical protein CHLNCDRAFT_49444              111   2e-25   
ref|XP_010546909.1|  PREDICTED: probable prolyl 4-hydroxylase 4         110   2e-25   
gb|KHG08217.1|  Prolyl 4-hydroxylase subunit alpha-1                    110   2e-25   
gb|KJB72513.1|  hypothetical protein B456_011G182800                    110   2e-25   
ref|XP_006365272.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    110   2e-25   
ref|NP_001241864.1|  prolyl 4-hydroxylase 4-2 precursor                 108   3e-25   
ref|XP_010425628.1|  PREDICTED: probable prolyl 4-hydroxylase 7         110   3e-25   
ref|XP_011008367.1|  PREDICTED: probable prolyl 4-hydroxylase 7         110   3e-25   
ref|XP_004983172.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    110   3e-25   
ref|XP_010695701.1|  PREDICTED: prolyl 4-hydroxylase 1                  110   3e-25   
ref|XP_010693781.1|  PREDICTED: probable prolyl 4-hydroxylase 4         110   3e-25   
gb|EEC66934.1|  hypothetical protein OsI_33548                          110   3e-25   
ref|NP_001064592.1|  Os10g0413500                                       110   3e-25   
gb|ABB47602.2|  prolyl 4-hydroxylase, putative, expressed               110   4e-25   
ref|XP_006443144.1|  hypothetical protein CICLE_v10021508mg             109   4e-25   
emb|CDX86429.1|  BnaA06g31460D                                          110   4e-25   
gb|EMT25186.1|  Prolyl 4-hydroxylase subunit alpha-1                    109   4e-25   
ref|XP_006845819.1|  hypothetical protein AMTR_s00019p00257460          109   4e-25   
ref|XP_008811421.1|  PREDICTED: prolyl 4-hydroxylase 1 isoform X3       108   4e-25   
gb|KJB38490.1|  hypothetical protein B456_006G256500                    109   5e-25   
ref|XP_009134885.1|  PREDICTED: prolyl 4-hydroxylase 2-like isofo...    107   5e-25   
gb|KDO50530.1|  hypothetical protein CISIN_1g027393mg                   107   5e-25   
gb|KDO50529.1|  hypothetical protein CISIN_1g027393mg                   107   5e-25   
ref|XP_010105675.1|  Prolyl 4-hydroxylase subunit alpha-1               109   5e-25   
gb|AAL57673.1|  AT3g28480/MFJ20_16                                      109   5e-25   
ref|XP_010024472.1|  PREDICTED: probable prolyl 4-hydroxylase 4         109   5e-25   
ref|XP_009151868.1|  PREDICTED: probable prolyl 4-hydroxylase 7         110   5e-25   
gb|KDO50531.1|  hypothetical protein CISIN_1g027393mg                   107   5e-25   
ref|NP_001241863.1|  prolyl 4-hydroxylase 4 precursor                   108   6e-25   
ref|XP_010502850.1|  PREDICTED: probable prolyl 4-hydroxylase 7         109   6e-25   
ref|XP_009772473.1|  PREDICTED: probable prolyl 4-hydroxylase 4         109   6e-25   
ref|XP_010514553.1|  PREDICTED: probable prolyl 4-hydroxylase 7         109   6e-25   
ref|XP_002461632.1|  hypothetical protein SORBIDRAFT_02g005750          109   7e-25   
ref|NP_566838.1|  oxoglutarate/iron-dependent oxygenase                 109   7e-25   
gb|EMS46596.1|  Prolyl 4-hydroxylase subunit alpha-2                    108   7e-25   
ref|XP_001753237.1|  predicted protein                                  108   7e-25   
ref|XP_008811419.1|  PREDICTED: prolyl 4-hydroxylase 1 isoform X1       108   8e-25   
gb|AAF08583.1|AC011623_16  unknown protein                              108   8e-25   
dbj|BAB02864.1|  prolyl 4-hydroxylase alpha subunit-like protein        109   9e-25   
ref|XP_010430961.1|  PREDICTED: probable prolyl 4-hydroxylase 7         107   9e-25   
gb|AAM67123.1|  prolyl 4-hydroxylase alpha subunit-like protein         108   9e-25   
ref|XP_006411583.1|  hypothetical protein EUTSA_v10017046mg             108   9e-25   
ref|NP_566279.1|  prolyl-4 hydroxylase 2                                108   9e-25   
ref|XP_002882460.1|  hypothetical protein ARALYDRAFT_896741             108   9e-25   
ref|XP_006407963.1|  hypothetical protein EUTSA_v10021226mg             108   1e-24   
gb|KFK38069.1|  hypothetical protein AALP_AA3G065700                    108   1e-24   
emb|CDY53661.1|  BnaC04g52950D                                          108   1e-24   
ref|XP_006443143.1|  hypothetical protein CICLE_v10021508mg             107   1e-24   
ref|XP_010486127.1|  PREDICTED: prolyl 4-hydroxylase 2-like             108   1e-24   
ref|XP_002880022.1|  AT-P4H-1                                           108   1e-24   
ref|XP_006290404.1|  hypothetical protein CARUB_v10018771mg             108   1e-24   
dbj|BAF01121.1|  hypothetical protein                                   108   1e-24   
ref|XP_006298105.1|  hypothetical protein CARUB_v10014146mg             108   1e-24   
ref|XP_009412184.1|  PREDICTED: probable prolyl 4-hydroxylase 4 i...    108   1e-24   
tpg|DAA38325.1|  TPA: hypothetical protein ZEAMMB73_894856              105   1e-24   
ref|XP_010525698.1|  PREDICTED: prolyl 4-hydroxylase 1 isoform X2       107   1e-24   
gb|KHG03768.1|  Prolyl 4-hydroxylase subunit alpha-1                    108   2e-24   
ref|XP_010670507.1|  PREDICTED: uncharacterized protein LOC104887554    109   2e-24   
ref|XP_001698589.1|  predicted protein                                  107   2e-24   
ref|XP_010412436.1|  PREDICTED: probable prolyl 4-hydroxylase 6         108   2e-24   
gb|KFK30551.1|  hypothetical protein AALP_AA7G276800                    107   2e-24   
ref|XP_004144967.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    108   2e-24   
ref|XP_006395360.1|  hypothetical protein EUTSA_v10004627mg             108   2e-24   
ref|NP_001059113.1|  Os07g0194500                                       108   2e-24   
ref|XP_009412183.1|  PREDICTED: probable prolyl 4-hydroxylase 4 i...    108   2e-24   
ref|XP_008458517.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    108   2e-24   
ref|XP_010912106.1|  PREDICTED: probable prolyl 4-hydroxylase 4         107   2e-24   
gb|KJB33683.1|  hypothetical protein B456_006G026200                    106   2e-24   
ref|XP_008808711.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    107   2e-24   
gb|KFK26128.1|  hypothetical protein AALP_AA8G207300                    107   2e-24   
emb|CDY05250.1|  BnaC05g45530D                                          107   2e-24   
dbj|BAC83179.1|  prolyl 4-hydroxylase alpha-1 subunit precursor-l...    107   2e-24   
ref|XP_006650749.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    107   3e-24   
ref|XP_007147837.1|  hypothetical protein PHAVU_006G159200g             107   3e-24   
ref|XP_006400443.1|  hypothetical protein EUTSA_v10014223mg             107   3e-24   
emb|CDY08058.1|  BnaC03g34650D                                          107   3e-24   
ref|NP_181836.1|  prolyl-4 hydroxylase                                  107   3e-24   
ref|XP_009142908.1|  PREDICTED: prolyl 4-hydroxylase 1                  107   3e-24   
ref|XP_009129657.1|  PREDICTED: prolyl 4-hydroxylase 2                  107   3e-24   
ref|XP_010437904.1|  PREDICTED: prolyl 4-hydroxylase 2                  107   3e-24   
emb|CDX74110.1|  BnaA03g29370D                                          107   3e-24   
ref|XP_010506166.1|  PREDICTED: prolyl 4-hydroxylase 1-like             107   3e-24   
ref|XP_006294750.1|  hypothetical protein CARUB_v10023796mg             107   3e-24   
ref|XP_010508473.1|  PREDICTED: prolyl 4-hydroxylase 1-like             107   3e-24   
ref|XP_010464199.1|  PREDICTED: prolyl 4-hydroxylase 2-like             107   3e-24   
ref|XP_010517861.1|  PREDICTED: prolyl 4-hydroxylase 1                  107   3e-24   
ref|XP_006356269.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    105   4e-24   
gb|AFK36537.1|  unknown                                                 107   4e-24   
gb|EMS67772.1|  Prolyl 4-hydroxylase subunit alpha-1                    106   4e-24   
ref|XP_010492924.1|  PREDICTED: probable prolyl 4-hydroxylase 4         107   4e-24   
gb|AAM13038.1|  unknown protein                                         107   4e-24   
ref|NP_197391.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    107   4e-24   
ref|NP_001241485.1|  uncharacterized protein LOC100783075 precursor     107   4e-24   
ref|XP_006288327.1|  hypothetical protein CARUB_v10001574mg             107   4e-24   
ref|NP_001241870.1|  prolyl 4-hydroxylase 6-3 precursor                 105   4e-24   
ref|NP_001052511.1|  Os04g0346000                                       106   4e-24   
ref|XP_008667544.1|  PREDICTED: uncharacterized protein LOC100273...    106   4e-24   



>ref|XP_003612250.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95208.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=204

 Score =   249 bits (636),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R   R+++S  T  F++F   + ++L+LL FGILSIPSS++   K +DL++I 
Sbjct  1    MAKSRYSRLPSRKSSSPYTLIFSLFIAFTFLILILLVFGILSIPSSNQNLPKPNDLTSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            HNT++R + EE    KG+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP M KSTVVD
Sbjct  61   HNTVDRNDDEEG---KGEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPSMHKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKI+RNIEK+IADFTFIP EHGEGLQ+LHYE
Sbjct  118  SETGKSKDSRVRTSSGTFLARGRDKIVRNIEKKIADFTFIPVEHGEGLQVLHYE  171



>ref|XP_009622125.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=291

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ R  PR++++ +T  F  F +LS VVL+LLAFGI SIPSSSRGSQKAHDLS+IAHN
Sbjct  4    KGRHSRVGPRKSSN-STLIFGGFIMLSFVVLILLAFGIFSIPSSSRGSQKAHDLSSIAHN  62

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T++R + ++DD +  D WVEVIS EPRA++YHNFLSK ECEYLI+LAKPHMQKSTVVDS 
Sbjct  63   TVQRGDDDDDDGKG-DQWVEVISLEPRAYIYHNFLSKEECEYLISLAKPHMQKSTVVDSA  121

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKSKDSRVRTSSGTFL RGRDK+IRNIEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  122  TGKSKDSRVRTSSGTFLARGRDKVIRNIEKRIADFTFIPVEHGEGLQVLHYE  173



>ref|XP_009776785.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ R  PR++++ +T  F  F ++S VVL+LLAFGI SIPSS+RGSQKAHDLS+IAHN
Sbjct  4    KGRHSRVGPRKSSN-STLIFGGFIMISFVVLILLAFGIFSIPSSTRGSQKAHDLSSIAHN  62

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T++R + +++       WVEVIS EPRA++YHNFLSK ECEYLI+LAKPHMQKSTVVDS 
Sbjct  63   TVQRGDDDDEGKGD--QWVEVISLEPRAYIYHNFLSKEECEYLISLAKPHMQKSTVVDSA  120

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKSKDSRVRTSSGTFL RGRDK+IRNIEK+IADFTFIP EHGEGLQ+LHYE
Sbjct  121  TGKSKDSRVRTSSGTFLARGRDKVIRNIEKKIADFTFIPVEHGEGLQVLHYE  172



>ref|XP_003612249.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95207.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=289

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R   R+++S  T  F++F   + ++L+LL FGILSIPSS++   K +DL++I 
Sbjct  1    MAKSRYSRLPSRKSSSPYTLIFSLFIAFTFLILILLVFGILSIPSSNQNLPKPNDLTSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            HNT++R + EE    KG+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP M KSTVVD
Sbjct  61   HNTVDRNDDEEG---KGEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPSMHKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKI+RNIEK+IADFTFIP EHGEGLQ+LHYE
Sbjct  118  SETGKSKDSRVRTSSGTFLARGRDKIVRNIEKKIADFTFIPVEHGEGLQVLHYE  171



>gb|KDO71357.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=202

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFFPLENGEGLQVLHYE  170



>emb|CDP01844.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   244 bits (623),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ RG  R+ TS +T  FA+F + S  +L++LA G+LS+PS+SR SQKAHDLSTIAHN
Sbjct  4    KGRHLRGPSRKATSSSTLIFAMFIMFSFFLLIMLALGLLSVPSTSRDSQKAHDLSTIAHN  63

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            +++R   +EDD  +GD WVEVISWEPRA VYHNFLS  ECEYLINLAKPHMQKSTVVDS 
Sbjct  64   SIDR--GDEDDEGRGDQWVEVISWEPRAVVYHNFLSIEECEYLINLAKPHMQKSTVVDSA  121

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKSKDSRVRTSSGTFL RGRDK IR IEKRIADF FIP EHGEGLQILHYE
Sbjct  122  TGKSKDSRVRTSSGTFLARGRDKTIREIEKRIADFAFIPVEHGEGLQILHYE  173



>ref|XP_004512179.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512180.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cicer arietinum]
Length=292

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 147/178 (83%), Gaps = 8/178 (4%)
 Frame = +3

Query  108  MAKGKYGRGLPRR--TTSLATTAFAVFAILSLVVLMLLAFGILSIPSSS--RGSQKAHDL  275
            MAK +Y R LP R  ++S  T  FA+F   + ++L+LL FGILSIP++S  +   K +DL
Sbjct  1    MAKPRYSR-LPYRKPSSSSYTIIFALFIAFTFLILILLVFGILSIPTTSSRQNLPKPNDL  59

Query  276  STIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
            ++IAHNT++R ++EE    KG+ WVE++SWEPRAFVYHNFL+K ECEYLI++AKPHM KS
Sbjct  60   TSIAHNTVDRIDEEEG---KGERWVEIVSWEPRAFVYHNFLTKEECEYLIDIAKPHMHKS  116

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TVVDSETGKSKDSRVRTSSGTFL RGRDKI+RNIEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  TVVDSETGKSKDSRVRTSSGTFLDRGRDKIVRNIEKRIADFTFIPVEHGEGLQVLHYE  174



>gb|KJB43229.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=225

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R +P R +S +T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN +++ + +E     G+ WVEVISWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVV
Sbjct  60   VHNVVDKNDYDEG---VGEQWVEVISWEPRAFIYHNFLSKEECEYLIDLAKPHMEKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKIIRNIE+RIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPVEHGEGLQVLHYE  171



>gb|KHN35999.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 145/175 (83%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +Y R  PR+++S +T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            A NT+E  + +E    +G+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP M KSTVV
Sbjct  61   ARNTIETSDSDE----RGEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPSMHKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKI+RNIEK+I+DFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLARGRDKIVRNIEKKISDFTFIPVEHGEGLQVLHYE  171



>ref|NP_001242522.1| uncharacterized protein LOC100806046 [Glycine max]
 gb|ACU24023.1| unknown [Glycine max]
Length=289

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 145/175 (83%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +Y R  PR+++S +T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            A NT+E  + +E    +G+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP M KSTVV
Sbjct  61   ARNTIETSDSDE----RGEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPSMHKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKI+RNIEK+I+DFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLARGRDKIVRNIEKKISDFTFIPVEHGEGLQVLHYE  171



>ref|XP_006425362.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38602.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=265

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFLPLENGEGLQVLHYE  170



>gb|ACU17088.1| unknown [Glycine max]
Length=207

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +Y R  PR+++S +T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            A NT+     ++DDVR G+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP+M KS+VV
Sbjct  61   ARNTIH--TSDDDDVR-GEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPNMHKSSVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKI+R+IEKRIA ++FIP EHGEGLQ+LHYE
Sbjct  118  DSETGKSKDSRVRTSSGTFLARGRDKIVRDIEKRIAHYSFIPVEHGEGLQVLHYE  172



>ref|XP_009801759.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 146/173 (84%), Gaps = 5/173 (3%)
 Frame = +3

Query  114  KGKYGRG-LPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAH  290
            KG++ RG LPR++++ +T  FAVF  LSL+VL+LLAFGI SIP SS+GSQKAHDLS+IAH
Sbjct  4    KGRHVRGGLPRKSSN-STLVFAVFIGLSLLVLILLAFGIFSIPFSSKGSQKAHDLSSIAH  62

Query  291  NTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDS  470
            N + R +   DD  KGD W EVISWEPRA VYHNFLSK ECEYLINL KPHM+KSTVVDS
Sbjct  63   NAVGRRD---DDGGKGDQWAEVISWEPRAVVYHNFLSKDECEYLINLGKPHMKKSTVVDS  119

Query  471  ETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             TGKS DSRVRTSSGTFL RG+DK++R IEKRIADFTFIP EHGEGLQILHYE
Sbjct  120  ATGKSTDSRVRTSSGTFLSRGQDKVVRTIEKRIADFTFIPVEHGEGLQILHYE  172



>ref|XP_009587704.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=290

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 142/172 (83%), Gaps = 3/172 (2%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ RG   R +  +T  FAVF  LSL+VL+LLAFGI SIP SS+GSQKAHDLS+IAHN
Sbjct  4    KGRHVRGGLTRKSPNSTLVFAVFIGLSLLVLILLAFGIFSIPFSSKGSQKAHDLSSIAHN  63

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T+ R +   DD  KGD W EVISWEPRA VYHNFLSK ECEYLINL KPHM+KSTVVDS 
Sbjct  64   TVGRRD---DDGGKGDQWAEVISWEPRAVVYHNFLSKDECEYLINLGKPHMKKSTVVDSA  120

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RG+DK++R IEKRIADFTFIP EHGEGLQILHYE
Sbjct  121  TGKSTDSRVRTSSGTFLSRGQDKVVRTIEKRIADFTFIPVEHGEGLQILHYE  172



>gb|KJB43228.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=266

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R +P R +S +T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN +++ + +E     G+ WVEVISWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVV
Sbjct  60   VHNVVDKNDYDEG---VGEQWVEVISWEPRAFIYHNFLSKEECEYLIDLAKPHMEKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKIIRNIE+RIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPVEHGEGLQVLHYE  171



>gb|KDO71356.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=265

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFFPLENGEGLQVLHYE  170



>ref|XP_006467023.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Citrus sinensis]
Length=288

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFLPLENGEGLQVLHYE  170



>ref|XP_006425363.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 ref|XP_006425364.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38603.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38604.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=288

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFLPLENGEGLQVLHYE  170



>gb|KDO71351.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71352.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71353.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=288

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF P E+GEGLQ+LHYE
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFFPLENGEGLQVLHYE  170



>gb|KJB43227.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43230.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43231.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=289

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R +P R +S +T    +  + + +VL+LLA GILSIP+S SR S K +DLS+I
Sbjct  1    MAKPRLSR-VPARRSSSSTMFLTLLIMFTFLVLILLALGILSIPTSNSRSSHKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN +++ + +E     G+ WVEVISWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVV
Sbjct  60   VHNVVDKNDYDEG---VGEQWVEVISWEPRAFIYHNFLSKEECEYLIDLAKPHMEKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKIIRNIE+RIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPVEHGEGLQVLHYE  171



>ref|XP_003538892.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Glycine max]
 gb|KHN41867.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=290

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +Y R  PR+++S +T    +F + + +VL+LLA GILSIPSSSRG+  K +DL++I
Sbjct  1    MAKPRYSRLPPRKSSSSSTLILTLFLVFTFLVLILLALGILSIPSSSRGNLPKPNDLASI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            A NT+     ++DDVR G+ WVEV+SWEPRAFVYHNFL+K ECEYLI++AKP+M KS+VV
Sbjct  61   ARNTIH--TSDDDDVR-GEQWVEVVSWEPRAFVYHNFLTKEECEYLIDIAKPNMHKSSVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKI+R+IEKRIA ++FIP EHGEGLQ+LHYE
Sbjct  118  DSETGKSKDSRVRTSSGTFLARGRDKIVRDIEKRIAHYSFIPVEHGEGLQVLHYE  172



>ref|XP_010113287.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
 gb|EXC35294.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
Length=291

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRG--SQKAHDLST  281
            MAK ++ R   R+++S +T  F +  + S VVL+L+A GILS+PSSS G  + K +DLS+
Sbjct  1    MAKIRHSRLQGRKSSSFSTLTFTMLVMFSFVVLILVALGILSVPSSSGGDSTHKPNDLSS  60

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            I     +R E +E    KG+ WVEVISWEPRAF+YHNFL+K ECEYLINLA P+M+KSTV
Sbjct  61   IVRKNADRSEGDEG---KGERWVEVISWEPRAFIYHNFLTKEECEYLINLAMPNMKKSTV  117

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDSETGKSKDSRVRTSSGTFL RGRDK+IR IEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  VDSETGKSKDSRVRTSSGTFLARGRDKVIRTIEKRIADFTFIPVEHGEGLQILHYE  173



>ref|XP_006467024.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Citrus sinensis]
Length=287

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++E     E D  + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSME----SEGDEGRAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE
Sbjct  116  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFLPLENGEGLQVLHYE  169



>gb|KDO71350.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=287

 Score =   236 bits (603),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++E     E D  + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSME----SEGDEGRAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF P E+GEGLQ+LHYE
Sbjct  116  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFFPLENGEGLQVLHYE  169



>ref|XP_006340784.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=287

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 6/172 (3%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ R  PR++++ +T  F    +LS   L+LLAF I+SIP   RGSQKAHDL++I HN
Sbjct  4    KGRHSRMGPRKSSN-STLIFGGIIVLSFFALILLAFRIISIP---RGSQKAHDLTSIVHN  59

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T++R  Q++DD  K D WVEVIS EPRA+VYHNFLSK ECEYLI+LAKPHMQKS+VVDS 
Sbjct  60   TVQR--QDDDDDGKRDQWVEVISSEPRAYVYHNFLSKEECEYLISLAKPHMQKSSVVDSS  117

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RGRDK+IR+IEKRIADFTFIPAEHGEGLQILHYE
Sbjct  118  TGKSMDSRVRTSSGTFLARGRDKVIRDIEKRIADFTFIPAEHGEGLQILHYE  169



>ref|XP_006343343.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=289

 Score =   234 bits (597),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ RGL R++++ +T  FAVF   S  VL+LLAFGI SIP +SRGS+K HDLS+IAHN
Sbjct  4    KGRHFRGLSRKSSN-STLLFAVFIGFSFFVLILLAFGIFSIPFTSRGSRKVHDLSSIAHN  62

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
               R + +     +   W E+ISWEPRA VYHNFLSK ECEYLINL KPHM+KSTVVDS 
Sbjct  63   AAGRRDDDGGRGDE---WAELISWEPRAVVYHNFLSKEECEYLINLGKPHMKKSTVVDSA  119

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RG+DK++R IEKRIADFTFIP EHGEGLQILHYE
Sbjct  120  TGKSTDSRVRTSSGTFLARGQDKVVRTIEKRIADFTFIPVEHGEGLQILHYE  171



>ref|XP_004234520.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=289

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ RGL R++++ +T  FAVF   S  VL+LLAFGI SIP +SRG +K HDLS+IAHN
Sbjct  4    KGRHFRGLSRKSSN-STLIFAVFIGFSFFVLILLAFGIFSIPFTSRGLRKVHDLSSIAHN  62

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
               R + +     +   W EVISWEPRA VYHNFLSK ECEYLINL KPHM+KSTVVDS 
Sbjct  63   AAGRRDDDGGRGDQ---WAEVISWEPRAVVYHNFLSKEECEYLINLGKPHMKKSTVVDSA  119

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RG+DK++R IEKRIADFTFIP EHGEGLQILHYE
Sbjct  120  TGKSTDSRVRTSSGTFLSRGQDKVVRTIEKRIADFTFIPVEHGEGLQILHYE  171



>ref|XP_010465981.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465989.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465996.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X2 [Camelina 
sativa]
Length=290

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  F V  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  13   RKSSNSTLVFGVLIMFTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGED  70

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D +  + WVE+ISWEPRA +YHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  71   DSKNDERWVEIISWEPRASIYHNFLTKEECKYLIELAKPHMEKSTVVDQKTGKSTDSRVR  130

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  131  TSSGTFLARGRDKIIRQIEKRISDFTFIPVEHGEGLQVLHYE  172



>ref|XP_010444842.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
 ref|XP_010444843.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=290

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  F V  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  13   RKSSNSTLVFGVLIMFTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGED  70

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D +  D WVE+ISWEPRA +YHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  71   DSKNDDRWVEIISWEPRASIYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVR  130

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSG FL RGRDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  131  TSSGAFLARGRDKIIRQIEKRISDFTFIPVEHGEGLQVLHYE  172



>ref|XP_004232524.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=287

 Score =   229 bits (583),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 141/172 (82%), Gaps = 6/172 (3%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            KG++ R  PR++++ +T  F    +LS   L+LLAF I+S     RGSQKAHDL++IAHN
Sbjct  4    KGRHSRLGPRKSSN-STLIFGGIIVLSFFALILLAFRIISF---HRGSQKAHDLTSIAHN  59

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T++R  Q++DD  K D WVEVIS EPRA+VYHNFLSK ECEYLI+LAKPHMQKS+VVDS 
Sbjct  60   TVQR--QDDDDDGKTDQWVEVISSEPRAYVYHNFLSKEECEYLISLAKPHMQKSSVVDSS  117

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RGRDK+IR+IEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  TGKSMDSRVRTSSGTFLARGRDKVIRDIEKRIADFTFIPVEHGEGLQILHYE  169



>ref|XP_009112275.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 ref|XP_009112276.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 emb|CDY18586.1| BnaA09g08090D [Brassica napus]
Length=287

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 3/163 (2%)
 Frame = +3

Query  141  RRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEE  320
            RR TS +T  FAV  + + V+L LLA GILS+PS++ GS KA+DL++I    L+R  +  
Sbjct  10   RRKTSYSTLVFAVLIMFTFVILFLLALGILSLPSNNGGSSKANDLTSIVRKNLQRNGK--  67

Query  321  DDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRV  500
             DV + + WVE+ISWEPRA +YHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRV
Sbjct  68   -DVSENERWVEIISWEPRASIYHNFLTKEECKYLIELAKPHMEKSTVVDQKTGKSTDSRV  126

Query  501  RTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            RTSSGTFL RGRDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  127  RTSSGTFLPRGRDKIIRQIEKRISDFTFIPVEHGEGLQVLHYE  169



>gb|EYU30384.1| hypothetical protein MIMGU_mgv1a011046mg [Erythranthe guttata]
Length=294

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 7/176 (4%)
 Frame = +3

Query  111  AKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS---SRGSQKAHDLST  281
             + +YGR  PR+T+S +T       +LSL++++LLA GILSI SS   S+ S +AHDLS 
Sbjct  5    GRQQYGRVGPRKTSS-STLVLYGLIMLSLLIVILLALGILSISSSTNASKDSPRAHDLSF  63

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            I+HN+   ++ +E+     D W+EVISWEPRAFV+HNFLSK ECEYLI++A+PHM+KSTV
Sbjct  64   ISHNSAHSDDGDEE---SKDQWLEVISWEPRAFVFHNFLSKEECEYLISIAEPHMEKSTV  120

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDSETGKS DSRVRTSSGTFL RGRDKI++ IEKRIADFTFIP EHGEGLQILHYE
Sbjct  121  VDSETGKSTDSRVRTSSGTFLARGRDKIVQRIEKRIADFTFIPVEHGEGLQILHYE  176



>dbj|BAB10411.1| prolyl 4-hydroxylase, alpha subunit-like protein [Arabidopsis 
thaliana]
Length=267

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  FAV  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  13   RKSSHSTLVFAVLIMSTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGED  70

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D  K + WVE+ISWEPRA VYHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  71   D-SKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVR  129

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  130  TSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE  171



>emb|CDX81416.1| BnaC09g08270D [Brassica napus]
Length=287

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = +3

Query  141  RRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEE  320
            RR TS +T  FAV  + + V+L LLA GILS+PS++ GS KA+DL++I    L+R  +  
Sbjct  10   RRKTSYSTLVFAVLIMFTFVILFLLALGILSLPSNNGGSSKANDLTSIVRKNLQRSGK--  67

Query  321  DDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRV  500
             D  + + WVE+ISWEPRA +YHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRV
Sbjct  68   -DASENERWVEIISWEPRASIYHNFLTKEECKYLIELAKPHMEKSTVVDQKTGKSTDSRV  126

Query  501  RTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            RTSSGTFL RGRDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  127  RTSSGTFLPRGRDKIIRQIEKRISDFTFIPVEHGEGLQVLHYE  169



>ref|XP_002866777.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43036.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  FAV  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  12   RKSSRSTLVFAVLIMSTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--GVED  69

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D  K + WVE+ISWEPRA VYHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  70   D-SKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVR  128

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  129  TSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE  170



>ref|XP_004291329.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 139/181 (77%), Gaps = 5/181 (3%)
 Frame = +3

Query  87   YRAYAVTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKA  266
            +RA A TMAKG+YGR L     S  T   ++  +L++V+LML+AFGI+S+P SS  S   
Sbjct  15   FRARASTMAKGRYGR-LRSSKWSTFTLVLSMLFMLTVVLLMLMAFGIVSLPESSDDS-PP  72

Query  267  HDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHM  446
            +DLS+     +ER E      ++ + W +VISWEPRAF+YHNFLSK EC+YLI LA PHM
Sbjct  73   NDLSSFRRRIVERSEGLG---KRENQWTQVISWEPRAFIYHNFLSKEECDYLIQLATPHM  129

Query  447  QKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
             KSTVVDS+TGKSKDSRVRTSSGTFL RGRDK+IR+IEKRIADFTFIP EHGEGLQILHY
Sbjct  130  TKSTVVDSKTGKSKDSRVRTSSGTFLRRGRDKVIRDIEKRIADFTFIPVEHGEGLQILHY  189

Query  627  E  629
            E
Sbjct  190  E  190



>ref|NP_201407.4| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|F4JZ24.1|P4H10_ARATH RecName: Full=Probable prolyl 4-hydroxylase 10; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED98153.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=289

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  FAV  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  13   RKSSHSTLVFAVLIMSTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGED  70

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D  K + WVE+ISWEPRA VYHNFL+K EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  71   D-SKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVR  129

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  130  TSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE  171



>ref|XP_006280909.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
 gb|EOA13807.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
Length=289

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MA+ +  R   RR+ S +T  F V  + + V+L LLAFGILS+PS++ GS KA+DL++I 
Sbjct  2    MARPRSHRPSARRS-SHSTLIFVVLIMSTFVILFLLAFGILSVPSNNAGSSKANDLTSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              TLER    EDD  K + WVE+ISWEPRA +YHNFL+K EC+YLI LAKPHM+KSTVVD
Sbjct  61   RKTLER--SGEDD-SKNERWVEIISWEPRASIYHNFLTKEECKYLIELAKPHMEKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TGKS DSRVRTSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  118  EKTGKSTDSRVRTSSGTFLARGRDKTIRQIEKRISDFTFIPVEHGEGLQVLHYE  171



>ref|XP_008387906.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
 ref|XP_008350487.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
Length=286

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 136/174 (78%), Gaps = 6/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S  T   ++  +LS VVL++LAFGI+S+P S+ GS   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSPFTLVLSMLFVLS-VVLLMLAFGIVSLPVSTDGSS-PNDLSSFR  57

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
               +ER +   +   +G+ W EVISWEPRAF+YHNFLSK EC+YLINLAKPHM KSTVVD
Sbjct  58   RKIVERSDGLGN---RGEQWTEVISWEPRAFIYHNFLSKDECDYLINLAKPHMVKSTVVD  114

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDS VRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  115  SETGKSKDSSVRTSSGMFLRRGRDKIIRDIEKRIADFTFIPVEHGEGLQVLHYE  168



>ref|XP_008387904.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
 ref|XP_008350486.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
Length=291

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 135/176 (77%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S  T   ++  +LS VVL++LAFGI+S+P S+ GS   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSPFTLVLSMLFVLS-VVLLMLAFGIVSLPVSTDGSS-PNDLSSFR  57

Query  288  HNTLEREEQEEDDV--RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
               +ER      D    +G+ W EVISWEPRAF+YHNFLSK EC+YLINLAKPHM KSTV
Sbjct  58   RKIVERYAFRSSDGLGNRGEQWTEVISWEPRAFIYHNFLSKDECDYLINLAKPHMVKSTV  117

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDSETGKSKDS VRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  118  VDSETGKSKDSSVRTSSGMFLRRGRDKIIRDIEKRIADFTFIPVEHGEGLQVLHYE  173



>gb|KHG30312.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=289

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +  R +P R +S +T    +  + + +VL+LLA GILSIPSS+  S  K +DLS+I
Sbjct  1    MAKPRLSR-VPARKSSSSTMFLTLLIMFTFLVLILLALGILSIPSSNSRSSHKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN +++ + +E     G+ WVEVISWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVV
Sbjct  60   VHNVVDKNDYDEG---VGEQWVEVISWEPRAFIYHNFLSKEECEYLIDLAKPHMEKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D+ETGKSKDSRVRTSSGTFL RGRDKIIRNIE+RIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DTETGKSKDSRVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPVEHGEGLQVLHYE  171



>ref|XP_006393794.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
 gb|ESQ31080.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
Length=289

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 129/162 (80%), Gaps = 3/162 (2%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  F V  + + V+L LLA GILS+PS++ GS KA+DL++I   TL+R  +++ 
Sbjct  13   RKSSYSTVVFVVLIMFTFVILFLLALGILSLPSNNAGSSKANDLTSIVRKTLQRSGKDDS  72

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            +    + WVE+ISWEPRA +YHNFL+K ECEYLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  73   E---NERWVEIISWEPRASIYHNFLTKEECEYLIELAKPHMEKSTVVDEKTGKSTDSRVR  129

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  130  TSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE  171



>ref|XP_009149624.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=237

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = +3

Query  141  RRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEE  320
            R+ ++L    F +F +L++V+LMLLAFG+ S+P ++       DLS       ER   EE
Sbjct  14   RKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNNDESSPMDLSYFRRAATER--SEE  70

Query  321  DDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRV  500
               ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVDSETGKSKDSRV
Sbjct  71   GLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRV  130

Query  501  RTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            RTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  131  RTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  173



>gb|KDO71358.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=174

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  P R +S +T    +  + +  +L+LLAFGILS+PSSS  S+KA+DLS+I 
Sbjct  1    MAKPRYSR-FPTRKSSSSTLILTLLIMFTFAILILLAFGILSMPSSSGDSRKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              ++ER E +E    + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVD
Sbjct  60   RKSMERSEGDEG---RAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIP  590
            S+TGKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADFTF P
Sbjct  117  SDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTFFP  157



>ref|XP_010550487.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Tarenaya hassleriana]
Length=285

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 136/174 (78%), Gaps = 7/174 (4%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   RR+ S  T  FAV  + + V+L+L+A GIL +PS++R S KA+DLS+I 
Sbjct  1    MAKPRHYRPSGRRS-SYPTLVFAVLLMFTFVILILMALGILWVPSNNRASSKANDLSSIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            H +++      DD  +   WVE+ISWEPRA VYHNFL+K EC+YLI LAKPHM+KSTVVD
Sbjct  60   HKSIK---SGGDDAER---WVEIISWEPRASVYHNFLTKKECQYLIELAKPHMEKSTVVD  113

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG+S+DSRVRTSSGTFL RGRDKIIR+IEKRIAD TFIP EHGEGLQ+LHYE
Sbjct  114  EKTGQSRDSRVRTSSGTFLPRGRDKIIRDIEKRIADLTFIPVEHGEGLQVLHYE  167



>gb|KDP23952.1| hypothetical protein JCGZ_25340 [Jatropha curcas]
Length=289

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSS-RGSQKAHDLSTI  284
            MAK +Y R LP R +S +T    V  + + V+L+LLA GILSIPS+S   S KAHDLSTI
Sbjct  1    MAKARYSR-LPVRKSSSSTLILTVLLMFTFVILILLALGILSIPSNSGDSSHKAHDLSTI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN L+R E+++ +  +   W EVISW PRAF+YHNFL+K EC+YLINLAKPHMQKSTVV
Sbjct  60   VHNKLDRSERDDGNRER---WAEVISWAPRAFIYHNFLTKEECDYLINLAKPHMQKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDK IR IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSETGKSKDSRVRTSSGTFLARGRDKKIREIEKRIADFTFIPVEHGEGLQVLHYE  171



>emb|CAN64470.1| hypothetical protein VITISV_014644 [Vitis vinifera]
Length=288

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  PR+++S +T   ++  + S VVL+LLA G+LSIPS S  S +A+DLSTI 
Sbjct  1    MAKPRYPRFPPRKSSS-STVVLSMLLMFSFVVLVLLALGLLSIPSHSGDSPRANDLSTIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            H T+ER +  +    KG+ W EVISWEPRAFVYHNFLSK ECEYLI LAKPHMQKSTVVD
Sbjct  60   HRTVERSDGNDG---KGEPWSEVISWEPRAFVYHNFLSKDECEYLIKLAKPHMQKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S TGKSKDSRVRTSSGTFL RG+DKIIR IEKR++DFTF+P EHGEGLQILHYE
Sbjct  117  SSTGKSKDSRVRTSSGTFLTRGQDKIIRGIEKRLSDFTFLPVEHGEGLQILHYE  170



>ref|NP_001190630.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 gb|AED98154.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=243

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 5/162 (3%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEED  323
            R +S +T  FAV  + + V+L+LLAFGILS+PS++ GS KA+DL++I   TL+R    ED
Sbjct  13   RKSSHSTLVFAVLIMSTFVILILLAFGILSVPSNNAGSSKANDLTSIVRKTLQR--SGED  70

Query  324  DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVR  503
            D  K + WVE+ISWEPRA VYHNFL   EC+YLI LAKPHM+KSTVVD +TGKS DSRVR
Sbjct  71   D-SKNERWVEIISWEPRASVYHNFLE--ECKYLIELAKPHMEKSTVVDEKTGKSTDSRVR  127

Query  504  TSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TSSGTFL RGRDK IR IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  128  TSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE  169



>ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF31744.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=287

 Score =   221 bits (563),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R   R+++S  T    +  + + V+L+LLA GILS+PS+S    KAHDL+TI 
Sbjct  1    MAKARYSRLPARKSSSPTTMILTMLLMFTFVILILLALGILSVPSNS--GDKAHDLTTIV  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            HN   +E+  + D  KG+ W EVISWEPRAFVYHNFL+K ECEYLINLAKP+MQKSTVVD
Sbjct  59   HN---KEQSFDGDDGKGERWAEVISWEPRAFVYHNFLTKEECEYLINLAKPNMQKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETG+SKDSRVRTSSGTFL RGRDK IR+IEKRIADF+FIP EHGEGLQ+LHYE
Sbjct  116  SETGRSKDSRVRTSSGTFLSRGRDKKIRDIEKRIADFSFIPVEHGEGLQVLHYE  169



>ref|XP_002263060.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Vitis vinifera]
 emb|CBI24447.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   221 bits (563),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R  PR+++S +T   ++  + S VVL+LLA G+LSIPS S  S +A+DLSTI 
Sbjct  1    MAKPRYPRFPPRKSSS-STVVLSMLLMFSFVVLVLLALGLLSIPSHSGDSPRANDLSTIV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            H T+ER +  +    KG+ W EVISWEPRAFVYHNFLSK ECEYLI LAKPHMQKSTVVD
Sbjct  60   HRTVERSDGNDG---KGEPWSEVISWEPRAFVYHNFLSKDECEYLIKLAKPHMQKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S TGKSKDSRVRTSSGTFL RG+DKIIR IEKR++DFTF+P EHGEGLQILHYE
Sbjct  117  SSTGKSKDSRVRTSSGTFLTRGQDKIIRGIEKRLSDFTFLPVEHGEGLQILHYE  170



>emb|CDY29362.1| BnaA06g14340D [Brassica napus]
Length=291

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = +3

Query  141  RRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEE  320
            R+ ++L    F +F +L++V+LMLLAFG+ S+P ++       DLS       ER   EE
Sbjct  14   RKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNNDESSPMDLSYFRRAATER--SEE  70

Query  321  DDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRV  500
               ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVDSETGKSKDSRV
Sbjct  71   GLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRV  130

Query  501  RTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            RTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  131  RTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  173



>ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69355.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  S    DLS   
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNDESSPI-DLSYFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER E      ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVD
Sbjct  59   RAATERSEGLG---KRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQILHYE
Sbjct  116  SETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQILHYE  169



>emb|CDY51328.1| BnaCnng20650D [Brassica napus]
Length=291

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = +3

Query  141  RRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEE  320
            R+ ++L    F +F +L++V+LMLLAFG+ S+P ++       DLS       ER   EE
Sbjct  14   RKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNNDESSPMDLSYFRRAATER--SEE  70

Query  321  DDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRV  500
               ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVDS+TGKSKDSRV
Sbjct  71   GLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSQTGKSKDSRV  130

Query  501  RTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            RTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  131  RTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  173



>ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LN20.1|P4H3_ARATH RecName: Full=Probable prolyl 4-hydroxylase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF88161.1|AC026234_12 Contains similarity to a prolyl 4-hydroxylase alpha subunit protein 
from Gallus gallus gi|212530 [Arabidopsis thaliana]
 gb|ABE02413.1| At1g20270 [Arabidopsis thaliana]
 gb|AEE29956.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=287

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  S    DLS   
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNDESSPI-DLSYFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER E      ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVD
Sbjct  59   RAATERSEGLG---KRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  116  SETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  169



>gb|AAM61711.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=287

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  S    DLS   
Sbjct  1    MAKLRHSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNDESSPI-DLSYFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER E      ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVD
Sbjct  59   RAATERSEGLG---KRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  116  SETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  169



>ref|XP_010266900.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 135/174 (78%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R  P + +S  T A A+  +L+ V+LMLLA GI S+P SS  + KA+DLS+  
Sbjct  1    MAKPRPFR-TPNKRSSTYTLALAMLLMLTFVLLMLLALGIFSLPVSSNDTSKANDLSSFV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            H T+ R +    +  +G+ W EV+SWEPRAF+YH FLSK ECEYLI LAKPHM+KSTVVD
Sbjct  60   HRTVHRNDGGFGE--RGEQWTEVLSWEPRAFIYHTFLSKEECEYLIELAKPHMEKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S TGKSKDSRVRTSSGTFL RG+DKIIRNIEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  STTGKSKDSRVRTSSGTFLKRGQDKIIRNIEKRIADFTFIPVEHGEGLQILHYE  171



>ref|XP_006305481.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
 gb|EOA38379.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
Length=287

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 133/174 (76%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  S    DLS   
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPINNDESSPM-DLSYFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER E      ++GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTVVD
Sbjct  59   RAATERSEGLG---KRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  116  SETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  169



>ref|XP_010480555.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=272

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  +        ++
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPITNNNNNDDSSPIDLS  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            +      E+ E    +GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM+KSTVVD
Sbjct  60   YFRRAATERSEGLGTRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMKKSTVVD  119

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  120  SQTGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  173



>ref|XP_011079010.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Sesamum indicum]
Length=295

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +3

Query  111  AKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQ---KAHDLST  281
            A+  YGRG P R TS +T       +LSL++++LL  GI SI SSS  S+   KAHDLS 
Sbjct  5    ARQHYGRGGPPRKTSSSTAVLYGLLMLSLLIVILLYLGIFSISSSSGSSKDSPKAHDLSF  64

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            IAHN++   + +E++    D WVEVISWEPRAFV+HNFLSK ECEYLI++AKPHM+KSTV
Sbjct  65   IAHNSVHSGDGDEENK---DQWVEVISWEPRAFVFHNFLSKEECEYLISIAKPHMEKSTV  121

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDSETGKSKDSRVRTSSGTFL RGRDKI++ IEKRIADFTF+P EHGEGLQILHYE
Sbjct  122  VDSETGKSKDSRVRTSSGTFLVRGRDKIVQRIEKRIADFTFLPVEHGEGLQILHYE  177



>ref|XP_010477260.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010477261.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=291

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  +        ++
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPITNNNNNDDSSPIDLS  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            +      E+ E    +GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM+KSTVVD
Sbjct  60   YFRRAATERSEGLGTRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMKKSTVVD  119

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  120  SQTGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  173



>ref|XP_008440878.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=287

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+++S +T  F +  + + V+L+LLA GILSIP +S GS K HDLS+I 
Sbjct  1    MAKHRQSRFPTRKSSSSSTLVFTLLIMFTFVILILLALGILSIPGNSGGSTKVHDLSSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                 R+  ++ D  KG+ WVEVISWEPRAF+YHNFL+K ECEYLI+LAKPHMQKSTVVD
Sbjct  61   -----RKTSDDVDEEKGEQWVEVISWEPRAFIYHNFLTKEECEYLISLAKPHMQKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETG+SKDSRVRTSSGTFL RGRDK IR IEKRI+DF+FIP EHGEGLQ+LHYE
Sbjct  116  SETGQSKDSRVRTSSGTFLPRGRDKTIRTIEKRISDFSFIPVEHGEGLQVLHYE  169



>ref|XP_007046593.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007046596.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90750.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90753.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=283

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 138/174 (79%), Gaps = 9/174 (5%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R LP R +S +TT   +  + + ++L+LLA GILSIPSS+ G     DLS+I 
Sbjct  1    MAKPRYSR-LPARKSSSSTTILTMLIMFTFLILILLALGILSIPSSNSG-----DLSSIK  54

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             N ++R +  E    +G+ WVEVISWEPRAF+YHNFLS+ ECEYLI LAKPHM+KSTVVD
Sbjct  55   RNAVDRSDGGEG---QGEQWVEVISWEPRAFIYHNFLSQKECEYLIELAKPHMEKSTVVD  111

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDK IRNIEKRIADFTFIP EHGEGLQILHYE
Sbjct  112  SETGKSKDSRVRTSSGTFLARGRDKTIRNIEKRIADFTFIPVEHGEGLQILHYE  165



>ref|XP_010498461.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010498463.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 134/176 (76%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  +    D S I 
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPITNN-NNNNDDSSPID  58

Query  288  HNTLERE--EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
             +   R   E+ E    +GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTV
Sbjct  59   LSYFRRAATERSEGLGTRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTV  118

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  119  VDSQTGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  174



>ref|XP_004134841.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
 gb|KGN48959.1| hypothetical protein Csa_6G507320 [Cucumis sativus]
Length=287

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+++S +T  F +  + + V+L+LLA GILSIP +S GS K HDLS+I 
Sbjct  1    MAKHRQSRFPTRKSSSSSTLVFTLLIMFTFVILILLALGILSIPGNSGGSTKVHDLSSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                 R+  ++ D  KG+ WVEVISWEPRAFVYHNFL+K ECEYLI+LAKPHMQKSTVVD
Sbjct  61   -----RKTSDDVDEEKGEQWVEVISWEPRAFVYHNFLTKEECEYLISLAKPHMQKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETG+SKDSRVRTSSGTFL RGRDK +R IEKR++DF+FIP EHGEGLQ+LHYE
Sbjct  116  SETGQSKDSRVRTSSGTFLPRGRDKTVRTIEKRLSDFSFIPVEHGEGLQVLHYE  169



>ref|XP_004158845.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=287

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+++S +T  F +  + + V+L+LLA GILSIP +S GS K HDLS+I 
Sbjct  1    MAKHRQSRFPTRKSSSSSTLVFTLLIMFTFVILILLALGILSIPGNSGGSTKVHDLSSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                 R+  ++ D  KG+ WVEVISWEPRAFVYHNFL+K ECEYLI+LAKPHMQKSTVVD
Sbjct  61   -----RKTSDDVDEEKGEQWVEVISWEPRAFVYHNFLTKEECEYLISLAKPHMQKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETG+SKDSRVRTSSGTFL RGRDK +R IEKR++DF+FIP EHGEGLQ+LHYE
Sbjct  116  SETGQSKDSRVRTSSGTFLPRGRDKTVRTIEKRLSDFSFIPVEHGEGLQVLHYE  169



>ref|XP_010459709.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010459710.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 134/176 (76%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +  R   R+ ++L    F +F +L++V+LMLLAFG+ S+P ++  +    D S I 
Sbjct  1    MAKVRQSRFQARKWSTLMLVLFMLF-MLTIVLLMLLAFGVFSLPITNN-NNNNDDSSPID  58

Query  288  HNTLERE--EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
             +   R   E+ E    +GD W EV+SWEPRAFVYHNFLSK ECEYLI+LAKPHM KSTV
Sbjct  59   LSYFRRAATERSEGLGTRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTV  118

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKSKDSRVRTSSGTFL RGRDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  119  VDSQTGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYE  174



>ref|XP_007046594.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007046595.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOX90751.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX90752.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=296

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 138/174 (79%), Gaps = 9/174 (5%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK +Y R LP R +S +TT   +  + + ++L+LLA GILSIPSS+ G     DLS+I 
Sbjct  1    MAKPRYSR-LPARKSSSSTTILTMLIMFTFLILILLALGILSIPSSNSG-----DLSSIK  54

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             N ++R +  E    +G+ WVEVISWEPRAF+YHNFLS+ ECEYLI LAKPHM+KSTVVD
Sbjct  55   RNAVDRSDGGEG---QGEQWVEVISWEPRAFIYHNFLSQKECEYLIELAKPHMEKSTVVD  111

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDK IRNIEKRIADFTFIP EHGEGLQILHYE
Sbjct  112  SETGKSKDSRVRTSSGTFLARGRDKTIRNIEKRIADFTFIPVEHGEGLQILHYE  165



>gb|KJB48236.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=266

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 136/175 (78%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPS-SSRGSQKAHDLSTI  284
            MAK +  R LP R +S +    A+  I + ++L+LL  GI  IPS  SR S K +DLS+I
Sbjct  1    MAKPRSSR-LPPRKSSSSIMFLAMLVIFTFLILILLGLGIFYIPSGDSRNSPKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN ++R   +ED   +G+ WVE ISWEPRAF+YHNFLS  ECEYLI+LAKPHM+KS VV
Sbjct  60   VHNVVDRSYVDED---RGEQWVEAISWEPRAFIYHNFLSMEECEYLIDLAKPHMKKSKVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TGKS+DSRVRTSSGTFL RGRDKII++IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSKTGKSEDSRVRTSSGTFLPRGRDKIIKSIEKRIADFTFIPVEHGEGLQVLHYE  171



>ref|XP_010266054.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
 ref|XP_010266055.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   +R+ S       +  +L+ V+L+LLA GI S+P ++  + KA+DLS+  
Sbjct  1    MAKPRHHRPSSKRSPSFTLVLVML-LMLTFVLLVLLALGIFSLPINTNDAPKANDLSSFV  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              +  R +    +  +G+ W EVISWEPRAFVYHNFLSK ECEYLINLAKPHM+KSTVVD
Sbjct  60   RKSAYRNDGGFGE--RGEQWTEVISWEPRAFVYHNFLSKEECEYLINLAKPHMEKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S TGKSKDSRVRTSSGTFL RG+D IIRNIEKRIAD+TFIP EHGEGLQILHYE
Sbjct  118  STTGKSKDSRVRTSSGTFLRRGQDAIIRNIEKRIADYTFIPVEHGEGLQILHYE  171



>gb|EPS71884.1| hypothetical protein M569_02873 [Genlisea aurea]
Length=292

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 131/176 (74%), Gaps = 7/176 (4%)
 Frame = +3

Query  111  AKGK--YGRGLPRR-TTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
             KG+  YG+  PRR  TS AT       IL   +++ ++  ILSIP   + S K HDL+T
Sbjct  3    GKGRQFYGKAAPRRVNTSSATLLTYGMIILFFGLVIFISLRILSIPGD-KDSPKPHDLTT  61

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            IAH ++ R+     D    D WVEVISWEPRA +YH FLSK ECEYLI++AKPHM+KS+V
Sbjct  62   IAHASVHRDGS---DAEAKDQWVEVISWEPRASIYHGFLSKEECEYLISIAKPHMEKSSV  118

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VD+ETGKSKDSRVRTSSGTFL RGRDKI++ IEKRIADFTFIP EHGEGLQILHYE
Sbjct  119  VDTETGKSKDSRVRTSSGTFLARGRDKIVQTIEKRIADFTFIPVEHGEGLQILHYE  174



>ref|XP_010033532.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 ref|XP_010033534.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW53223.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
 gb|KCW53224.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
Length=294

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 6/151 (4%)
 Frame = +3

Query  186  ILSLVVLMLLAFGILSIPSSSRGS---QKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEV  356
            + S VVL+LLA GILS+P  S      +KA+DL++I  NT++R + +E    + + WVEV
Sbjct  29   VFSFVVLILLALGILSMPGGSSAGGDRRKANDLASIVRNTVDRSKGDEG---RAEQWVEV  85

Query  357  ISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGR  536
            ISWEPRAFVYHNFLSK ECEYLI LA P+M+KSTVVDSETGKS DSRVRTS GTFL RGR
Sbjct  86   ISWEPRAFVYHNFLSKEECEYLIELAAPNMEKSTVVDSETGKSTDSRVRTSYGTFLARGR  145

Query  537  DKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DKIIR+IEKRIAD+TFIP E+GEGLQ+LHYE
Sbjct  146  DKIIRDIEKRIADYTFIPVENGEGLQVLHYE  176



>gb|KJB48235.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48237.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48238.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48239.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=289

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 136/175 (78%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R LP R +S +    A+  I + ++L+LL  GI  IPS  SR S K +DLS+I
Sbjct  1    MAKPRSSR-LPPRKSSSSIMFLAMLVIFTFLILILLGLGIFYIPSGDSRNSPKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN ++R   +ED   +G+ WVE ISWEPRAF+YHNFLS  ECEYLI+LAKPHM+KS VV
Sbjct  60   VHNVVDRSYVDED---RGEQWVEAISWEPRAFIYHNFLSMEECEYLIDLAKPHMKKSKVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TGKS+DSRVRTSSGTFL RGRDKII++IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSKTGKSEDSRVRTSSGTFLPRGRDKIIKSIEKRIADFTFIPVEHGEGLQVLHYE  171



>gb|EPS63604.1| iron ion binding / oxidoreductase/ oxidoreductase protein, partial 
[Genlisea aurea]
Length=283

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 11/177 (6%)
 Frame = +3

Query  99   AVTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLS  278
            AV   +  YG+  PR+ +           ILS VV + ++ G+LSI SS+  S +AHDL+
Sbjct  2    AVKGTRQFYGKAAPRKVS-------YGMIILSFVVFVFISLGLLSI-SSTEYSPEAHDLN  53

Query  279  TIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKST  458
             IAH ++ R+E EED     D W EVISWEPRA ++H FLSK EC YLI+LA+PHM+KST
Sbjct  54   AIAHGSVLRDELEEDTR---DRWSEVISWEPRASIFHGFLSKAECNYLISLAQPHMKKST  110

Query  459  VVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VVDS+TGKSKDSRVRTS GTFL RGRDKI+RNIEKRIAD TFIP EHGEGLQILHYE
Sbjct  111  VVDSDTGKSKDSRVRTSYGTFLARGRDKIVRNIEKRIADATFIPVEHGEGLQILHYE  167



>ref|XP_007157869.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
 gb|ESW29863.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
Length=290

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGS-QKAHDLSTI  284
            MAK +Y R  PR+++S +T    +  + + ++L+LLA GILSIPSSSR    K +DL++I
Sbjct  1    MAKPRYSRLQPRKSSSSSTLILTLLLVFTFLILILLALGILSIPSSSRNDLPKPNDLTSI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            A NT++     +DD  +G+ WVEV+SWEPRAFVYHNFL+K EC+YLI++AKP MQKSTVV
Sbjct  61   ARNTIQ---TSDDDEERGEQWVEVVSWEPRAFVYHNFLTKEECDYLIDIAKPSMQKSTVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSETGKSKDSRVRTSSGTFL RGRDKI+RNIEK+IADF+FIP EHGEGLQ+LHYE
Sbjct  118  DSETGKSKDSRVRTSSGTFLPRGRDKIVRNIEKKIADFSFIPVEHGEGLQVLHYE  172



>ref|XP_009334602.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Pyrus x bretschneideri]
Length=287

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S  T   ++  +LS+V+LMLLAFGI+S+P S+ GS   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSAFTLVLSMLFVLSVVLLMLLAFGIVSLPVSTDGSS-PNDLSSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
               +ER +   +   +G+ W EVISWEPRAF+YHNFLSK EC+YLINLAKPHM KSTVVD
Sbjct  59   RKIVERSDGLGN---RGEQWTEVISWEPRAFIYHNFLSKEECDYLINLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKS+DS VRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  116  SKTGKSRDSSVRTSSGMFLRRGRDKIIRDIEKRIADFTFIPVEHGEGLQVLHYE  169



>ref|XP_010683036.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Beta vulgaris subsp. 
vulgaris]
Length=291

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATT-AFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLST  281
            MAKGK GR  PR++++ ++T  F++  +LS+VVL+LLA GI+S+P+S S  S+  HDL+ 
Sbjct  1    MAKGKLGRTPPRKSSTPSSTLVFSLLLMLSVVVLILLALGIVSLPTSNSATSRPVHDLNN  60

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            I H+T+ R E  ++   KG+ WVE +SWEPRA VYHNFLSK ECEYLI LA PHM+KS V
Sbjct  61   IVHSTVHRVEVSKE---KGEQWVEFLSWEPRAVVYHNFLSKDECEYLIKLASPHMEKSKV  117

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +D +TGKSKDSRVRTSSGTFL RGRD IIR IE+RIADFTF+P EHGEGLQ+LHYE
Sbjct  118  IDEKTGKSKDSRVRTSSGTFLPRGRDTIIRAIEQRIADFTFLPVEHGEGLQVLHYE  173



>ref|XP_009386075.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386076.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MA+G ++ R LP R +S  T   A     S+V+LMLLA GI S+P +S G  K   L   
Sbjct  1    MARGARHPRKLPGRRSSPFTLILAALLTASVVLLMLLALGIFSLPVNSDGPPK---LDHR  57

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             H ++   E  +    +GD W EV+SWEPRAF+YHNFLSK ECEYL  LAKPHM+KSTVV
Sbjct  58   PHRSIH--EMRDGMGERGDQWTEVLSWEPRAFIYHNFLSKKECEYLTELAKPHMEKSTVV  115

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D+ TG+SKDSRVRTSSG FL RG+DKIIR IEKRIAD+TFIP E+GEGLQ+LHYE
Sbjct  116  DTATGQSKDSRVRTSSGMFLRRGQDKIIRTIEKRIADYTFIPVENGEGLQVLHYE  170



>emb|CDP07346.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +3

Query  108  MAKGKYGRGL-PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIP-SSSRGSQKAHDLST  281
            MAKG++ R   P + TS      ++  +L++V+LMLLA GI S+P  S  G    +D   
Sbjct  1    MAKGRFSRQQHPGKRTSTVALVLSMLLMLTIVLLMLLALGIFSLPLGSDDGPYPVYDRIK  60

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
                 L+  E E    ++G+ W EV+SWEPRAF+YHNFLSK ECEYLI+LA+PHM KSTV
Sbjct  61   FKRVALDIGEGEGLG-KRGEQWTEVLSWEPRAFIYHNFLSKEECEYLIDLARPHMVKSTV  119

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TG+SKDSRVRTSSG F+ RG DK+IRNIEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  120  VDSKTGQSKDSRVRTSSGMFMRRGGDKVIRNIEKRIADYTFIPVDHGEGLQVLHYE  175



>gb|KHG25174.1| phy-2: Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=339

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R LP R +S +    A+  I + ++L+LL  GI  IPS   R S K +DLS+I
Sbjct  1    MAKPRSSR-LPPRKSSSSIMFLAMLVIFTFLILILLGLGIFYIPSGDPRNSPKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN ++R   +ED   +G+ WVE ISWEPRAF+YHNFLS  ECEYLI+LAKP M+KS VV
Sbjct  60   VHNVVDRSYVDED---RGEQWVEAISWEPRAFIYHNFLSMEECEYLIDLAKPRMKKSKVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TGKS+DSRVRTSSGTFL RGRDKII++IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSKTGKSEDSRVRTSSGTFLPRGRDKIIKSIEKRIADFTFIPVEHGEGLQVLHYE  171



>ref|XP_010536435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Tarenaya hassleriana]
Length=289

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 129/173 (75%), Gaps = 4/173 (2%)
 Frame = +3

Query  111  AKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAH  290
            AK ++ R   R+ ++L      +F +LS+V +MLL  GI SIP +   S    DLST   
Sbjct  3    AKLRHSRFHARKLSTLMLVLSMLF-MLSVVFVMLLTLGIFSIPVNDDESSTI-DLSTSYR  60

Query  291  NTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDS  470
                  E+ E   ++G+ W EV+SWEPRAFVYHNFLSK ECEYLINLA PHM KSTVVDS
Sbjct  61   RM--AAERGEGLGKRGEQWTEVLSWEPRAFVYHNFLSKEECEYLINLATPHMVKSTVVDS  118

Query  471  ETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +TGKSKDSRVRTSSGTFL RGRDK+IR+IEKRIAD+TFIPAEHGEGLQ+LHYE
Sbjct  119  KTGKSKDSRVRTSSGTFLRRGRDKVIRDIEKRIADYTFIPAEHGEGLQVLHYE  171



>gb|KHG25173.1| P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=347

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSS-SRGSQKAHDLSTI  284
            MAK +  R LP R +S +    A+  I + ++L+LL  GI  IPS   R S K +DLS+I
Sbjct  1    MAKPRSSR-LPPRKSSSSIMFLAMLVIFTFLILILLGLGIFYIPSGDPRNSPKPNDLSSI  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
             HN ++R   +ED   +G+ WVE ISWEPRAF+YHNFLS  ECEYLI+LAKP M+KS VV
Sbjct  60   VHNVVDRSYVDED---RGEQWVEAISWEPRAFIYHNFLSMEECEYLIDLAKPRMKKSKVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TGKS+DSRVRTSSGTFL RGRDKII++IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  DSKTGKSEDSRVRTSSGTFLPRGRDKIIKSIEKRIADFTFIPVEHGEGLQVLHYE  171



>gb|KDO75955.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=202

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R   ++ ++L T   ++  +L++V+LMLLA GI  IP     S   +DL++  
Sbjct  1    MVKLRHSRLQAKKWSTL-TLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDS-PPNDLTSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                E+     ++  KG+ W E+++WEPRAFVYHNFLSK ECEYLI+LAKP+M KSTVVD
Sbjct  59   RRAFEKRSSIAEE--KGEQWTEIVAWEPRAFVYHNFLSKAECEYLIDLAKPYMVKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSGTFL RG+D+IIR IEKRIADFTFIP EHGEG+Q+LHYE
Sbjct  117  SKTGQSKDSRVRTSSGTFLKRGQDRIIRGIEKRIADFTFIPMEHGEGIQVLHYE  170



>ref|XP_007202401.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
 gb|EMJ03600.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
Length=291

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 5/134 (4%)
 Frame = +3

Query  231  SIPSSSRG-SQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKY  407
            S+PS S G S KA+DLS+I   + +R E+E      G+ WVEVISWEPRAFVYHNFL+K 
Sbjct  44   SVPSGSSGNSAKANDLSSIVRKSADRNEEEG----AGEQWVEVISWEPRAFVYHNFLTKE  99

Query  408  ECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFI  587
            ECEYLI+LAKP M KSTVVDSETGKSKDSRVRTSSGTFL RGRDKIIRNIEKRIA+FTF+
Sbjct  100  ECEYLIDLAKPSMHKSTVVDSETGKSKDSRVRTSSGTFLQRGRDKIIRNIEKRIANFTFL  159

Query  588  PAEHGEGLQILHYE  629
            P EHGEGLQ+LHYE
Sbjct  160  PVEHGEGLQVLHYE  173



>ref|XP_008242010.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Prunus 
mume]
Length=291

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 113/134 (84%), Gaps = 5/134 (4%)
 Frame = +3

Query  231  SIPSSSRG-SQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKY  407
            S+PS S G S KA+DLS+I   + +R E+E      G+ WVEVISWEPRAF+YHNFL+K 
Sbjct  44   SVPSGSSGNSAKANDLSSIVRKSADRNEEE----GAGEQWVEVISWEPRAFIYHNFLTKE  99

Query  408  ECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFI  587
            ECEYLI+LAKP M KSTVVDSETGKSKDSRVRTSSGTFL RGRDKIIRNIEKRIA+FTF+
Sbjct  100  ECEYLIDLAKPSMHKSTVVDSETGKSKDSRVRTSSGTFLQRGRDKIIRNIEKRIANFTFL  159

Query  588  PAEHGEGLQILHYE  629
            P EHGEGLQ+LHYE
Sbjct  160  PVEHGEGLQVLHYE  173



>ref|XP_008221210.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Prunus mume]
Length=299

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   YRAYAVTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKA  266
            +RA++ TMAKG+YGR L  +  S  T   ++  +L +V+LMLLAFGI+S+P  +  S   
Sbjct  7    FRAHS-TMAKGRYGR-LQSKKWSTFTLVLSMLFMLIVVLLMLLAFGIVSLPVITDESS-P  63

Query  267  HDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHM  446
            +DLS     T+ER +   +   + D W EVISWEPRAF+YHNFLSK EC+YLINLAKP M
Sbjct  64   NDLSPFRRRTVERTDGLGE---REDQWTEVISWEPRAFIYHNFLSKEECDYLINLAKPDM  120

Query  447  QKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
             KSTVVDS+TGKSKDSRVRTSSG FL RGRDKI+ +IEKRIADFTFIP EHGEGLQILHY
Sbjct  121  VKSTVVDSKTGKSKDSRVRTSSGMFLKRGRDKIVSDIEKRIADFTFIPVEHGEGLQILHY  180

Query  627  E  629
            E
Sbjct  181  E  181



>ref|XP_002869059.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45318.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            K K+ R  PR+  S +T AF V  +   V+L+L+  GILS+P++++ S +  DL+TI   
Sbjct  4    KPKHLRNQPRK--SFSTQAFTVLILGLFVILILVGLGILSLPNTNKSSSRPMDLTTIVQT  61

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
              ERE   +++   GD W+EVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +
Sbjct  62   IEERESYGDEEDGNGDRWLEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSKVVDVK  121

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL RG D+I+  IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  122  TGKSIDSRVRTSSGTFLKRGHDEIVEEIENRISDFTFIPIENGEGLQVLHYE  173



>ref|XP_010029633.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW56575.1| hypothetical protein EUGRSUZ_I02306 [Eucalyptus grandis]
Length=343

 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQ--KAHDLST  281
            MAK +  R   RR  S      A   +  L VL+LLA G+ SIPS    S   +A+DLS+
Sbjct  51   MAKPRQPRFPQRRPPSSRRLLLAAILMFGLAVLILLALGVFSIPSGGGSSSSSEANDLSS  110

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            I    ++R     D  R G+ WVE+ISWEPRAFVYHNFLS+ EC+YLI LAKPHM+KSTV
Sbjct  111  ILRRNVKRSGLGRDGER-GEQWVELISWEPRAFVYHNFLSEDECKYLIELAKPHMKKSTV  169

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VD  TG++KDSRVRTS GTFL RGRDKIIR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  170  VDRVTGETKDSRVRTSLGTFLARGRDKIIRDIEKRIADFTFIPIEHGEGLQMLHYE  225



>gb|EYU36811.1| hypothetical protein MIMGU_mgv1a011044mg [Erythranthe guttata]
Length=294

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIP-SSSRGSQKAHDLSTI  284
            MAKG+  R   +R++++      +  +L++V+LMLL  GI+S+P  S   S    +   +
Sbjct  1    MAKGRGSRHQGKRSSTVVLVLSML-LMLTIVLLMLLGLGIVSLPVGSDEDSSPIGERIKL  59

Query  285  AHNTLEREEQEEDDV--RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKST  458
               T++ + + E D    +GD W EV+SWEPRAFVYHNFLSK ECEYLINLA+PHM KST
Sbjct  60   KRLTIDIKGESEGDGLGERGDQWTEVLSWEPRAFVYHNFLSKEECEYLINLARPHMVKST  119

Query  459  VVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VVDS+TGKSKDSRVRTSSG FL RGRDK+I++IEKRIAD+TFIPAEHGEGLQ+LHYE
Sbjct  120  VVDSKTGKSKDSRVRTSSGMFLRRGRDKVIKDIEKRIADYTFIPAEHGEGLQVLHYE  176



>gb|KDO75954.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=266

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R   ++ ++L T   ++  +L++V+LMLLA GI  IP     S   +DL++  
Sbjct  1    MVKLRHSRLQAKKWSTL-TLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDS-PPNDLTSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                E+     ++  KG+ W E+++WEPRAFVYHNFLSK ECEYLI+LAKP+M KSTVVD
Sbjct  59   RRAFEKRSSIAEE--KGEQWTEIVAWEPRAFVYHNFLSKAECEYLIDLAKPYMVKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSGTFL RG+D+IIR IEKRIADFTFIP EHGEG+Q+LHYE
Sbjct  117  SKTGQSKDSRVRTSSGTFLKRGQDRIIRGIEKRIADFTFIPMEHGEGIQVLHYE  170



>ref|XP_008377129.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=287

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 135/174 (78%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S      ++  +LS+V+LMLLAFG +S+P S+  S   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSTFMLVLSMLLMLSVVLLMLLAFGTVSLPVSTDDSS-PNDLSSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              T+ER +   + V +   W EVISWEPRAFVYHNFLSK EC+YLINLAKPHM KS+VVD
Sbjct  59   RKTVERGDGLGNRVEQ---WTEVISWEPRAFVYHNFLSKEECDYLINLAKPHMVKSSVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQILHYE
Sbjct  116  SKTGKSKDSRVRTSSGMFLKRGRDKIIRDIEKRIADFTFIPVEHGEGLQILHYE  169



>ref|XP_004287769.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Fragaria vesca subsp. 
vesca]
Length=292

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = +3

Query  231  SIPSSSRG-SQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKY  407
            S+PS S G S KA+DLS+I  N+ ER +    D R  + WVE ISWEPRAFVYHNFL++ 
Sbjct  44   SVPSGSSGDSPKANDLSSIVRNSAERIQ---GDDRSKEQWVEAISWEPRAFVYHNFLTQQ  100

Query  408  ECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFI  587
            EC+YLI+LAKPHM+KSTVVDSETGKSKDSRVRTSSGTFL RGRDK+IRNIE++IA+FTF+
Sbjct  101  ECDYLIDLAKPHMEKSTVVDSETGKSKDSRVRTSSGTFLSRGRDKVIRNIERKIANFTFL  160

Query  588  PAEHGEGLQILHYE  629
            P EHGEGLQILHYE
Sbjct  161  PVEHGEGLQILHYE  174



>ref|XP_007223346.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
 gb|EMJ24545.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
Length=287

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S  T   ++  +L +V+LMLLAFGI+S+P  +  S   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSTFTLVLSMLFMLIVVLLMLLAFGIVSLPVITDESS-PNDLSSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             +T+ER +   +   + D W EVISWEPRAF+YHNFLSK EC+YLINLAKP M KSTVVD
Sbjct  59   RSTVERTDGFGE---REDQWTEVISWEPRAFIYHNFLSKEECDYLINLAKPDMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSG FL RGRDKI+ +IEKRIADFTFIP EHGEGLQILHYE
Sbjct  116  SKTGKSKDSRVRTSSGMFLKRGRDKIVSDIEKRIADFTFIPVEHGEGLQILHYE  169



>ref|XP_006449333.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 ref|XP_006467805.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Citrus 
sinensis]
 gb|ESR62573.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 gb|KDO75953.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=288

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R   ++ ++L T   ++  +L++V+LMLLA GI  IP     S   +DL++  
Sbjct  1    MVKLRHSRLQAKKWSTL-TLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDS-PPNDLTSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                E+     ++  KG+ W E+++WEPRAFVYHNFLSK ECEYLI+LAKP+M KSTVVD
Sbjct  59   RRAFEKRSSIAEE--KGEQWTEIVAWEPRAFVYHNFLSKAECEYLIDLAKPYMVKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSGTFL RG+D+IIR IEKRIADFTFIP EHGEG+Q+LHYE
Sbjct  117  SKTGQSKDSRVRTSSGTFLKRGQDRIIRGIEKRIADFTFIPMEHGEGIQVLHYE  170



>emb|CDY54327.1| BnaCnng26730D [Brassica napus]
Length=290

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  192  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEP  371
            ++V+LMLL+FG+ S+P  +       DLS+      ER E      ++GD W E++SWEP
Sbjct  30   TIVLLMLLSFGVFSLPIDTFDEYSPADLSSFRRAATERSE---GIGKRGDQWTEILSWEP  86

Query  372  RAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIR  551
            RAF+YH FLSK ECEYLI+LAKP+M KSTVVDS+TGKSKDSRVRTSSGTFL RGRDK+I+
Sbjct  87   RAFLYHGFLSKEECEYLISLAKPYMVKSTVVDSQTGKSKDSRVRTSSGTFLRRGRDKVIK  146

Query  552  NIEKRIADFTFIPAEHGEGLQILHYE  629
             IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  147  TIEKRIADYTFIPADHGEGLQVLHYE  172



>ref|XP_006828848.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
 gb|ERM96264.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
Length=286

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 129/179 (72%), Gaps = 16/179 (9%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MAKG +Y +    R  S  T   A   + S++VLMLLA G+ S+P S+          T 
Sbjct  1    MAKGTRYHKAYSNRR-STQTLILAALVMFSVMVLMLLALGMFSLPVST----------TP  49

Query  285  AHNTLERE----EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQK  452
            +H  +ER     E++ +D  +   W E++SWEPRAF++HNFLSK ECEYLI+LAKPHM+K
Sbjct  50   SHEPIERTTVHLEKDGNDREERKQWTEILSWEPRAFLFHNFLSKDECEYLISLAKPHMEK  109

Query  453  STVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            STVVDS TG+SKDSRVRTSSG FL RG+DKII++IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  110  STVVDSTTGQSKDSRVRTSSGMFLKRGQDKIIQSIEKRIADFTFIPVEHGEGLQVLHYE  168



>emb|CDX96644.1| BnaA08g21870D [Brassica napus]
Length=290

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  192  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEP  371
            ++V+LMLL+FG+ S+P  +       DLS+      ER E      ++GD W E++SWEP
Sbjct  30   TIVLLMLLSFGVFSLPIDTFDEYSPTDLSSFRRAATERSE---GIGKRGDQWTEILSWEP  86

Query  372  RAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIR  551
            RAF+YH FLSK ECEYLI+LAKP+M KSTVVDS+TGKSKDSRVRTSSGTFL RGRDK+I+
Sbjct  87   RAFLYHGFLSKEECEYLISLAKPYMVKSTVVDSQTGKSKDSRVRTSSGTFLRRGRDKVIK  146

Query  552  NIEKRIADFTFIPAEHGEGLQILHYE  629
             IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  147  TIEKRIADYTFIPADHGEGLQVLHYE  172



>ref|XP_009363441.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATT-AFAVFAILSLVVLMLLAFGILSIPSSSRGSQ-KAHDLSTIA  287
            K ++ R   R+T+S +TT       + + V+L+LLA GILS+PS S GS  KA+DLS+I 
Sbjct  4    KPRHARLPARKTSSRSTTLVLTSLVMFTFVILILLALGILSVPSGSSGSSSKANDLSSIV  63

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             +++ER E++      G+ WVEVISWEPRAFVYHNFL+K EC+YLI+LAKP M KSTVVD
Sbjct  64   RHSVERSEEDG----AGEQWVEVISWEPRAFVYHNFLTKAECDYLIDLAKPTMHKSTVVD  119

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETGKSKDSRVRTSSGTFL RGRDKIIRNIEK+IA+FTF+P EHGEGLQ+LHYE
Sbjct  120  SETGKSKDSRVRTSSGTFLARGRDKIIRNIEKKIANFTFLPVEHGEGLQVLHYE  173



>ref|XP_010446875.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=293

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE  317
            PR+  SL+  AF V  ++  V+L+L+  GILS+PS +  S +  DL+T+     ERE   
Sbjct  14   PRK--SLSMQAFTVLILVIFVILILVCLGILSLPSITNNSSRPMDLTTVVQTIEERESYG  71

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            +++   G+ W+EVISWEPRAF+YHNFL+  ECE+LI+LAKP M KS VVD +TGKSKDSR
Sbjct  72   DEEDGNGERWLEVISWEPRAFIYHNFLANEECEHLISLAKPSMVKSKVVDVKTGKSKDSR  131

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             RTSSGTFL RG DK++ +IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  132  ARTSSGTFLKRGHDKVVEDIENRISDFTFIPIENGEGLQVLHYE  175



>ref|XP_008393737.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=292

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 114/134 (85%), Gaps = 5/134 (4%)
 Frame = +3

Query  231  SIPS-SSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKY  407
            S+PS S+ GS KA+DLS+I+  ++ER E+ E     G+ WVE ISWEPRAFVYHNFL+K 
Sbjct  45   SVPSGSAGGSPKANDLSSISRQSVERNEENE----AGEQWVEAISWEPRAFVYHNFLTKE  100

Query  408  ECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFI  587
            ECEYLI+LAKP M KS+VVDSETGKS+DSRVRTSSGTFL RGRDKIIRNIEK+IA+FTF+
Sbjct  101  ECEYLIDLAKPTMHKSSVVDSETGKSRDSRVRTSSGTFLARGRDKIIRNIEKKIANFTFL  160

Query  588  PAEHGEGLQILHYE  629
            P E GEGLQ+LHYE
Sbjct  161  PVEQGEGLQVLHYE  174



>ref|XP_009110235.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=290

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  192  SLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEP  371
            ++V+LMLL+FG+ S+P  +       DLS+      ER E      ++GD W E++SWEP
Sbjct  30   TIVLLMLLSFGVFSLPIDTFDEYSPTDLSSFRRAATERSE---GIGKRGDQWTEILSWEP  86

Query  372  RAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIR  551
            RAF+YH FLSK ECEYLI+LAKP+M KSTVVDS+TGKSKDSRVRTSSGTFL RGRD++I+
Sbjct  87   RAFLYHGFLSKEECEYLISLAKPYMVKSTVVDSQTGKSKDSRVRTSSGTFLRRGRDQVIK  146

Query  552  NIEKRIADFTFIPAEHGEGLQILHYE  629
             IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  147  TIEKRIADYTFIPADHGEGLQVLHYE  172



>ref|XP_011022255.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=290

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  QKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAK  437
            ++A+DLS+IAH++  R +   DD  K + W EVISW+PRAFVYHNFL+K ECEYLINLAK
Sbjct  51   RQANDLSSIAHHS--RIDGSGDDEGKAEQWAEVISWKPRAFVYHNFLTKAECEYLINLAK  108

Query  438  PHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQI  617
            PHMQKSTVVDS TGKSKDS+VRTSSGTFL RGRDKIIR+IEKRIADF+FIP EHGEGLQI
Sbjct  109  PHMQKSTVVDSSTGKSKDSKVRTSSGTFLPRGRDKIIRDIEKRIADFSFIPVEHGEGLQI  168

Query  618  LHYE  629
            LHYE
Sbjct  169  LHYE  172



>ref|XP_010548243.1| PREDICTED: prolyl 4-hydroxylase 5 [Tarenaya hassleriana]
Length=290

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK K+ R  PR+++S +T AF V  +L+ V+L+LL  GILS+P+SSR S K +DL++I 
Sbjct  1    MAKSKHYRNQPRKSSSPSTQAFTVLILLTFVILILLGLGILSLPNSSRSSPKTNDLTSIV  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              +  R+   +D    G+ WVEVISWEPRA VYHNFL+K ECE+LI+LAKP+M KS VVD
Sbjct  61   RRSEGRKSYGDDG--NGERWVEVISWEPRAVVYHNFLTKEECEHLISLAKPNMVKSAVVD  118

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG SKDSRVRTSSGTFL RG DK++  IE+RI+DFTFIP E+GEGLQ+LHYE
Sbjct  119  EKTGGSKDSRVRTSSGTFLRRGHDKVVEEIEQRISDFTFIPVENGEGLQVLHYE  172



>ref|XP_009397948.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MA+G +Y R L  R +S  T   A     S+V+LMLLAFGI S+P  S    K  DL   
Sbjct  1    MARGARYSRTLLGRRSSSFTLILAALLTASVVLLMLLAFGIFSLPVGSDDRAKP-DL---  56

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
                    E +++  + GD W E++SWEPRAF+YHNFLSK EC+YLI LAKPHM+KSTVV
Sbjct  57   -RPRRPVHEAKDEMGQIGDQWTEMLSWEPRAFIYHNFLSKKECDYLIELAKPHMEKSTVV  115

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS TG SKDSRVRTSSG FL RG+DKII  IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  116  DSATGWSKDSRVRTSSGMFLRRGKDKIICAIEKRIADYTFIPVEHGEGLQVLHYE  170



>ref|XP_004171765.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 125/176 (71%), Gaps = 9/176 (5%)
 Frame = +3

Query  102  VTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            + ++KGKY +   R+ ++   +   +  +L+L   ML+A    S P +S      H  S+
Sbjct  1    MAISKGKYIKLQGRKWSTFQLSKMIMALVLALGFFMLIALRFFSPPETSH-----HRFSS  55

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            + H     +       ++GD WVE ISWEPRAFVYHNFLSK EC YLI+LAKPHM+KSTV
Sbjct  56   VRHTAFLSDGLG----KRGDQWVEFISWEPRAFVYHNFLSKEECLYLISLAKPHMEKSTV  111

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TG+S DSRVRTSSG FL+RG+DKIIRNIEKRIADFTFIP EHGEGLQILHYE
Sbjct  112  VDSKTGESVDSRVRTSSGMFLNRGQDKIIRNIEKRIADFTFIPIEHGEGLQILHYE  167



>ref|XP_002285898.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664132.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664133.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 emb|CBI18919.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+Y RG  +R ++LA     +  +  +++++L   GI+S+P  +  S  A+DLS+  
Sbjct  1    MAKGRYSRGHGKRWSTLALVLSLLLMLTVVLLMLLAL-GIVSLPIGTVDSDAANDLSSFR  59

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              T +  E      ++G+ W E++SWEPRAF+YHNFLSK ECEY+I+LAKP+M+KSTVVD
Sbjct  60   RKTFDGGEGLG---KRGEQWTEIVSWEPRAFIYHNFLSKEECEYMISLAKPYMKKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SETG+SKDSRVRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  117  SETGRSKDSRVRTSSGMFLRRGRDKIIRDIEKRIADFTFIPVEHGEGLQVLHYE  170



>ref|XP_006577956.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Glycine max]
 gb|KHN45959.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 11/178 (6%)
 Frame = +3

Query  108  MAKGKYG--RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            MAKGK+   R   ++ ++ +   +A+F  L+L++++LLA GI+ +P++        D  T
Sbjct  1    MAKGKHSHTRAQGKKWSTFSLVLWALF-FLTLILVVLLALGIVYLPTTD------DDFPT  53

Query  282  IAHNTLEREEQE--EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
               +   R+  +  E  V   + W E++SWEPRAF+YHNFLSK ECEYLI LAKPHM KS
Sbjct  54   TELSAFRRKTSQSGESLVENSEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPHMVKS  113

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +VVDS+TGKS +SRVRTSSG FL RGRDKII+NIEKRIADFTFIP E+GEGLQILHYE
Sbjct  114  SVVDSKTGKSTESRVRTSSGMFLKRGRDKIIQNIEKRIADFTFIPVENGEGLQILHYE  171



>ref|XP_006383041.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
 gb|ERP60838.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
Length=291

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  QKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAK  437
            ++A+DLS+IAH++  R +   DD  K + W EVISW+PRAFVYHNFL+K ECEYLINLAK
Sbjct  52   RQANDLSSIAHHS--RIDGSGDDEGKAEQWAEVISWKPRAFVYHNFLTKAECEYLINLAK  109

Query  438  PHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQI  617
            P MQKSTVVDS TGKSKDS+VRTSSGTFL RGRDKI+R+IEKRIADF+FIP EHGEGLQI
Sbjct  110  PRMQKSTVVDSSTGKSKDSKVRTSSGTFLPRGRDKIVRDIEKRIADFSFIPVEHGEGLQI  169

Query  618  LHYE  629
            LHYE
Sbjct  170  LHYE  173



>ref|XP_008456388.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cucumis melo]
Length=284

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 124/176 (70%), Gaps = 9/176 (5%)
 Frame = +3

Query  102  VTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            + ++KGKY +   ++ ++   +   +  +L+L   ML+A    S P +S      H L +
Sbjct  1    MAVSKGKYIKLQGKKWSTFQLSKMIMALVLALGFFMLIALRFFSPPETSH-----HRLPS  55

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            +         Q +   ++GD WVE ISWEPRAFVYHNFLSK EC YLI+LAKPHM+KSTV
Sbjct  56   VRRTAF----QSDGLGKRGDQWVEFISWEPRAFVYHNFLSKEECLYLISLAKPHMEKSTV  111

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKS DSRVRTSSG FL+RG+DKII NIEKRIADFTFIP EHGEGLQILHYE
Sbjct  112  VDSKTGKSVDSRVRTSSGMFLNRGQDKIISNIEKRIADFTFIPIEHGEGLQILHYE  167



>ref|XP_006577957.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Glycine max]
Length=289

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 11/178 (6%)
 Frame = +3

Query  108  MAKGKYG--RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            MAKGK+   R   ++ ++ +   +A+F  L+L++++LLA GI+ +P++        D  T
Sbjct  1    MAKGKHSHTRAQGKKWSTFSLVLWALF-FLTLILVVLLALGIVYLPTTD------DDFPT  53

Query  282  IAHNTLEREEQE--EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
               +   R+  +  E  V   + W E++SWEPRAF+YHNFLSK ECEYLI LAKPHM KS
Sbjct  54   TELSAFRRKTSQSGESLVENSEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPHMVKS  113

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +VVDS+TGKS +SRVRTSSG FL RGRDKII+NIEKRIADFTFIP E+GEGLQILHYE
Sbjct  114  SVVDSKTGKSTESRVRTSSGMFLKRGRDKIIQNIEKRIADFTFIPVENGEGLQILHYE  171



>ref|XP_008456383.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cucumis melo]
Length=290

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 124/176 (70%), Gaps = 9/176 (5%)
 Frame = +3

Query  102  VTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            + ++KGKY +   ++ ++   +   +  +L+L   ML+A    S P +S      H L +
Sbjct  1    MAVSKGKYIKLQGKKWSTFQLSKMIMALVLALGFFMLIALRFFSPPETSH-----HRLPS  55

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            +         Q +   ++GD WVE ISWEPRAFVYHNFLSK EC YLI+LAKPHM+KSTV
Sbjct  56   VRRTAF----QSDGLGKRGDQWVEFISWEPRAFVYHNFLSKEECLYLISLAKPHMEKSTV  111

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKS DSRVRTSSG FL+RG+DKII NIEKRIADFTFIP EHGEGLQILHYE
Sbjct  112  VDSKTGKSVDSRVRTSSGMFLNRGQDKIISNIEKRIADFTFIPIEHGEGLQILHYE  167



>ref|XP_009337076.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 4/123 (3%)
 Frame = +3

Query  261  KAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKP  440
            KA+DLS+I  +++ER E++      G+ WVEVISWEPRAFVYHNFL+K EC+YLI+LAKP
Sbjct  55   KANDLSSIVRHSVERNEEDG----AGEQWVEVISWEPRAFVYHNFLTKAECDYLIDLAKP  110

Query  441  HMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQIL  620
             M KSTVVDSETGKSKDSRVRTSSGTFL RGRDKIIRNIEK+IA+FTF+P EHGEGLQ+L
Sbjct  111  TMHKSTVVDSETGKSKDSRVRTSSGTFLARGRDKIIRNIEKKIANFTFLPVEHGEGLQVL  170

Query  621  HYE  629
            HYE
Sbjct  171  HYE  173



>ref|XP_011003088.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
 ref|XP_011003089.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
Length=288

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 10/177 (6%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R L  +  S  T   ++  +L++V+ +LL  G  S+P SS  S   +DL    
Sbjct  1    MVKVRHSR-LHTKKWSTFTLVLSMLFMLTVVLFILLGLGAFSLPVSSEDSS-PNDL----  54

Query  288  HNTLEREEQEEDDVRKG---DSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKST  458
             N+  R   E D    G   + W E++SWEPRAF+YHNFLSK ECEYLINLAKPHM KST
Sbjct  55   -NSYRRMASESDGDGMGKREEQWTEILSWEPRAFLYHNFLSKEECEYLINLAKPHMVKST  113

Query  459  VVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VVDS+TG+SKDSRVRTSSG FL RGRD+ IR IEKRIADF+FIP EHGEGLQ+LHYE
Sbjct  114  VVDSKTGRSKDSRVRTSSGMFLRRGRDRFIREIEKRIADFSFIPVEHGEGLQVLHYE  170



>ref|XP_010100124.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
 gb|EXB81507.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
Length=287

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 135/174 (78%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+Y R L  R  S  T  F++  +LS+V+LMLLA GI+S+P SS  S   +DLS+  
Sbjct  1    MAKGRYTR-LHGRKWSTFTLVFSILFMLSVVLLMLLALGIVSLPVSSDDSP-PNDLSSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
               +ER ++     ++ + W EV+SWEPRAF+YHN LSK ECEYLI++A+PHM KSTVVD
Sbjct  59   RRIVERGDELG---KREEQWTEVLSWEPRAFIYHNVLSKEECEYLISIAEPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSG FL RGRDKIIR+IEKRIADFTFIP EHGEGLQILHYE
Sbjct  116  SKTGRSKDSRVRTSSGMFLKRGRDKIIRDIEKRIADFTFIPVEHGEGLQILHYE  169



>emb|CDY07826.1| BnaC03g47960D [Brassica napus]
Length=293

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 129/167 (77%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+++S +T AF V  +L +V+++LL FGILS+P+++R S K +DL+ I   + E +
Sbjct  10   RYQPRKSSSRSTQAFKVIILLLVVIMILLGFGILSLPNANRNSSKPNDLTNIVRKSQE-Q  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LINLAKP+M KS VVD +TG SK
Sbjct  69   SSGGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLINLAKPNMVKSAVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+I+  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLRRGHDEIVETIEKRISDFTFIPVENGEGLQVLHYQ  175



>ref|XP_009344824.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=292

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 125/169 (74%), Gaps = 8/169 (5%)
 Frame = +3

Query  135  LPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQ----KAHDLSTIAHNTLE  302
            LP R TS A++   V  +L +   ++L    L I S   GS     KA+DLS+I   ++E
Sbjct  10   LPARKTSTASSTTLVLTLLVMFTFVILILLALGILSVPSGSSGSSPKANDLSSILRQSVE  69

Query  303  REEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGK  482
            R E+ E     G+ WVE ISWEPRAFVYHNFL+K ECEYLI+LAKP M KS+VVDSETGK
Sbjct  70   RNEENE----TGEQWVEAISWEPRAFVYHNFLTKEECEYLIDLAKPTMHKSSVVDSETGK  125

Query  483  SKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+DSRVRTSSGTFL RGRDKIIRNIEK+IA+FTF+P E GEGLQ+LHYE
Sbjct  126  SRDSRVRTSSGTFLVRGRDKIIRNIEKKIANFTFLPVEQGEGLQVLHYE  174



>ref|XP_002307750.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE94746.2| oxidoreductase family protein [Populus trichocarpa]
Length=288

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R L  +  S  T   ++  +L++V+ +LL  G  S+P SS  S   +DL++  
Sbjct  1    MVKVRHSR-LHTKKWSTFTLVLSMLFMLTVVLFILLGLGAFSLPVSSEDSS-PNDLNS--  56

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            +  +  E   +   ++ + W E++SWEPRAF+YHNFLSK ECEYLINLAKPHM KSTVVD
Sbjct  57   YRRIASESDGDGMGKREEQWTEILSWEPRAFLYHNFLSKEECEYLINLAKPHMMKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSG FL RG D++IR IEKRIADF+FIP EHGEGLQ+LHYE
Sbjct  117  SKTGRSKDSRVRTSSGMFLRRGLDRVIREIEKRIADFSFIPVEHGEGLQVLHYE  170



>ref|XP_010437420.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=289

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE  317
            PR+  S+   AF V  +   V+L+L+  GILS+PS +  S +  DL+T+     E E   
Sbjct  10   PRKLLSMQ--AFTVLILGLFVILILVCLGILSLPSITNNSSRPMDLTTVVQTIEESESYG  67

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            +++   GD W+EVISWEPRAFVYHNFL+  +CE+LI+LAKP M KS VVD +TGKSKDSR
Sbjct  68   DEEEGNGDRWLEVISWEPRAFVYHNFLTNEDCEHLISLAKPSMVKSKVVDVKTGKSKDSR  127

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGL +LHYE
Sbjct  128  ARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLHVLHYE  171



>ref|XP_008337965.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=291

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 15/172 (9%)
 Frame = +3

Query  135  LPRRTTSLATTAFAVFAILSLVVLMLLAFGIL------SIPSSSRGSQ-KAHDLSTIAHN  293
            LP R TS  +T      +L+L+V+   A  IL      S+PS S GS  KA+DLS+I  +
Sbjct  10   LPGRKTSSPSTTL----VLTLLVMFTFAILILLALGILSVPSGSSGSSSKANDLSSIVRH  65

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            ++E   ++      G+ WVEVISWEPRAFVYHNFL+K EC+YLI+LAKP M KSTVVDSE
Sbjct  66   SVEGNVEDG----AGEQWVEVISWEPRAFVYHNFLTKEECDYLIDLAKPTMHKSTVVDSE  121

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKSKDSRVRTSSGTFL RGRDKIIRNIEK+IA+FTF+P EHGEGLQ+LHYE
Sbjct  122  TGKSKDSRVRTSSGTFLARGRDKIIRNIEKKIANFTFLPVEHGEGLQVLHYE  173



>gb|KGN60775.1| hypothetical protein Csa_2G009620 [Cucumis sativus]
Length=259

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 112/148 (76%), Gaps = 9/148 (6%)
 Frame = +3

Query  186  ILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISW  365
            +L+L   ML+A   LS P +S      H  S++ H     +       ++GD WVE ISW
Sbjct  4    VLALGFFMLIALRFLSPPETSH-----HRFSSVRHTAFLSDGLG----KRGDQWVEFISW  54

Query  366  EPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKI  545
            EPRAFVYHNFLSK EC YLI+LAKPHM+KSTVVDS+TG+S DSRVRTSSG FL+RG+DKI
Sbjct  55   EPRAFVYHNFLSKEECLYLISLAKPHMEKSTVVDSKTGESVDSRVRTSSGMFLNRGQDKI  114

Query  546  IRNIEKRIADFTFIPAEHGEGLQILHYE  629
            IRNIEKRIADFTFIP EHGEGLQILHYE
Sbjct  115  IRNIEKRIADFTFIPIEHGEGLQILHYE  142



>ref|XP_002510597.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF52784.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=289

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   R+ ++L T  F++  +L++V+LMLLA GI S+P S+  S   +DL+  +
Sbjct  1    MAKMRHSRLQARKMSTL-TLVFSMLFMLTVVLLMLLALGIFSLPMSTDDS-PPNDLAA-S  57

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            +  +  E   +   ++ + W E+ISWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVD
Sbjct  58   YRRMAAERDYDGLGKRVEQWTEIISWEPRAFVYHNFLSKEECEYLIALAKPHMVKSTVVD  117

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TG+SKDSRVRTSSG FL RGRDKIIRNIEKRIADF+FIP EHGEGLQ+LHYE
Sbjct  118  SKTGRSKDSRVRTSSGMFLRRGRDKIIRNIEKRIADFSFIPIEHGEGLQVLHYE  171



>ref|XP_010266902.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 0/178 (0%)
 Frame = +3

Query  96   YAVTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDL  275
            +A TMAK      +P R +S  T   AV  + S V++ML   G  S P  +    K+ D+
Sbjct  14   HAATMAKKPRSSRIPNRRSSSFTLVSAVLIMFSFVLVMLFVLGFFSPPVDTDDPPKSRDM  73

Query  276  STIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
             +  H T+ER +       + + W EVISWEPRA +YHNFLSK ECE+LI+LA PH+ KS
Sbjct  74   RSFIHETVERNDAAVGLGERREQWTEVISWEPRATLYHNFLSKEECEFLISLATPHLAKS  133

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +VV+S+TGKS DS VRTS G FL RG+D+IIR IEKRIADFTFIP E+GEGLQIL YE
Sbjct  134  SVVNSKTGKSIDSGVRTSFGMFLKRGQDRIIRTIEKRIADFTFIPVENGEGLQILRYE  191



>ref|XP_007136121.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
 gb|ESW08115.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
Length=289

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFA----ILSLVVLMLLAFGILSIPSSSRGSQKAHDL  275
            MAKGK+      RT     + F++F      L+L++++LLA GI+ +P++        D 
Sbjct  1    MAKGKHAH---TRTQGKKWSTFSLFLWTLFFLTLILVVLLALGIVYLPTTE------DDF  51

Query  276  STIAHNTLEREEQE--EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQ  449
             T+     +R+  +  E  V K + W E++SWEPRAF+YHNFLSK ECEYLI LAKP+M 
Sbjct  52   PTVDLAAFKRKTSQSGESMVEKTEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPYMI  111

Query  450  KSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            KS+VVDS+TGKS +SRVRTSSG FL RGRDK++++IEKRIADFTFIP E+GEGLQILHYE
Sbjct  112  KSSVVDSKTGKSTESRVRTSSGMFLKRGRDKVVQDIEKRIADFTFIPVENGEGLQILHYE  171



>ref|XP_010266901.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Nelumbo 
nucifera]
Length=309

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 120/178 (67%), Gaps = 0/178 (0%)
 Frame = +3

Query  96   YAVTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDL  275
            +A TMAK      +P R +S  T   AV  + S V++ML   G  S P  +    K+ D+
Sbjct  14   HAATMAKKPRSSRIPNRRSSSFTLVSAVLIMFSFVLVMLFVLGFFSPPVDTDDPPKSRDM  73

Query  276  STIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
             +  H T+ER +       + + W EVISWEPRA +YHNFLSK ECE+LI+LA PH+ KS
Sbjct  74   RSFIHETVERNDAAVGLGERREQWTEVISWEPRATLYHNFLSKEECEFLISLATPHLAKS  133

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +VV+S+TGKS DS VRTS G FL RG+D+IIR IEKRIADFTFIP E+GEGLQIL YE
Sbjct  134  SVVNSKTGKSIDSGVRTSFGMFLKRGQDRIIRTIEKRIADFTFIPVENGEGLQILRYE  191



>ref|XP_003570489.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=318

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 114/168 (68%), Gaps = 14/168 (8%)
 Frame = +3

Query  168  AFAVFAILSLVVLMLLAFGILSIPSSSRG-SQKAHDLSTIAHNTLEREEQEEDDVR----  332
            A     I S  +L L+AFG+ S+P S+   +  A    T + +T E    E    R    
Sbjct  33   ALGALLIASAFLLALIAFGVFSLPVSAPNLATTAGGGETESGSTEESGGSESHSARSRAR  92

Query  333  ---------KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKS  485
                     +G  W EVISWEPRAFVYHNFLSK ECEYLI LAKP M+KSTVVDS TGKS
Sbjct  93   RDLSEGLGERGAQWTEVISWEPRAFVYHNFLSKEECEYLIGLAKPRMEKSTVVDSTTGKS  152

Query  486  KDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            KDSRVRTSSG FL RGRDK+IR IE+RIAD+TFIPAEHGEGLQ+LHYE
Sbjct  153  KDSRVRTSSGMFLRRGRDKVIRAIERRIADYTFIPAEHGEGLQVLHYE  200



>gb|ABK24739.1| unknown [Picea sitchensis]
Length=303

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (69%), Gaps = 15/187 (8%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG   + +  R+T           +LS+V+LMLLA GI+S+P +SR   +  +    +
Sbjct  1    MAKGGRPKSISGRSTFTLVLTML--LMLSIVLLMLLALGIVSLPVNSRAPDEISNGGVYS  58

Query  288  HNTLEREEQE--EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
             ++  ++ QE   + + +   W EV+SWEPRA +YHNFL+K ECEYLINLAKPHM KSTV
Sbjct  59   EHSGGKKLQETYSNGMDEPKQWAEVLSWEPRAILYHNFLNKEECEYLINLAKPHMAKSTV  118

Query  462  VDSETGKSK-----------DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEG  608
            VDS TGKSK           DSRVRTSSG FL+RG+DK IR+IEKRIADFTFIPAEHGEG
Sbjct  119  VDSATGKSKDSRFVHRWKSNDSRVRTSSGMFLNRGQDKTIRSIEKRIADFTFIPAEHGEG  178

Query  609  LQILHYE  629
            LQ+LHYE
Sbjct  179  LQVLHYE  185



>ref|XP_006285542.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
 gb|EOA18440.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
Length=293

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 128/175 (73%), Gaps = 6/175 (3%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            K K+ R  P R  SL+  AF V  ++  V+L+L+  GILS+PS  + S +  DL+TI   
Sbjct  4    KPKHLRHQPPRK-SLSMQAFTVLVLVLFVILILVGLGILSLPSIKKNSSRPMDLTTIVQT  62

Query  294  TLEREE---QEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
              E +E    EED    GD W+EVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VV
Sbjct  63   IEESKESYGDEEDG--NGDGWLEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSMVV  120

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D +TGKSKDSR RTSSGTFL RG+D+I+ +IEKRI+DFTFIP EHGEGLQ+LHYE
Sbjct  121  DVKTGKSKDSRARTSSGTFLKRGQDEIVEDIEKRISDFTFIPIEHGEGLQVLHYE  175



>ref|XP_003603827.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES74078.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=280

 Score =   190 bits (482),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 126/174 (72%), Gaps = 14/174 (8%)
 Frame = +3

Query  108  MAKGKYGRGLPR-RTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MAKGK+    PR +   L+T       +L+LV+++LLA GIL +P+++       D S I
Sbjct  1    MAKGKHTH--PRSQVKKLSTLILLTLFMLTLVIIVLLALGILYLPNTT-------DDSLI  51

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
                 +R +  E    K + W E++SWEPRAFVYHNFLSK ECE+LINLAKP + KS+VV
Sbjct  52   T----DRRKIYESLAEKKEQWTEILSWEPRAFVYHNFLSKEECEHLINLAKPFLAKSSVV  107

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            DS+TGKS +SRVRTSSG FL RG+DKII+NIE+RIADFTFIP E+GEGLQ+LHY
Sbjct  108  DSKTGKSTESRVRTSSGMFLKRGKDKIIQNIERRIADFTFIPVENGEGLQVLHY  161



>ref|XP_010437419.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=290

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 118/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE  317
            PR+  S+   AF V  +   V+L+L+  GILS+PS +  S +  DL+T+     E  E  
Sbjct  10   PRKLLSMQ--AFTVLILGLFVILILVCLGILSLPSITNNSSRPMDLTTVVQTIEESSESY  67

Query  318  EDDVR-KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDS  494
             D+    GD W+EVISWEPRAFVYHNFL+  +CE+LI+LAKP M KS VVD +TGKSKDS
Sbjct  68   GDEEEGNGDRWLEVISWEPRAFVYHNFLTNEDCEHLISLAKPSMVKSKVVDVKTGKSKDS  127

Query  495  RVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            R RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGL +LHYE
Sbjct  128  RARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLHVLHYE  172



>ref|XP_009109263.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=292

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = +3

Query  108  MAKGKYG-RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MAK  Y  R  PR+++S  T AF V  +L   +++LL  GILS+P++SR S +  DL+TI
Sbjct  1    MAKKPYHLRHQPRKSSSTTTQAFTVIILLLFFIMILLGLGILSLPNTSRNSSRPVDLTTI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
              ++ ERE    +D   GD WVEVISWEPRAF+YHNF++  ECE+LI+LAKP M+KS VV
Sbjct  61   IRDSEERESYGNED-GNGDRWVEVISWEPRAFLYHNFMTNEECEHLISLAKPSMKKSKVV  119

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D +TG SKDSRVRTSSGTFL RG+D+I+  IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  120  DVKTGGSKDSRVRTSSGTFLKRGQDEIVEEIENRISDFTFIPVENGEGLQVLHYE  174



>ref|XP_009798871.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
 ref|XP_009798872.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
Length=291

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIP-SSSRGSQKAHDLSTI  284
            MAKG+  R   +R++++      +  +  +++++L   GI ++P  S      AHD   I
Sbjct  1    MAKGRLNRNQGKRSSTVVLVLSMLLMLTVVLLMLLAL-GIFNLPVGSDDEPSSAHD--HI  57

Query  285  AHNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
                L  +  E D + ++GD W E++SWEPRAFVYHNFLSK ECEYLIN AKPHM KSTV
Sbjct  58   KFKRLSLDIGEGDGLGKRGDQWTEILSWEPRAFVYHNFLSKEECEYLINQAKPHMVKSTV  117

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TG+SKDSRVRTSSG FL RGRDK+IRNIEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  118  VDSKTGQSKDSRVRTSSGMFLRRGRDKVIRNIEKRIADYTFIPVEHGEGLQVLHYE  173



>gb|KDP36874.1| hypothetical protein JCGZ_08165 [Jatropha curcas]
Length=289

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 117/160 (73%), Gaps = 12/160 (8%)
 Frame = +3

Query  180  FAILSLVVLMLLAF----------GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDV  329
            ++ ++L++ ML             GI S+P S+  S      ++    T+ER+   ++  
Sbjct  14   WSTMTLILTMLFMLTVVLLMLLALGIFSLPISNEDSTPIDLTTSYRRMTVERDGDGQE--  71

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++ + W E++SWEPRAF+YHNFLSK ECEYLI LA+PHM KSTVVDS+TG+SKDSRVRTS
Sbjct  72   KREEQWTEIVSWEPRAFLYHNFLSKEECEYLIALARPHMVKSTVVDSKTGRSKDSRVRTS  131

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RGRDKIIRNIEKRIADF+FIP EHGEGLQILHYE
Sbjct  132  SGMFLRRGRDKIIRNIEKRIADFSFIPVEHGEGLQILHYE  171



>ref|XP_008809399.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X3 [Phoenix 
dactylifera]
Length=267

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            M +G ++ R L  R +S  T   A   +LS+V+LMLLA GI S+P +S  + K+     +
Sbjct  1    MTRGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKS-KADRV  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            +H ++   E      ++G+ W EV+SWEPRAF+YHNFLSK ECEYLI LAKPHM+KSTVV
Sbjct  60   SHISVR--ETRNGMGQRGEQWTEVLSWEPRAFIYHNFLSKEECEYLIELAKPHMEKSTVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS TG+SKDSRVRTSSG FL RG+DKIIR IEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  DSATGRSKDSRVRTSSGMFLGRGQDKIIRTIEKRIADFTFIPVEHGEGLQILHYE  172



>ref|XP_006425365.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38605.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=235

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            E D  + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVDS+TGKSKDSR
Sbjct  14   EGDEGRAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVDSDTGKSKDSR  73

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VRTSSGTFL RGRDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE
Sbjct  74   VRTSSGTFLARGRDKIIRDIEKRIADFTFLPLENGEGLQVLHYE  117



>emb|CDY24822.1| BnaA08g14880D [Brassica napus]
Length=293

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +3

Query  108  MAKGKYG-RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MAK  Y  R  PR+++S  T AF V  +L   +++LL  GILS+P++SR S +  DL+TI
Sbjct  1    MAKKPYHLRHQPRKSSSTTTQAFTVIILLLFFIMILLGLGILSLPNTSRNSSRPVDLTTI  60

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
              ++ E  E   ++   GD WVEVISWEPRAF+YHNF++  ECE+LI+LAKP M+KS VV
Sbjct  61   IRDSEESRESYGNEDGNGDRWVEVISWEPRAFLYHNFMTNEECEHLISLAKPSMKKSKVV  120

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D +TG SKDSRVRTSSGTFL RG+D+I+  IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  121  DVKTGGSKDSRVRTSSGTFLKRGQDEIVEEIENRISDFTFIPVENGEGLQVLHYE  175



>ref|XP_010940405.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=295

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 107/137 (78%), Gaps = 8/137 (6%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDS-WVEVISWEPRAFVYHNFL  398
            GI S+P  S G+ +A D+  +   + +R       +  G+  W E+ISWEPRAFV+HNFL
Sbjct  48   GIFSLPVHSDGASEATDIRRVRSISKKR-------MPGGNGQWTEIISWEPRAFVFHNFL  100

Query  399  SKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADF  578
            SK ECEYLINLAKPHM+KSTVVDS TGKSKDSRVRTSSGTFL RGRDK IR+IEKRIAD+
Sbjct  101  SKKECEYLINLAKPHMEKSTVVDSATGKSKDSRVRTSSGTFLQRGRDKTIRDIEKRIADY  160

Query  579  TFIPAEHGEGLQILHYE  629
            TFIP EHGEG Q+LHYE
Sbjct  161  TFIPVEHGEGFQVLHYE  177



>ref|XP_009121088.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=293

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V   L +V+++LL  GILS+P+++R S K +DL+ I   + E E
Sbjct  10   RYQPRKSASRSTQAFTVLIGLLVVIMILLGLGILSLPNANRNSSKPNDLTNIVRKSQE-E  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP+M KSTVVD +TG SK
Sbjct  69   RNGGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPNMVKSTVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IE+RI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLKRGHDEVVERIEQRISDFTFIPVENGEGLQVLHYQ  175



>ref|XP_007017902.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15127.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=287

 Score =   187 bits (476),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 4/135 (3%)
 Frame = +3

Query  225  ILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSK  404
            I S+P S+  S   +DL++      ER ++     ++G+ W EV+SWEPRAF+YHNFLSK
Sbjct  39   IFSLPMSTDDS-PPNDLTSYRRMASERGKELG---KRGEQWTEVLSWEPRAFIYHNFLSK  94

Query  405  YECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTF  584
             ECEYLINLAKPHM KSTVVDS+TG+SKDSRVRTSSG FL RG+DKIIR+IEKRIAD+TF
Sbjct  95   EECEYLINLAKPHMAKSTVVDSKTGRSKDSRVRTSSGMFLRRGQDKIIRDIEKRIADYTF  154

Query  585  IPAEHGEGLQILHYE  629
            IP EHGEGLQ+LHYE
Sbjct  155  IPVEHGEGLQVLHYE  169



>emb|CDY20811.1| BnaC07g06600D [Brassica napus]
Length=293

 Score =   187 bits (476),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V   L +V+++LL  GILS+P+++R S K +DL+ I   + E E
Sbjct  10   RYQPRKSASRSTQAFTVLIGLLVVIMILLGLGILSLPNANRNSSKPNDLTNIVRKSQE-E  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP+M KSTVVD +TG SK
Sbjct  69   SNGGDEEGNGERWVEVISWEPRAVVYHNFLTNDECEHLISLAKPNMVKSTVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IE+RI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLKRGHDEVVERIEQRISDFTFIPVENGEGLQVLHYQ  175



>ref|XP_008456352.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456362.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456370.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=284

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 120/175 (69%), Gaps = 9/175 (5%)
 Frame = +3

Query  102  VTMAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            + ++ GKY +   ++ ++   +   +  +L+L   ML A    S P +S      H LS+
Sbjct  1    MAVSIGKYIKLQGKKWSTFQLSKMIMALVLALGFFMLSALWFFSPPETSH-----HRLSS  55

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            + H     +       ++GD WVE ISWEPRAFVYHNFLSK EC YLI+LAKPHM+KSTV
Sbjct  56   VRHTAFLSDGLG----KRGDQWVEFISWEPRAFVYHNFLSKEECLYLISLAKPHMEKSTV  111

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            VDSETGKS DS VRTSSG FL+RG+DKII NIEKRIADFTFIP EHGE +QILHY
Sbjct  112  VDSETGKSVDSSVRTSSGMFLNRGQDKIISNIEKRIADFTFIPIEHGEDIQILHY  166



>emb|CDY24364.1| BnaA07g02890D [Brassica napus]
Length=293

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V   L +V+++LL  GILS+P+++R S K +DL+ I   + E E
Sbjct  10   RYQPRKSASRSTQAFTVLIGLLVVIMILLGLGILSLPNANRNSSKPNDLTNIVRKSQE-E  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP+M KSTVVD +TG SK
Sbjct  69   RNGGDEEGNGERWVEVISWEPRAVVYHNFLTNDECEHLISLAKPNMVKSTVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IE+RI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLKRGHDEVVERIEQRISDFTFIPVENGEGLQVLHYQ  175



>ref|XP_007156206.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 ref|XP_007156207.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28200.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28201.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
Length=289

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 4/130 (3%)
 Frame = +3

Query  240  SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEY  419
            +SS    K +DL++IA NT      +EDD  +G+SWVE+ISWEPRAF+YHNFL+K ECE+
Sbjct  46   NSSNALSKPNDLTSIARNT---HVTQEDD-SQGESWVEIISWEPRAFIYHNFLTKEECEH  101

Query  420  LINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEH  599
            LIN+AKP+M+KS VVDSETGKS DSRVRTSSG FL RGRD+++R+IEKRI+D TFIP EH
Sbjct  102  LINIAKPNMRKSAVVDSETGKSMDSRVRTSSGAFLARGRDQVVRDIEKRISDLTFIPVEH  161

Query  600  GEGLQILHYE  629
            GEGLQ+LHYE
Sbjct  162  GEGLQVLHYE  171



>ref|XP_007017904.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY15129.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
Length=284

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 109/135 (81%), Gaps = 4/135 (3%)
 Frame = +3

Query  225  ILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSK  404
            I S+P S+  S   +DL++      ER ++     ++G+ W EV+SWEPRAF+YHNFLSK
Sbjct  39   IFSLPMSTDDS-PPNDLTSYRRMASERGKELG---KRGEQWTEVLSWEPRAFIYHNFLSK  94

Query  405  YECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTF  584
             ECEYLINLAKPHM KSTVVDS+TG+SKDSRVRTSSG FL RG+DKIIR+IEKRIAD+TF
Sbjct  95   EECEYLINLAKPHMAKSTVVDSKTGRSKDSRVRTSSGMFLRRGQDKIIRDIEKRIADYTF  154

Query  585  IPAEHGEGLQILHYE  629
            IP EHGEGLQ+LHYE
Sbjct  155  IPVEHGEGLQVLHYE  169



>dbj|BAK01841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=315

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 107/151 (71%), Gaps = 15/151 (10%)
 Frame = +3

Query  219  FGILSIP--------------SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEV  356
            FG+ S+P              SS  G + A + S  A N   R+  E    R G  W EV
Sbjct  48   FGVFSLPVSSPTVPTTGAETESSGGGGEAASESSRPARNRGRRDLSEGLGER-GAQWTEV  106

Query  357  ISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGR  536
            ISWEPRAFVYHNFLSK ECEYLI LAKP M KSTVVDSETGKSKDSRVRTSSG FL RGR
Sbjct  107  ISWEPRAFVYHNFLSKEECEYLIELAKPRMVKSTVVDSETGKSKDSRVRTSSGMFLQRGR  166

Query  537  DKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DK+IR IE+RIAD+TFIPAEHGEGLQ+LHYE
Sbjct  167  DKVIRAIERRIADYTFIPAEHGEGLQVLHYE  197



>gb|KDO71354.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=235

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            E D  + + WVEVISWEPRAFVYHNFLSK ECEYLINLA PHM+KSTVVDS+TGKSKDSR
Sbjct  14   EGDEGRAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVDSDTGKSKDSR  73

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VRTSSGTFL RGRDKIIR+IEKRIADFTF P E+GEGLQ+LHYE
Sbjct  74   VRTSSGTFLARGRDKIIRDIEKRIADFTFFPLENGEGLQVLHYE  117



>ref|XP_008809395.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809396.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809397.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=290

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            M +G ++ R L  R +S  T   A   +LS+V+LMLLA GI S+P +S  + K+     +
Sbjct  1    MTRGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKS-KADRV  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            +H ++   E      ++G+ W EV+SWEPRAF+YHNFLSK ECEYLI LAKPHM+KSTVV
Sbjct  60   SHISVR--ETRNGMGQRGEQWTEVLSWEPRAFIYHNFLSKEECEYLIELAKPHMEKSTVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS TG+SKDSRVRTSSG FL RG+DKIIR IEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  DSATGRSKDSRVRTSSGMFLGRGQDKIIRTIEKRIADFTFIPVEHGEGLQILHYE  172



>ref|XP_009620049.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana tomentosiformis]
Length=291

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIP-SSSRGSQKAHDLSTI  284
            MAKG+  R   +R++++      +  +  +++++L   GI ++P  S      AHD   I
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLAL-GIFNLPVGSDDEPSSAHD--HI  57

Query  285  AHNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
                L  +  E D +  +GD W E++SWEPRAFVYHNFLSK ECEYLIN AKPHM KSTV
Sbjct  58   KFKRLSLDIGEGDGLGERGDQWTEILSWEPRAFVYHNFLSKEECEYLINQAKPHMVKSTV  117

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TG+SKDSRVRTSSG FL RGRDK+IRNIEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  118  VDSKTGQSKDSRVRTSSGMFLRRGRDKVIRNIEKRIADYTFIPVEHGEGLQVLHYE  173



>gb|KHG08442.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=296

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   ++  ++ T   ++  +L++V+LMLL  GI S+P ++  S   +DL++  
Sbjct  1    MAKVRHSRFTAKKRLTV-TLVLSILFMLTIVLLMLLGLGIFSLPMTTDDSS-LYDLTSYR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER         +G+ W +V+SWEPRA +YHNFLSK ECEYLI +AKP M+KS+VVD
Sbjct  59   RMASERGRLGN----RGEKWTQVLSWEPRASIYHNFLSKEECEYLIKIAKPFMKKSSVVD  114

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSG FL RG+DKII +IEKRIA+++FIP EHGEGLQ+LHYE
Sbjct  115  SKTGKSKDSRVRTSSGMFLKRGQDKIISDIEKRIAEYSFIPIEHGEGLQVLHYE  168



>ref|XP_011083428.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083429.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083430.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083431.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=292

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++GD W E++SWEPRAF+YHNFLSK ECEY+INLAKPHM KSTVVDS+TGKSKDSRVRTS
Sbjct  75   KRGDQWTEILSWEPRAFLYHNFLSKEECEYMINLAKPHMTKSTVVDSKTGKSKDSRVRTS  134

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RGRDK+IR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  135  SGMFLRRGRDKVIRDIEKRIADFTFIPVEHGEGLQVLHYE  174



>ref|XP_006342080.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=292

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+  R   +R++++      +  +  +++++L   GI ++P  S     +     I 
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLAL-GIFNLPVGSDDESSSTAQDHIK  59

Query  288  HNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
                  +  E D + ++G+ W E++SWEPRAFVYHNFLSK ECEYLIN AKPHM KS+VV
Sbjct  60   FKRFNLDIGEGDGLGKRGEQWTEILSWEPRAFVYHNFLSKEECEYLINQAKPHMVKSSVV  119

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TG+SKDSRVRTSSG FL RGRDKIIRNIEKRIAD+TFIPAEHGEGLQ+LHYE
Sbjct  120  DSKTGQSKDSRVRTSSGMFLRRGRDKIIRNIEKRIADYTFIPAEHGEGLQVLHYE  174



>gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea]
Length=283

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            +G  W E+ISWEPRAFVYHNFLSK ECEYLIN+AKPHMQKSTVVDS+TGKSKDSRVRTSS
Sbjct  70   RGQQWTEIISWEPRAFVYHNFLSKEECEYLINVAKPHMQKSTVVDSKTGKSKDSRVRTSS  129

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RGRD +IR+IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  130  GMFLRRGRDAVIRDIEKRIADFTFIPVEHGEGLQVLHYE  168



>ref|XP_004954469.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=311

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 109/157 (69%), Gaps = 10/157 (6%)
 Frame = +3

Query  189  LSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE----------EDDVRKG  338
            +S  +L L+AFG+ S+P S+  +   +        T   + +           E    +G
Sbjct  37   VSAFLLALIAFGVFSLPVSAPNAATTNAAGAGGGETESADARPARPRPRRDLGEGLGERG  96

Query  339  DSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGT  518
              W EVISWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSSG 
Sbjct  97   AQWTEVISWEPRAFVYHNFLSKEECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGM  156

Query  519  FLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            FL RGRDK+IR IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  157  FLQRGRDKVIRTIEKRIADFTFIPVEHGEGLQVLHYE  193



>gb|KJB29665.1| hypothetical protein B456_005G112700 [Gossypium raimondii]
Length=286

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 6/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R   ++  ++ T   ++  +L++V+LMLL  GI S+P ++  S  ++DL++  
Sbjct  1    MAKVRHSRFTAKKRLTV-TLVLSILFMLTIVLLMLLGLGIFSLPMTTDDSS-SYDLTSYR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER         + + W EV+SWEPRA +YHNFLSK ECEYLI +AKP M+KS+VVD
Sbjct  59   RMASERGRLGN----RREKWTEVLSWEPRASIYHNFLSKEECEYLIKIAKPFMKKSSVVD  114

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSG FL RG+DKII +IEKRIA+++FIP EHGEGLQ+LHYE
Sbjct  115  SKTGKSKDSRVRTSSGMFLKRGQDKIISDIEKRIAEYSFIPIEHGEGLQVLHYE  168



>ref|XP_004238387.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Solanum lycopersicum]
Length=292

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+  R   +R++++      +  +  +++++L   GI ++P  S     +     I 
Sbjct  1    MAKGRLNRHQGKRSSTVVLVLSMLLMLTVVLLMLLAL-GIFNLPVGSDDESSSTVQDHIK  59

Query  288  HNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
                  +  E D + ++G+ W E++SWEPRAFVYHNFLSK ECEYLIN AKPHM KS+VV
Sbjct  60   FKRFNLDIGEGDGLGKRGEQWTEILSWEPRAFVYHNFLSKEECEYLINQAKPHMVKSSVV  119

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS+TG+SKDSRVRTSSG FL RGRDKIIRNIEKRIAD+TFIPAEHGEGLQ+LHYE
Sbjct  120  DSKTGQSKDSRVRTSSGMFLRRGRDKIIRNIEKRIADYTFIPAEHGEGLQVLHYE  174



>ref|XP_008809398.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=289

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 133/176 (76%), Gaps = 7/176 (4%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            M +G ++ R L  R +S  T   A   +LS+V+LMLLA GI S+P +S  + K+     +
Sbjct  1    MTRGARHNRVLSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKS-KADRV  59

Query  285  AHNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
            +H ++    +E + + ++G+ W EV+SWEPRAF+YHNFLSK ECEYLI LAKPHM+KSTV
Sbjct  60   SHISV----RETNGMGQRGEQWTEVLSWEPRAFIYHNFLSKEECEYLIELAKPHMEKSTV  115

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS TG+SKDSRVRTSSG FL RG+DKIIR IEKRIADFTFIP EHGEGLQILHYE
Sbjct  116  VDSATGRSKDSRVRTSSGMFLGRGQDKIIRTIEKRIADFTFIPVEHGEGLQILHYE  171



>ref|XP_004139389.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 118/170 (69%), Gaps = 9/170 (5%)
 Frame = +3

Query  120  KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTL  299
            KY +   ++ ++   +   +  +L+L   ML+A   LS P +S      H  S++ H   
Sbjct  7    KYIKLQGKKWSTFQLSKMIMALVLALGFFMLIALRFLSPPETSH-----HRFSSVRHTAF  61

Query  300  EREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETG  479
              +       ++GD WVE ISWEPRAFVYHNFLSK EC YLI+LAKPHM+KSTVVD+ETG
Sbjct  62   LSDGLG----KRGDQWVEFISWEPRAFVYHNFLSKEECLYLISLAKPHMEKSTVVDNETG  117

Query  480  KSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            K+ +  VRTSSG FL+RG+DKI+ NIEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  KNVEDSVRTSSGMFLNRGQDKIVSNIEKRIADFTFIPIEHGEGLQILHYE  167



>ref|XP_011014780.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=291

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  QKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAK  437
            +KA+DLS+IAHN+  +  +  DD  K + WVEV+SWEPRAF+YHNFL+K EC+YLINLAK
Sbjct  52   RKANDLSSIAHNS--KIHESGDDEGKAEQWVEVVSWEPRAFIYHNFLTKAECDYLINLAK  109

Query  438  PHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQI  617
            PHMQKS VVDS +GKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADF+FIPAEHGEGLQI
Sbjct  110  PHMQKSMVVDSSSGKSKDSRVRTSSGTFLPRGRDKIIRDIEKRIADFSFIPAEHGEGLQI  169

Query  618  LHYE  629
            LHYE
Sbjct  170  LHYE  173



>ref|XP_008778312.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=308

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLS  401
            GI S+P  S  + +A D+  +     +          +G  W EVISWEPRA V+HNFLS
Sbjct  48   GIFSLPVHSDSAPEAADIHRVRSVYKKTMTDGNGLGNRGAQWAEVISWEPRASVFHNFLS  107

Query  402  KYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFT  581
            + ECEY+INLAKPHM+KSTVVDS TGKSKDSRVRTSSGTFL RGRDKIIR IEKRIAD+T
Sbjct  108  REECEYIINLAKPHMEKSTVVDSATGKSKDSRVRTSSGTFLQRGRDKIIRAIEKRIADYT  167

Query  582  FIPAEHGEGLQILHYE  629
            FIP EHGEGLQ+LHYE
Sbjct  168  FIPVEHGEGLQVLHYE  183



>ref|XP_008778322.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=301

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLS  401
            GI S+P  S  + +A D+  +     +          +G  W EVISWEPRA V+HNFLS
Sbjct  48   GIFSLPVHSDSAPEAADIHRVRSVYKKTMTDGNGLGNRGAQWAEVISWEPRASVFHNFLS  107

Query  402  KYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFT  581
            + ECEY+INLAKPHM+KSTVVDS TGKSKDSRVRTSSGTFL RGRDKIIR IEKRIAD+T
Sbjct  108  REECEYIINLAKPHMEKSTVVDSATGKSKDSRVRTSSGTFLQRGRDKIIRAIEKRIADYT  167

Query  582  FIPAEHGEGLQILHYE  629
            FIP EHGEGLQ+LHYE
Sbjct  168  FIPVEHGEGLQVLHYE  183



>ref|NP_195306.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEE86574.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=290

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 125/172 (73%), Gaps = 2/172 (1%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            K K  R  PR+  S +T  F V  ++  V+L+L+  GI S+PS+++ S    DL+TI   
Sbjct  4    KPKQLRNKPRK--SFSTQTFTVVVLVLFVILILVGLGIFSLPSTNKTSSMPMDLTTIVQT  61

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
              ERE   +++   GD W+EVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +
Sbjct  62   IQERESFGDEEDGNGDRWLEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVK  121

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKS DSRVRTSSGTFL+RG D+I+  IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  122  TGKSIDSRVRTSSGTFLNRGHDEIVEEIENRISDFTFIPPENGEGLQVLHYE  173



>gb|KHN09058.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja]
Length=290

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  MAKGKYG--RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            MAKGK+   R   ++ ++ +   +A+F  L+L++++LLA GI+ +  ++       DLS 
Sbjct  1    MAKGKHTHTRAQGKKWSTFSLVLWALF-FLTLILVVLLALGIVYL-PTTDDDFPTTDLSA  58

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
                T +  E   ++    + W E++SWEPRAF+YHNFLSK ECEYLI LAKP M KS+V
Sbjct  59   FRRKTSQSAESLVEN--PPEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPQMAKSSV  116

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKS +SRVRTSSG FL RGRDKI++NIEKRIADFTFIP E+GEGLQILHYE
Sbjct  117  VDSKTGKSTESRVRTSSGMFLKRGRDKIVQNIEKRIADFTFIPEENGEGLQILHYE  172



>ref|XP_010667434.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667436.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = +3

Query  237  PSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECE  416
            P +S   + AHDLS      LER +      ++ + WVE++SWEPRAF+YH+FLSK EC+
Sbjct  40   PVTSDDHRPAHDLSNFGRKVLERGKGIG---KRDEQWVEILSWEPRAFLYHHFLSKEECD  96

Query  417  YLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAE  596
            YLI+LA PHM KSTVVDS+TG+SKDSRVRTSSG FL RG+DKIIR+IEKRIADFTFIP E
Sbjct  97   YLIDLATPHMVKSTVVDSKTGRSKDSRVRTSSGMFLRRGQDKIIRDIEKRIADFTFIPVE  156

Query  597  HGEGLQILHYE  629
            HGEGLQILHYE
Sbjct  157  HGEGLQILHYE  167



>gb|KHG14293.1| Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=287

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 130/174 (75%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAK ++ R L  R  S  T   ++  +LS+V+LMLL  GI S+P ++  S   +DL++  
Sbjct  1    MAKVRHSR-LQARKWSTVTLVLSMLFMLSVVLLMLLGLGIFSLPINNDDSA-PNDLTSYR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                ER +      ++G+ W EV+SWEPRAF+YHNFLSK ECEYLINLAKPHM KSTVVD
Sbjct  59   RMASERGKGLG---KRGEQWTEVLSWEPRAFIYHNFLSKEECEYLINLAKPHMVKSTVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S+TGKSKDSRVRTSSG FL RG+DKIIR+IE RIAD++FIP EHGEGLQ+LHYE
Sbjct  116  SKTGKSKDSRVRTSSGMFLRRGQDKIIRDIENRIADYSFIPVEHGEGLQVLHYE  169



>ref|XP_010918436.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918437.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
Length=290

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            M +G ++ R    R +S  T   A   +LS+V+LMLLA GI S+P +S  + K+    ++
Sbjct  1    MTRGARHSRVFSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKS-KADSV  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            +H ++   E      ++G+ W EV+SWEPRAF+YH+FLSK ECEYLI LAKPHM+KSTVV
Sbjct  60   SHISIP--ETRNGMGQRGEQWTEVLSWEPRAFIYHHFLSKEECEYLIELAKPHMEKSTVV  117

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS TG+SKDSRVRTSSG FL RG+DKII+ IEKRIADFTFIP EHGEGLQILHYE
Sbjct  118  DSATGRSKDSRVRTSSGMFLRRGQDKIIQTIEKRIADFTFIPVEHGEGLQILHYE  172



>gb|KDO75956.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=164

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R   ++ ++L T   ++  +L++V+LMLLA GI  IP     S   +DL++  
Sbjct  1    MVKLRHSRLQAKKWSTL-TLVLSMLFMLTIVLLMLLAMGIFYIPIGDDDSP-PNDLTSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
                E+     ++  KG+ W E+++WEPRAFVYHNFLSK ECEYLI+LAKP+M KSTVVD
Sbjct  59   RRAFEKRSSIAEE--KGEQWTEIVAWEPRAFVYHNFLSKAECEYLIDLAKPYMVKSTVVD  116

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQ  614
            S+TG+SKDSRVRTSSGTFL RG+D+IIR IEKRIADFTFIP   GE L+
Sbjct  117  SKTGQSKDSRVRTSSGTFLKRGQDRIIRGIEKRIADFTFIPM--GEYLK  163



>ref|XP_006648159.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Oryza brachyantha]
Length=306

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = +3

Query  219  FGILSIPSSSRG---SQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYH  389
            FG+ S+P S+     +    D       T  R +  E    +G  W EVISWEPRAFVYH
Sbjct  49   FGVFSLPVSAPNAATTDAGGDADPRPARTRARRDLSEGLGERGAQWTEVISWEPRAFVYH  108

Query  390  NFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRI  569
            NFLSK EC+YLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGRDK+IR IEKRI
Sbjct  109  NFLSKEECDYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRDKVIRAIEKRI  168

Query  570  ADFTFIPAEHGEGLQILHYE  629
            AD+TFIP EHGEGLQ+LHYE
Sbjct  169  ADYTFIPMEHGEGLQVLHYE  188



>gb|KJB59734.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=294

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++G+ W EV+SWEPRAF+YHNFLSK ECEYLINLAKPHM KSTVVDS+TGKSKDSRVRTS
Sbjct  70   KRGEQWTEVLSWEPRAFIYHNFLSKEECEYLINLAKPHMVKSTVVDSKTGKSKDSRVRTS  129

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RG+DKII++IEKRIAD++FIP EHGEGLQ+LHYE
Sbjct  130  SGMFLRRGQDKIIKDIEKRIADYSFIPVEHGEGLQVLHYE  169



>gb|KJB59733.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=287

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++G+ W EV+SWEPRAF+YHNFLSK ECEYLINLAKPHM KSTVVDS+TGKSKDSRVRTS
Sbjct  70   KRGEQWTEVLSWEPRAFIYHNFLSKEECEYLINLAKPHMVKSTVVDSKTGKSKDSRVRTS  129

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RG+DKII++IEKRIAD++FIP EHGEGLQ+LHYE
Sbjct  130  SGMFLRRGQDKIIKDIEKRIADYSFIPVEHGEGLQVLHYE  169



>emb|CDY29194.1| BnaA06g25630D [Brassica napus]
Length=293

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+ +S +T AF V  +L +V+++LL  GILS+P+++R S K +DL+ I H + E +
Sbjct  10   RYQPRKASSRSTQAFTVIILLLVVIMILLGLGILSLPNANRNSSKPNDLTNIIHKSQE-Q  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LINLAKP+M KS VVD +TG SK
Sbjct  69   SSGGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLINLAKPNMVKSAVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLRRGHDEVVETIEKRISDFTFIPVENGEGLQVLHYQ  175



>ref|XP_006581148.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X1 [Glycine 
max]
 ref|XP_006581149.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X2 [Glycine 
max]
 ref|XP_006581150.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X3 [Glycine 
max]
 ref|XP_006581151.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X4 [Glycine 
max]
Length=290

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  MAKGKYG--RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLST  281
            MAKGK+   R   ++ ++ +   +A+F  L+L++++LLA GI+ +  ++       DLS 
Sbjct  1    MAKGKHTHTRAQGKKWSTFSLVLWALF-FLTLILVVLLALGIVYL-PTTDDDFPTTDLSA  58

Query  282  IAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTV  461
                T +  E   ++    + W E++SWEPRAF+YHNFLSK ECEYLI LAKP M KS+V
Sbjct  59   FRRKTSQSAESLVEN--PPEQWTEILSWEPRAFIYHNFLSKEECEYLIELAKPQMVKSSV  116

Query  462  VDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VDS+TGKS +SRVRTSSG FL RG+DKI++NIEKRIADFTFIP E+GEGLQILHYE
Sbjct  117  VDSKTGKSTESRVRTSSGMFLKRGKDKIVQNIEKRIADFTFIPEENGEGLQILHYE  172



>gb|AFW63914.1| hypothetical protein ZEAMMB73_179176 [Zea mays]
Length=222

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            +G  W EVISWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSS
Sbjct  92   RGAQWTEVISWEPRAFVYHNFLSKEECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSS  151

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RGRDK+IR IEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  152  GMFLQRGRDKVIRVIEKRIADYTFIPVDHGEGLQVLHYE  190



>dbj|BAD23054.1| putative prolyl 4-hydroxylase [Oryza sativa Japonica Group]
Length=310

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +3

Query  213  LAFGILSIP---------SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISW  365
            +AFG+ S+P          S+     A         T  R +  E    +G  W EVISW
Sbjct  45   IAFGVFSLPVSAPNAATTDSAAAGGDAEPADPRPPRTRARRDLSEGLGERGAQWTEVISW  104

Query  366  EPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKI  545
            EPRAFVYHNFLSK EC+YLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGRDK+
Sbjct  105  EPRAFVYHNFLSKEECDYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRDKV  164

Query  546  IRNIEKRIADFTFIPAEHGEGLQILHYE  629
            IR IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  165  IRAIEKRIADYTFIPMEHGEGLQVLHYE  192



>gb|KCW68010.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=235

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  252  GSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINL  431
            G   A+  S+    T ER +      ++G+ W EV+SWEPRAF+YH FLS+ ECEYLI+L
Sbjct  81   GDAPANGWSSFRRRTFERGDGLG---QRGEQWTEVLSWEPRAFIYHGFLSREECEYLISL  137

Query  432  AKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGL  611
            AKP M KSTVVDS TGKSKDSRVRTSSGTFL RG DKIIR+IEKRIADFTFIP EHGEGL
Sbjct  138  AKPRMAKSTVVDSTTGKSKDSRVRTSSGTFLQRGGDKIIRDIEKRIADFTFIPVEHGEGL  197

Query  612  QILHYE  629
            Q+LHYE
Sbjct  198  QVLHYE  203



>ref|XP_011074717.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011074718.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=289

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            T++ +++ E    + + W EV+SWEPRAF+YHNFLSK ECEYLINLA+PHM KSTVVDS+
Sbjct  63   TIDIKDEGEGLGERREQWTEVLSWEPRAFLYHNFLSKEECEYLINLARPHMVKSTVVDSK  122

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TGKSKDSRVRTSSG FL RGRDK+IR+IEKRIAD+TFIPAEHGEGLQ+LHYE
Sbjct  123  TGKSKDSRVRTSSGMFLRRGRDKVIRDIEKRIADYTFIPAEHGEGLQVLHYE  174



>ref|XP_010918438.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Elaeis 
guineensis]
Length=289

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            M +G ++ R    R +S  T   A   +LS+V+LMLLA GI S+P +S  + K+    ++
Sbjct  1    MTRGARHSRVFSGRRSSPYTLILAALLMLSVVLLMLLALGIFSLPVNSNDAPKS-KADSV  59

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            +H ++    +     ++G+ W EV+SWEPRAF+YH+FLSK ECEYLI LAKPHM+KSTVV
Sbjct  60   SHISIP---ETNGMGQRGEQWTEVLSWEPRAFIYHHFLSKEECEYLIELAKPHMEKSTVV  116

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DS TG+SKDSRVRTSSG FL RG+DKII+ IEKRIADFTFIP EHGEGLQILHYE
Sbjct  117  DSATGRSKDSRVRTSSGMFLRRGQDKIIQTIEKRIADFTFIPVEHGEGLQILHYE  171



>ref|XP_002453082.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
 gb|EES06058.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
Length=307

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            +G  W EVISWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSS
Sbjct  91   RGAQWTEVISWEPRAFVYHNFLSKEECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSS  150

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RGRDK+IR IEKRIAD+TFIPA+HGEGLQ+LHYE
Sbjct  151  GMFLQRGRDKVIRAIEKRIADYTFIPADHGEGLQVLHYE  189



>ref|XP_002884079.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60338.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I   +   E
Sbjct  10   RYQPRKSVSRSTQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVRKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFLS  ECE+LINLAKP M KSTVVD +TG SK
Sbjct  67   TSYGDEDGNGERWVEVISWEPRAVVYHNFLSNEECEHLINLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>ref|XP_008347372.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=167

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKG+YGR L  +  S      ++  +LS+V+LMLLAFG +S+P S+  S   +DLS+  
Sbjct  1    MAKGRYGR-LQSKKWSTFMLVLSMLLMLSVVLLMLLAFGTVSLPVSTDDSS-PNDLSSFR  58

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              T+ER +   + V   + W EVISWEPRAFVYHNFLSK EC+YLINLAKPHM KS+VVD
Sbjct  59   RKTVERGDGLGNRV---EQWTEVISWEPRAFVYHNFLSKEECDYLINLAKPHMVKSSVVD  115

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEH  599
            S+TGKSKDSRVRTSSG FL RGRDKIIR+IEKRIADFTFIP + 
Sbjct  116  SKTGKSKDSRVRTSSGMFLKRGRDKIIRDIEKRIADFTFIPGKE  159



>gb|EEE58093.1| hypothetical protein OsJ_08962 [Oryza sativa Japonica Group]
Length=387

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +3

Query  213  LAFGILSIP---------SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISW  365
            +AFG+ S+P          S+     A         T  R +  E    +G  W EVISW
Sbjct  45   IAFGVFSLPVSAPNAATTDSAAAGGDAEPADPRPPRTRARRDLSEGLGERGAQWTEVISW  104

Query  366  EPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKI  545
            EPRAFVYHNFLSK EC+YLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGRDK+
Sbjct  105  EPRAFVYHNFLSKEECDYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRDKV  164

Query  546  IRNIEKRIADFTFIPAEHGEGLQILHYE  629
            IR IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  165  IRAIEKRIADYTFIPMEHGEGLQVLHYE  192



>ref|XP_009150771.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X2 [Brassica rapa]
Length=292

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+ +S +T AF V  +L +V+++LL  GILS+P+++R S K +DL+ I   + E+ 
Sbjct  10   RYQPRKASSRSTQAFTVIILLLVVIMILLGLGILSLPNANRNSSKPNDLTNIVRKSQEQS  69

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
              +E+    G+ WVEVISWEPRA VYHNFL+  ECE+LINLAKP+M KS VVD +TG SK
Sbjct  70   GGDEEG--NGERWVEVISWEPRAVVYHNFLTNEECEHLINLAKPNMVKSAVVDEKTGGSK  127

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  128  DSRVRTSSGTFLRRGHDEVVETIEKRISDFTFIPVENGEGLQVLHYQ  174



>ref|XP_004167095.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=249

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 105/141 (74%), Gaps = 9/141 (6%)
 Frame = +3

Query  207  MLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVY  386
            ML+A   LS P +S      H  S++ H     +       ++GD WVE ISWEPRAFVY
Sbjct  1    MLIALRFLSPPETSH-----HRFSSVRHTAFLSDGLG----KRGDQWVEFISWEPRAFVY  51

Query  387  HNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKR  566
            HNFLSK EC YLI+LAKPHM+KSTVVD+ETGK+ +  VRTSSG FL+RG+DKI+ NIEKR
Sbjct  52   HNFLSKEECLYLISLAKPHMEKSTVVDNETGKNVEDSVRTSSGMFLNRGQDKIVSNIEKR  111

Query  567  IADFTFIPAEHGEGLQILHYE  629
            IADFTFIP EHGEGLQILHYE
Sbjct  112  IADFTFIPIEHGEGLQILHYE  132



>ref|XP_010539828.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539829.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539830.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
Length=288

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLS  401
            GI S+P +   S   +  ++      ER E  E   ++G+ + EV+SWEPRAFVYHNFLS
Sbjct  38   GIFSLPVNDDESSSIYLSTSYRRMAAERGEGIE---KRGEQYTEVLSWEPRAFVYHNFLS  94

Query  402  KYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFT  581
            K ECEYLI+LAKP M KS+VVDS+TGKSKDSRVRTSSGTFL RG+DKIIR+IEKRIAD+T
Sbjct  95   KEECEYLIDLAKPRMVKSSVVDSKTGKSKDSRVRTSSGTFLRRGKDKIIRDIEKRIADYT  154

Query  582  FIPAEHGEGLQILHYE  629
            FIP E+GEGLQ+LHYE
Sbjct  155  FIPVENGEGLQVLHYE  170



>ref|XP_006409254.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
 gb|ESQ50707.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
Length=290

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            K K  R  PR+++S +T AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I   
Sbjct  4    KSKNLRYQPRKSSSRSTQAFTVLILLLVVILILLGLGILSLPNANRNSSKPNDLTNIVRK  63

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
            + E    EE +    + WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +
Sbjct  64   SGESYGDEEGN---NERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEK  120

Query  474  TGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            TG SKDSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  121  TGGSKDSRVRTSSGTFLRRGHDEVVETIEKRISDFTFIPVENGEGLQVLHYQ  172



>ref|XP_009392830.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392831.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 107/138 (78%), Gaps = 7/138 (5%)
 Frame = +3

Query  222  GILSIP-SSSRGSQKAHDLSTIAHNTLEREEQEEDDV-RKGDSWVEVISWEPRAFVYHNF  395
            GI S+P SS  G +   DL   A     R  ++ D + ++G  W EVISWEPRAFVYHNF
Sbjct  51   GIFSLPVSSDSGPESEADLRHHA-----RSLRDADGLGQRGQQWTEVISWEPRAFVYHNF  105

Query  396  LSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIAD  575
            LSK ECEYLI LAKPHMQKS+VVDS TGKSKDSRVRTS+G FL RG+DKIIR IEKRI+D
Sbjct  106  LSKEECEYLIELAKPHMQKSSVVDSTTGKSKDSRVRTSTGMFLPRGQDKIIRVIEKRISD  165

Query  576  FTFIPAEHGEGLQILHYE  629
            +TFIP E+GEGLQ+LHYE
Sbjct  166  YTFIPVENGEGLQVLHYE  183



>ref|XP_010489402.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+T S +  AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I H +   E
Sbjct  10   RYQPRKTPSRSIQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVHKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +TG SK
Sbjct  67   TSYGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>ref|XP_010514697.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=291

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+T S +  AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I H +   E
Sbjct  10   RYQPRKTPSRSIQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVHKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +TG SK
Sbjct  67   TSYGDEGGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>ref|XP_006380560.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
 gb|ERP58357.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
Length=287

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 2/124 (2%)
 Frame = +3

Query  258  QKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAK  437
            +KA+DLS+IAHN+  +  +  DD  K + WVE ISWEPRAF+YHNFL+K EC+YLINLAK
Sbjct  48   RKANDLSSIAHNS--KIHESGDDEGKAEQWVEAISWEPRAFIYHNFLTKAECDYLINLAK  105

Query  438  PHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQI  617
            PHMQKS VVDS +GKSKDSRVRTSSGTFL RGRDKIIR+IEKRIADF+FIP+EHGEGLQI
Sbjct  106  PHMQKSMVVDSSSGKSKDSRVRTSSGTFLPRGRDKIIRDIEKRIADFSFIPSEHGEGLQI  165

Query  618  LHYE  629
            LHYE
Sbjct  166  LHYE  169



>ref|NP_001241695.1| prolyl 4-hydroxylase 8-5 [Zea mays]
 gb|AEP37762.1| prolyl 4-hydroxylase 8-5 [Zea mays]
Length=307

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 103/150 (69%), Gaps = 20/150 (13%)
 Frame = +3

Query  219  FGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVR-------------KGDSWVEVI  359
            FG+ S+P S+  +      +          E E  DVR             +G  W EVI
Sbjct  47   FGVFSLPVSAPNAAATTGTAAGG-------ETESADVRPRARRDLGEGLGERGAQWTEVI  99

Query  360  SWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRD  539
            SWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGRD
Sbjct  100  SWEPRAFVYHNFLSKDECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRD  159

Query  540  KIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            K+IR IEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  160  KVIRAIEKRIADYTFIPVDHGEGLQVLHYE  189



>ref|XP_009150770.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X1 [Brassica rapa]
Length=293

 Score =   180 bits (457),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR+ +S +T AF V  +L +V+++LL  GILS+P+++R S K +DL+ I   + E +
Sbjct  10   RYQPRKASSRSTQAFTVIILLLVVIMILLGLGILSLPNANRNSSKPNDLTNIVRKSQE-Q  68

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LINLAKP+M KS VVD +TG SK
Sbjct  69   SSGGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLINLAKPNMVKSAVVDEKTGGSK  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  129  DSRVRTSSGTFLRRGHDEVVETIEKRISDFTFIPVENGEGLQVLHYQ  175



>ref|NP_001159002.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
 ref|XP_008643888.1| PREDICTED: prolyl 4-hydroxylase alpha-2 subunit isoform X1 [Zea 
mays]
 gb|ACG35031.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37757.1| prolyl 4-hydroxylase 8 [Zea mays]
 gb|AEP37758.1| prolyl 4-hydroxylase 8-1 [Zea mays]
 gb|AFW74120.1| prolyl 4-hydroxylase alpha-2 subunit isoform 1 [Zea mays]
 gb|AFW74121.1| prolyl 4-hydroxylase alpha-2 subunit isoform 2 [Zea mays]
 gb|AFW74122.1| prolyl 4-hydroxylase alpha-2 subunit isoform 3 [Zea mays]
 gb|AFW74123.1| prolyl 4-hydroxylase alpha-2 subunit isoform 4 [Zea mays]
Length=307

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 103/150 (69%), Gaps = 20/150 (13%)
 Frame = +3

Query  219  FGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVR-------------KGDSWVEVI  359
            FG+ S+P S+  +      +          E E  DVR             +G  W EVI
Sbjct  47   FGVFSLPVSAPNAAATTGTAAGG-------ETESADVRPRARRDLGEGLGERGAQWTEVI  99

Query  360  SWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRD  539
            SWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGRD
Sbjct  100  SWEPRAFVYHNFLSKDECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRD  159

Query  540  KIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            K+IR IEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  160  KVIRAIEKRIADYTFIPVDHGEGLQVLHYE  189



>ref|XP_003574128.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=306

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVVDS TG SKDSRVRTSS
Sbjct  90   KGEPWTEVLSWEPRAFLYHNFLSKEECEYLISLAKPHMKKSTVVDSATGGSKDSRVRTSS  149

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            GTFL RG+DK+IR IEKRI+DFTFIPAE+GEGLQ+LHYE
Sbjct  150  GTFLRRGQDKVIRTIEKRISDFTFIPAENGEGLQVLHYE  188



>gb|EEC74283.1| hypothetical protein OsI_09531 [Oryza sativa Indica Group]
Length=376

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            +G  W EVISWEPRAFVYHNFLSK EC+YLI LAKPHM KSTVVDS TGKSKDSRVRTSS
Sbjct  94   RGAQWTEVISWEPRAFVYHNFLSKEECDYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSS  153

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RGRDK+IR IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  154  GMFLQRGRDKVIRAIEKRIADYTFIPMEHGEGLQVLHYE  192



>dbj|BAJ85763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  306  EEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKS  485
            E + E    KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVVDS TG S
Sbjct  75   ESRLEKGGEKGEPWTEVLSWEPRAFIYHNFLSKEECEYLISLAKPHMKKSTVVDSATGGS  134

Query  486  KDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            KDSRVRTSSGTFL RG+DKI+R IEKRI+DFTFIP E+GEGLQ+LHYE
Sbjct  135  KDSRVRTSSGTFLRRGQDKIVRTIEKRISDFTFIPVENGEGLQVLHYE  182



>ref|NP_179363.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
 sp|Q24JN5.1|P4H5_ARATH RecName: Full=Prolyl 4-hydroxylase 5; Flags: Precursor [Arabidopsis 
thaliana]
 pir||F84555 similar to prolyl 4-hydroxylase alpha subunit [imported] - Arabidopsis 
thaliana
 gb|ABD65585.1| At2g17720 [Arabidopsis thaliana]
 dbj|BAF01353.1| similar to prolyl 4-hydroxylase alpha subunit [Arabidopsis thaliana]
 gb|AEC06673.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
Length=291

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I   +   E
Sbjct  10   RYQPRKSVSRSTQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVRKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +TG SK
Sbjct  67   TSSGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>gb|AAM65040.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=291

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I   +   E
Sbjct  10   RYQPRKSVSRSTQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVRKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +TG SK
Sbjct  67   TSSGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>ref|XP_010467565.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +  AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I H +   E
Sbjct  10   RYQPRKSPSRSIQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIVHKS---E  66

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
                D+   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP M KSTVVD +TG SK
Sbjct  67   TSYGDEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSK  126

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  127  DSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  173



>ref|XP_010061109.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 ref|XP_010061110.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 gb|KCW68007.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68008.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68009.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=321

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  252  GSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINL  431
            G   A+  S+    T ER +      ++G+ W EV+SWEPRAF+YH FLS+ ECEYLI+L
Sbjct  81   GDAPANGWSSFRRRTFERGDGLG---QRGEQWTEVLSWEPRAFIYHGFLSREECEYLISL  137

Query  432  AKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGL  611
            AKP M KSTVVDS TGKSKDSRVRTSSGTFL RG DKIIR+IEKRIADFTFIP EHGEGL
Sbjct  138  AKPRMAKSTVVDSTTGKSKDSRVRTSSGTFLQRGGDKIIRDIEKRIADFTFIPVEHGEGL  197

Query  612  QILHYE  629
            Q+LHYE
Sbjct  198  QVLHYE  203



>ref|NP_001151238.1| LOC100284871 [Zea mays]
 ref|XP_008677412.1| PREDICTED: auxin-independent growth promoter protein isoform 
X1 [Zea mays]
 gb|ACG42089.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37748.1| prolyl 4-hydroxylase 5 [Zea mays]
 gb|AFW63915.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
Length=308

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            +G  W EVISWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSS
Sbjct  92   RGAQWTEVISWEPRAFVYHNFLSKEECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSS  151

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RGRDK+IR IEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  152  GMFLQRGRDKVIRVIEKRIADYTFIPVDHGEGLQVLHYE  190



>gb|AGP04976.1| prolyl-4-hydroxylase 6_b [Physcomitrella patens]
Length=283

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = +3

Query  150  TSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDV  329
            T + T A  VFA LSL+V+++L   ++++PS  RGS     +   A   L+       D 
Sbjct  10   TGVGTMALLVFAFLSLIVMVMLLLDVVAMPSGRRGS-----IDEGAEVELKLPTHRHVDE  64

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
                 WVEV+SWEPRAF+YH+FL++ EC +LI +AKP + KSTV+DS TGKSKDSRVRTS
Sbjct  65   NPLAPWVEVLSWEPRAFLYHHFLTQVECNHLIEVAKPSLVKSTVIDSATGKSKDSRVRTS  124

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            SGTFL RG+D II+ IEKRIADFTFIP E GEGLQ+L Y
Sbjct  125  SGTFLVRGQDHIIKRIEKRIADFTFIPVEQGEGLQVLQY  163



>ref|NP_001241694.1| prolyl 4-hydroxylase 8-4 [Zea mays]
 gb|AEP37761.1| prolyl 4-hydroxylase 8-4 [Zea mays]
Length=307

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 103/150 (69%), Gaps = 20/150 (13%)
 Frame = +3

Query  219  FGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVR-------------KGDSWVEVI  359
            FG+ S+P S+  +      +          E E  DVR             +G  W EVI
Sbjct  47   FGVFSLPVSAPNAAATTGTAAGG-------ETESADVRPRARRDLGEGLGERGAQWTEVI  99

Query  360  SWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRD  539
            SWEPRAFVYHNFLSK ECEYLI LAKPHM KSTVVDS TGKSKDSRVRTSSG FL RGR+
Sbjct  100  SWEPRAFVYHNFLSKDECEYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRN  159

Query  540  KIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            K+IR IEKRIAD+TFIP +HGEGLQ+LHYE
Sbjct  160  KVIRAIEKRIADYTFIPVDHGEGLQVLHYE  189



>ref|XP_006298248.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
 gb|EOA31146.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
Length=289

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 5/167 (3%)
 Frame = +3

Query  129  RGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLERE  308
            R  PR++ S +T AF V  +L +V+L+LL  GILS+P+++R S K +DL+ I      R+
Sbjct  10   RYQPRKSPSRSTQAFTVLILLLVVILILLGLGILSLPNANRNSSKTNDLTNIV-----RK  64

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
             +   +   G+ WVEVISWEPRA VYHNFL+  ECE+LI+LAKP+M KSTVVD +TG SK
Sbjct  65   SETSYEEGNGERWVEVISWEPRAVVYHNFLTNEECEHLISLAKPNMVKSTVVDEKTGGSK  124

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSRVRTSSGTFL RG D+++  IEKRI+DFTFIP E+GEGLQ+LHY+
Sbjct  125  DSRVRTSSGTFLKRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQ  171



>gb|AGP04975.1| prolyl-4-hydroxylase 6_a [Physcomitrella patens]
Length=343

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = +3

Query  150  TSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDV  329
            T + T A  VFA LSL+V+++L   ++++PS  RGS     +   A   L+       D 
Sbjct  70   TGVGTMALLVFAFLSLIVMVMLLLDVVAMPSGRRGS-----IDEGAEVELKLPTHRHVDE  124

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
                 WVEV+SWEPRAF+YH+FL++ EC +LI +AKP + KSTV+DS TGKSKDSRVRTS
Sbjct  125  NPLAPWVEVLSWEPRAFLYHHFLTQVECNHLIEVAKPSLVKSTVIDSATGKSKDSRVRTS  184

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            SGTFL RG+D II+ IEKRIADFTFIP E GEGLQ+L Y
Sbjct  185  SGTFLVRGQDHIIKRIEKRIADFTFIPVEQGEGLQVLQY  223



>tpg|DAA49454.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=222

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAFVYHNFLSK EC++LI+LAKPHM+KSTVVDS TG SKDSRVRTSS
Sbjct  91   KGEPWTEVLSWEPRAFVYHNFLSKEECDHLISLAKPHMKKSTVVDSATGGSKDSRVRTSS  150

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRIAD+TFIP E GEGLQ+LHYE
Sbjct  151  GMFLRRGQDKIIRTIEKRIADYTFIPVEQGEGLQVLHYE  189



>gb|KJB58041.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58042.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58043.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=287

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++G+ W EV+SWEPRAF+YHNFLS+ ECEYLINLAKP+M+KSTVVDS+TG+SKDSRVRTS
Sbjct  70   KRGEQWTEVLSWEPRAFLYHNFLSREECEYLINLAKPYMKKSTVVDSKTGQSKDSRVRTS  129

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RG+DKII +IEKRIAD+TFIP E+GEGLQ+LHYE
Sbjct  130  SGMFLRRGQDKIIMDIEKRIADYTFIPVENGEGLQVLHYE  169



>gb|KJB58040.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=265

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++G+ W EV+SWEPRAF+YHNFLS+ ECEYLINLAKP+M+KSTVVDS+TG+SKDSRVRTS
Sbjct  48   KRGEQWTEVLSWEPRAFLYHNFLSREECEYLINLAKPYMKKSTVVDSKTGQSKDSRVRTS  107

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            SG FL RG+DKII +IEKRIAD+TFIP E+GEGLQ+LHYE
Sbjct  108  SGMFLRRGQDKIIMDIEKRIADYTFIPVENGEGLQVLHYE  147



>ref|XP_009418644.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLS  401
            GI S+P  S  + K+     +   +L      E   + G  W EVISWEPRAFVYHNFLS
Sbjct  51   GIFSLPVRSDSAPKSQADPRLRSRSLR---DVEGLGQLGHQWTEVISWEPRAFVYHNFLS  107

Query  402  KYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFT  581
            K ECEYLI LA+PHMQKSTV DS TG+SKDSRVRTS+G FLHRG+DK IR IEKRIA++T
Sbjct  108  KEECEYLIELARPHMQKSTVADSATGQSKDSRVRTSTGMFLHRGQDKTIRAIEKRIAEYT  167

Query  582  FIPAEHGEGLQILHYE  629
            FIP EHGEGLQ+LHYE
Sbjct  168  FIPIEHGEGLQVLHYE  183



>ref|XP_002467008.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
 gb|EER94006.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
Length=307

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAFVYHNFLSK EC++LI+LAKPHM+KSTVVDS TG SKDSRVRTSS
Sbjct  91   KGEPWTEVLSWEPRAFVYHNFLSKEECDHLISLAKPHMKKSTVVDSATGASKDSRVRTSS  150

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKII+ IEKRIADFTFIP EHGEGLQ+LHYE
Sbjct  151  GMFLRRGQDKIIQTIEKRIADFTFIPVEHGEGLQVLHYE  189



>ref|XP_010063298.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
Length=227

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKGK  R   RR +  +     +    ++V+L LLAFGI+SIP     S +        
Sbjct  30   MAKGKVARVQARRASKRSLALALL-LSFTVVLLFLLAFGIVSIPVRREISPRD------G  82

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             +T+ER        R G  W +V+SWEPRAF+YHNFLS+ ECEYLI+LAKPH+ KSTVVD
Sbjct  83   PSTVERAAFGGLGER-GKQWTQVLSWEPRAFLYHNFLSREECEYLISLAKPHISKSTVVD  141

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
               GKS DS VRTS G FL+RG+DKI+R IEKRIADFT IP EHGEGLQIL Y
Sbjct  142  GSNGKSMDSGVRTSFGMFLNRGQDKIVRAIEKRIADFTHIPVEHGEGLQILQY  194



>gb|EEE51215.1| hypothetical protein OsJ_32038 [Oryza sativa Japonica Group]
Length=222

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVVD+ TG SKDSRVRTSS
Sbjct  6    KGEPWTEVLSWEPRAFLYHNFLSKEECEYLISLAKPHMKKSTVVDASTGGSKDSRVRTSS  65

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRI+D+TFIP E+GEGLQ+LHYE
Sbjct  66   GMFLGRGQDKIIRTIEKRISDYTFIPVENGEGLQVLHYE  104



>dbj|BAE92293.1| putative prolyl 4-hydroxylase, alpha subunit [Cryptomeria japonica]
Length=302

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 5/151 (3%)
 Frame = +3

Query  180  FAILSLVVLMLLAFGILSIPSSSRGSQKAHDLS-TIAHNTLEREEQEEDDVRKGDSWVEV  356
            F +LS+ VL +LA  + S+P      Q +  LS +IA +  +R + +++   +    VEV
Sbjct  38   FTLLSVFVLFVLAIWVFSVPVKRTPYQISRQLSESIAADYAKRSDGKDEPKER----VEV  93

Query  357  ISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGR  536
            +SWEPRAF+YHNFL+K ECEYLIN+AKPHM KS VVDS+TG S DS VRTSSG FL+RG+
Sbjct  94   LSWEPRAFLYHNFLAKDECEYLINIAKPHMVKSMVVDSKTGGSMDSNVRTSSGWFLNRGQ  153

Query  537  DKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DKIIR IEKRIADF+ IP EHGEGL +LHYE
Sbjct  154  DKIIRRIEKRIADFSHIPVEHGEGLHVLHYE  184



>gb|KCW70504.1| hypothetical protein EUGRSUZ_F03711 [Eucalyptus grandis]
Length=284

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            MAKGK  R   RR +  +     +    ++V+L LLAFGI+SIP     S +        
Sbjct  1    MAKGKVARVQARRASKRSLALALL-LSFTVVLLFLLAFGIVSIPVRREISPRD------G  53

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
             +T+ER        R G  W +V+SWEPRAF+YHNFLS+ ECEYLI+LAKPH+ KSTVVD
Sbjct  54   PSTVERAAFGGLGER-GKQWTQVLSWEPRAFLYHNFLSREECEYLISLAKPHISKSTVVD  112

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
               GKS DS VRTS G FL+RG+DKI+R IEKRIADFT IP EHGEGLQIL Y
Sbjct  113  GSNGKSMDSGVRTSFGMFLNRGQDKIVRAIEKRIADFTHIPVEHGEGLQILQY  165



>ref|XP_010432226.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X4 [Camelina sativa]
Length=293

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE  317
            PRR  SL+  AF V  ++  V+L+LL  GILS+PS +  S +  DL+ +     E E   
Sbjct  14   PRR--SLSMQAFTVLILVLFVILILLCLGILSLPSITNNSSRPMDLTNVVQTIEESESYG  71

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            +++   GD WVEVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +TGKSKDSR
Sbjct  72   DEEDSNGDRWVEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSKVVDVKTGKSKDSR  131

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  132  ARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLQVLHYE  175



>ref|XP_010432224.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=298

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREEQE  317
            PRR  SL+  AF V  ++  V+L+LL  GILS+PS +  S +  DL+ +     E E   
Sbjct  14   PRR--SLSMQAFTVLILVLFVILILLCLGILSLPSITNNSSRPMDLTNVVQTIEESESYG  71

Query  318  EDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSR  497
            +++   GD WVEVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +TGKSKDSR
Sbjct  72   DEEDSNGDRWVEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSKVVDVKTGKSKDSR  131

Query  498  VRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  132  ARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLQVLHYE  175



>ref|XP_003520105.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Glycine 
max]
Length=296

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +3

Query  240  SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEY  419
            SS R   K +DL++IA NT     + E D + G+ WVE+ISWEPR F+YHNFL+K ECE+
Sbjct  50   SSGRLIIKPNDLNSIALNTTTHISEAEYD-QLGERWVEIISWEPRIFLYHNFLTKEECEH  108

Query  420  LINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEH  599
            LIN+AKP+M+KSTV++SETG S +SRVRTSSGTFL RGRDKI+RNIE RIADFTFIP ++
Sbjct  109  LINIAKPNMRKSTVIESETGMSIESRVRTSSGTFLARGRDKIVRNIENRIADFTFIPVDN  168

Query  600  GEGLQILHYE  629
            GE LQ+LHY+
Sbjct  169  GEELQVLHYQ  178



>ref|NP_001064962.1| Os10g0497800 [Oryza sativa Japonica Group]
 gb|ABB47828.1| prolyl 4-hydroxylase alpha subunit, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26876.1| Os10g0497800 [Oryza sativa Japonica Group]
 dbj|BAH00081.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67248.1| hypothetical protein OsI_34188 [Oryza sativa Indica Group]
Length=321

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVVD+ TG SKDSRVRTSS
Sbjct  105  KGEPWTEVLSWEPRAFLYHNFLSKEECEYLISLAKPHMKKSTVVDASTGGSKDSRVRTSS  164

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRI+D+TFIP E+GEGLQ+LHYE
Sbjct  165  GMFLGRGQDKIIRTIEKRISDYTFIPVENGEGLQVLHYE  203



>ref|NP_001131953.1| uncharacterized protein LOC100193348 [Zea mays]
 gb|ACF80592.1| unknown [Zea mays]
 gb|AEP37741.1| prolyl 4-hydroxylase 1 [Zea mays]
 tpg|DAA49455.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=307

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAFVYHNFLSK EC++LI+LAKPHM+KSTVVDS TG SKDSRVRTSS
Sbjct  91   KGEPWTEVLSWEPRAFVYHNFLSKEECDHLISLAKPHMKKSTVVDSATGGSKDSRVRTSS  150

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRIAD+TFIP E GEGLQ+LHYE
Sbjct  151  GMFLRRGQDKIIRTIEKRIADYTFIPVEQGEGLQVLHYE  189



>ref|XP_010935631.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=297

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MA+G ++ R    R +SL T AF V  +LS+V+L+LLA G+ S+P    G    HD S +
Sbjct  9    MARGVRHSRLFSNRPSSLYTLAFTVLLMLSVVLLILLALGVFSLP---EGDDIHHDRS-V  64

Query  285  AHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
               T           ++G  W EV+SWEPRAF+YHNFLSK ECE+LI LAKPHM+KSTVV
Sbjct  65   YETTATYLSDGNGLGKRGPQWTEVVSWEPRAFIYHNFLSKEECEFLIELAKPHMRKSTVV  124

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            DS TGKS DSRVRTSSG F  RG++KII++IEKRIAD+TFIP EHGEGLQ+LHY
Sbjct  125  DSTTGKSIDSRVRTSSGMFFGRGQNKIIQDIEKRIADYTFIPVEHGEGLQVLHY  178



>ref|XP_009394475.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=293

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  309  EQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
            E+ E  V+ G  W EVISWEPRA VYHNFLSK ECEY+I LAKPHM+KSTVV+S TG S+
Sbjct  69   EKTEGFVQSGRQWTEVISWEPRASVYHNFLSKEECEYIIQLAKPHMKKSTVVNSTTGGSE  128

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D+ VRTSSG FL RGRDKIIR+IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  129  DNSVRTSSGMFLQRGRDKIIRSIEKRIADYTFIPVEHGEGLQVLHYE  175



>gb|AAL58274.1|AC068923_16 putative prolyl 4-hydroxylase, alpha subunit [Oryza sativa Japonica 
Group]
Length=343

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LAKPHM+KSTVVD+ TG SKDSRVRTSS
Sbjct  105  KGEPWTEVLSWEPRAFLYHNFLSKEECEYLISLAKPHMKKSTVVDASTGGSKDSRVRTSS  164

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRI+D+TFIP E+GEGLQ+LHYE
Sbjct  165  GMFLGRGQDKIIRTIEKRISDYTFIPVENGEGLQVLHYE  203



>ref|XP_008802391.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=303

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTI  284
            MA+G +  R    R +SL   A  V  +LS+V+LMLLA GI S+P  S  + +  D+   
Sbjct  9    MARGVRRPRLFSNRRSSLYALALTVLLMLSVVLLMLLALGIFSLPVPSNSAPEGVDIRQ-  67

Query  285  AHNTLEREEQEEDDV---RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKS  455
             H+    E    D     ++G  W EV+SWEPRAF+YHNFLSK ECEYLI LAKPHM KS
Sbjct  68   RHDRSVFEATTTDGNGLGKRGVQWTEVVSWEPRAFIYHNFLSKEECEYLIKLAKPHMVKS  127

Query  456  TVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
            TVVDS TG+SK SRVRTSSG FL RG+DKII+ IEKRIAD+TFIP EHGEGLQ+LHY
Sbjct  128  TVVDSTTGRSKGSRVRTSSGMFLRRGQDKIIQYIEKRIADYTFIPVEHGEGLQVLHY  184



>tpg|DAA49456.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=364

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAFVYHNFLSK EC++LI+LAKPHM+KSTVVDS TG SKDSRVRTSS
Sbjct  148  KGEPWTEVLSWEPRAFVYHNFLSKEECDHLISLAKPHMKKSTVVDSATGGSKDSRVRTSS  207

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRIAD+TFIP E GEGLQ+LHYE
Sbjct  208  GMFLRRGQDKIIRTIEKRIADYTFIPVEQGEGLQVLHYE  246



>ref|XP_010266056.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=309

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +3

Query  222  GILSIPSSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLS  401
            G  S P S     KA ++S   H+T+E          +G  W EVISWEPRA +YHNFLS
Sbjct  56   GFFSPPVSRNDPPKAKEISLFVHDTVELINDGVGLGERGLQWTEVISWEPRATLYHNFLS  115

Query  402  KYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFT  581
            K ECEYLI+LAKP++ KS+VVDS TGKS DS VRTS G FL+RG+DK++R+IEKRIADF+
Sbjct  116  KEECEYLISLAKPYLAKSSVVDSNTGKSMDSSVRTSFGMFLNRGQDKVVRSIEKRIADFS  175

Query  582  FIPAEHGEGLQILHYE  629
            FIP EHGEGLQIL YE
Sbjct  176  FIPVEHGEGLQILRYE  191



>ref|XP_008802369.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802377.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802385.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=306

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = +3

Query  108  MAKG-KYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKA------  266
            MA+G +  R    R +SL   A  V  +LS+V+LMLLA GI S+P  S  + +       
Sbjct  9    MARGVRRPRLFSNRRSSLYALALTVLLMLSVVLLMLLALGIFSLPVPSNSAPEGVDIRQR  68

Query  267  HDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHM  446
            HD S     T    +      ++G  W EV+SWEPRAF+YHNFLSK ECEYLI LAKPHM
Sbjct  69   HDRSVFEATTTYLGDGNGLG-KRGVQWTEVVSWEPRAFIYHNFLSKEECEYLIKLAKPHM  127

Query  447  QKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
             KSTVVDS TG+SK SRVRTSSG FL RG+DKII+ IEKRIAD+TFIP EHGEGLQ+LHY
Sbjct  128  VKSTVVDSTTGRSKGSRVRTSSGMFLRRGQDKIIQYIEKRIADYTFIPVEHGEGLQVLHY  187



>ref|XP_003629229.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03705.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=278

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 120/174 (69%), Gaps = 14/174 (8%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K ++ R  PR+ +  A+         +L+  + + F +L +   +    K + +++I+
Sbjct  1    MVKFRHSRLGPRKPSLTASQ--------TLIFTLFVTFTLLILILLTLRIPKLNHINSIS  52

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            HN L  E+   D+ R    WV+++SWEPRAF+YHNFL+K ECE+LIN AKP MQKS+VVD
Sbjct  53   HNALRSEDN--DNKR----WVQIVSWEPRAFLYHNFLTKKECEHLINTAKPSMQKSSVVD  106

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            +ETGKSKDS VRTSSGTFL RG D+I+RNIEKRIADFTFIP E+GE   +L YE
Sbjct  107  NETGKSKDSSVRTSSGTFLDRGGDEIVRNIEKRIADFTFIPVENGESFNVLRYE  160



>ref|XP_010432225.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X3 [Camelina sativa]
Length=294

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREE--  311
            PRR  SL+  AF V  ++  V+L+LL  GILS+PS +  S +  DL+ +     E  E  
Sbjct  14   PRR--SLSMQAFTVLILVLFVILILLCLGILSLPSITNNSSRPMDLTNVVQTIEESSESY  71

Query  312  -QEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
              EED    GD WVEVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +TGKSK
Sbjct  72   GDEEDS--NGDRWVEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSKVVDVKTGKSK  129

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSR RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  130  DSRARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLQVLHYE  176



>ref|XP_010432223.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=299

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +3

Query  138  PRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHNTLEREE--  311
            PRR  SL+  AF V  ++  V+L+LL  GILS+PS +  S +  DL+ +     E  E  
Sbjct  14   PRR--SLSMQAFTVLILVLFVILILLCLGILSLPSITNNSSRPMDLTNVVQTIEESSESY  71

Query  312  -QEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSK  488
              EED    GD WVEVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +TGKSK
Sbjct  72   GDEEDS--NGDRWVEVISWEPRAFVYHNFLTNEECEHLISLAKPSMVKSKVVDVKTGKSK  129

Query  489  DSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            DSR RTSSGTFL RG D+I+ +IE RI+DFTFIP E+GEGLQ+LHYE
Sbjct  130  DSRARTSSGTFLKRGHDEIVEDIENRISDFTFIPIENGEGLQVLHYE  176



>gb|KHN00440.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=555

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +3

Query  240  SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEY  419
            SS R   K +DL++IA NT     + E D + G+ WVE+ISWEPR F+YHNFL+K ECE+
Sbjct  50   SSGRLIIKPNDLNSIALNTTTHISEAEYD-QLGERWVEIISWEPRIFLYHNFLTKEECEH  108

Query  420  LINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEH  599
            LIN+AKP+M+KSTV++SETG S +SRVRTSSGTFL RGRDKI+RNIE RIADFTFIP ++
Sbjct  109  LINIAKPNMRKSTVIESETGMSIESRVRTSSGTFLARGRDKIVRNIENRIADFTFIPVDN  168

Query  600  GEGLQILHYE  629
            GE LQ+LHY+
Sbjct  169  GEELQVLHYQ  178


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 21/98 (21%)
 Frame = +3

Query  399  SKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADF  578
            +K ECEYLIN+A PHMQKSTV D+++G+S    VR S+G FL RG+D+I+RNIEKRIAD 
Sbjct  363  TKEECEYLINIATPHMQKSTVADNQSGQSVVHDVRKSTGAFLDRGQDEIVRNIEKRIADV  422

Query  579  TFIPA---------------------EHGEGLQILHYE  629
            TFIP                      E+GE + ++HYE
Sbjct  423  TFIPIVEDLKLSLCFIILLDIPCGFLENGEPIYVIHYE  460



>ref|XP_009149614.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Brassica rapa]
Length=260

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            + K K+ R  PR++ SL T AF    +    +L+LL  GILS+PS+   S +  D +T+ 
Sbjct  2    VKKPKHLRPQPRKS-SLTTHAFTFLILALFSILILLGLGILSLPSTRMISSRPTDFTTVE  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              +  RE    DD   G+ W+EVISWEPRAF+YHNFL+  ECE+LI+LAKP+M KS V D
Sbjct  61   RTSEGRESTYGDDEGNGERWLEVISWEPRAFLYHNFLTNEECEHLISLAKPNMAKSKVAD  120

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG+SKDSRVRTSSG FL  G D+I++ IE +I+DFTFIP E+GE LQ+LHYE
Sbjct  121  VKTGRSKDSRVRTSSGAFLKTGHDEIVKEIEDKISDFTFIPVENGESLQVLHYE  174



>emb|CDX69169.1| BnaC01g02840D [Brassica napus]
Length=292

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            + K K+ R  PR++ SL T AF    +    +L+LL  GILS+PS+S  S +  D +T+ 
Sbjct  2    VKKPKHLRPQPRKS-SLTTHAFTFLILALFSILILLGLGILSLPSTSMISSRPDDFTTVE  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              + +  E   D+   G+ W+EVISWEPRAF+YHNFL+  ECE+LI+LAKP+M KS V D
Sbjct  61   RTSEDSRESYGDEEGNGERWLEVISWEPRAFLYHNFLTNEECEHLISLAKPNMAKSKVAD  120

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG+SKDSRVRTSSG FL  G D+I+R IE +I+DFTFIP E+GE LQ+LHYE
Sbjct  121  VKTGRSKDSRVRTSSGAFLKTGHDEIVREIENKISDFTFIPVENGESLQVLHYE  174



>emb|CAA21467.1| putative protein [Arabidopsis thaliana]
 emb|CAB81490.1| putative protein [Arabidopsis thaliana]
Length=307

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 125/203 (62%), Gaps = 33/203 (16%)
 Frame = +3

Query  114  KGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIAHN  293
            K K  R  PR+  S +T  F V  ++  V+L+L+  GI S+PS+++ S    DL+TI   
Sbjct  4    KPKQLRNKPRK--SFSTQTFTVVVLVLFVILILVGLGIFSLPSTNKTSSMPMDLTTIVQT  61

Query  294  TLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSE  473
              ERE   +++   GD W+EVISWEPRAFVYHNFL+  ECE+LI+LAKP M KS VVD +
Sbjct  62   IQERESFGDEEDGNGDRWLEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVK  121

Query  474  TGKSKDS-------------------------------RVRTSSGTFLHRGRDKIIRNIE  560
            TGKS DS                               RVRTSSGTFL+RG D+I+  IE
Sbjct  122  TGKSIDSRFCTLTSVVVFTFQLNLERFENSKFANPSLCRVRTSSGTFLNRGHDEIVEEIE  181

Query  561  KRIADFTFIPAEHGEGLQILHYE  629
             RI+DFTFIP E+GEGLQ+LHYE
Sbjct  182  NRISDFTFIPPENGEGLQVLHYE  204



>ref|XP_009149485.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
 ref|XP_009149555.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
Length=292

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            + K K+ R  PR++ SL T AF    +    +L+LL  GILS+PS+   S +  D +T+ 
Sbjct  2    VKKPKHLRPQPRKS-SLTTHAFTFLILALFSILILLGLGILSLPSTRMISSRPTDFTTVE  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              +  RE    DD   G+ W+EVISWEPRAF+YHNFL+  ECE+LI+LAKP+M KS V D
Sbjct  61   RTSEGRESTYGDDEGNGERWLEVISWEPRAFLYHNFLTNEECEHLISLAKPNMAKSKVAD  120

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG+SKDSRVRTSSG FL  G D+I++ IE +I+DFTFIP E+GE LQ+LHYE
Sbjct  121  VKTGRSKDSRVRTSSGAFLKTGHDEIVKEIEDKISDFTFIPVENGESLQVLHYE  174



>ref|XP_010531576.1| PREDICTED: prolyl 4-hydroxylase 5-like [Tarenaya hassleriana]
Length=337

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +3

Query  294  TLEREEQEED--DVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
            TL++ E+ +   +   G+ WVEVISWEPRAFVYHNFLSK ECE+LI+LAKP+M KSTVVD
Sbjct  106  TLKKSEERKSYGEHENGERWVEVISWEPRAFVYHNFLSKEECEHLISLAKPNMVKSTVVD  165

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG SKDSRVRTSSGTFL RG+DKI+  IE+RI+DFTFIP E+GEGLQ+LHYE
Sbjct  166  EKTGGSKDSRVRTSSGTFLRRGQDKIVEEIEQRISDFTFIPVENGEGLQVLHYE  219



>ref|XP_006661912.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Oryza brachyantha]
Length=221

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAF+YHNFLSK ECEYLI+LA+P M+KSTVVD+ TG SKDSRVRTSS
Sbjct  5    KGEPWTEVLSWEPRAFLYHNFLSKEECEYLISLARPLMKKSTVVDTSTGGSKDSRVRTSS  64

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG DKII  IEKRI+D+TFIP E+GEGLQ+LHYE
Sbjct  65   GMFLRRGLDKIISTIEKRISDYTFIPVENGEGLQVLHYE  103



>ref|XP_004487245.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cicer arietinum]
Length=282

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 120/177 (68%), Gaps = 16/177 (9%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAIL---SLVVLMLLAFGILSIPSSSRGSQKAHDLS  278
            MAK       PR++ SL T+   +  IL   + ++L+LLAF   SIP       K + L+
Sbjct  1    MAKSMQSHVWPRKS-SLTTSHTLILTILVTFTFLILILLAF---SIP-------KPNHLN  49

Query  279  TIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKST  458
             I+ N    ++++  +V +   W EVISWEPRAF+YHNFL+K ECE+L+N+AKP MQKS 
Sbjct  50   FISRNAQRSKDKDSSEVER--IWFEVISWEPRAFMYHNFLTKEECEHLMNIAKPSMQKSA  107

Query  459  VVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            VVD+ETGKS  + +RTS GTF+ RG DKI+ NIEKRIA  + IP EHGEGLQ+LHY+
Sbjct  108  VVDNETGKSLITSIRTSYGTFIERGHDKIVSNIEKRIAQVSLIPIEHGEGLQVLHYK  164



>emb|CDX75528.1| BnaA01g01740D [Brassica napus]
Length=292

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 121/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            + K K+ R  PR++ SL T AF    +    +L+LL  GILS+PS+   S +  D +T+ 
Sbjct  2    VKKPKHLRPQPRKS-SLTTHAFTFLILALFSILILLGLGILSLPSTRMISSRPTDFTTVE  60

Query  288  HNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVD  467
              +    E   D+   G+ W+EVISWEPRAF+YHNFL+  ECE+LI+LAKP+M KS V D
Sbjct  61   RTSEGSRESYGDEEGNGERWLEVISWEPRAFLYHNFLTNEECEHLISLAKPNMAKSKVAD  120

Query  468  SETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             +TG+SKDSRVRTSSG FL  G D+I+R IE +I+DFTFIP E+GE LQ+LHYE
Sbjct  121  VKTGRSKDSRVRTSSGAFLKTGHDEIVREIENKISDFTFIPVENGESLQVLHYE  174



>ref|XP_006386160.1| hypothetical protein POPTR_0002s01820g [Populus trichocarpa]
 gb|ERP63957.1| hypothetical protein POPTR_0002s01820g [Populus trichocarpa]
Length=278

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 114/169 (67%), Gaps = 17/169 (10%)
 Frame = +3

Query  144  RTTSLATTAFAVFAILSLVVLML-------LAFGILSIPSSSRGSQKAHDLSTIAHNTLE  302
            R + L     + F ++S ++ ML       L  GI S+ SSS G    +DLS+    T E
Sbjct  5    RHSRLQAIKLSTFTLVSSMLFMLTFVLLVLLGLGIFSLRSSSEGF-PPNDLSSYRRMTSE  63

Query  303  REEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGK  482
            RE    +  +K + W E++SWEPRAF+YHNFLSK ECEYLINLA       TVVD+ETG+
Sbjct  64   REGDRME--KKEEKWTEILSWEPRAFLYHNFLSKEECEYLINLA-------TVVDAETGR  114

Query  483  SKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            S DSRVRTS+G FL RG+D++IR+IEKRIADF FIP EHGE LQ+LHYE
Sbjct  115  SIDSRVRTSTGMFLDRGQDRVIRDIEKRIADFFFIPVEHGEELQVLHYE  163



>ref|XP_006836966.1| hypothetical protein AMTR_s00098p00020560 [Amborella trichopoda]
 gb|ERM99819.1| hypothetical protein AMTR_s00098p00020560 [Amborella trichopoda]
Length=191

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  306  EEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKS  485
            + Q+ D V     WVEV+SW PRAF+YHNFLSK ECEYLI+L+KPHM+KSTVVDS TG+S
Sbjct  74   DNQKSDGVDGPKQWVEVLSWAPRAFIYHNFLSKEECEYLISLSKPHMRKSTVVDSGTGRS  133

Query  486  KDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIP  590
            KDSRVRTSSG FL RG+DKIIRNIEKRIADFTFIP
Sbjct  134  KDSRVRTSSGMFLRRGQDKIIRNIEKRIADFTFIP  168



>ref|XP_010266057.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nelumbo nucifera]
Length=311

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 101/146 (69%), Gaps = 17/146 (12%)
 Frame = +3

Query  213  LAFGILSIPSSSRGSQKAHDLSTIAHNTL-------EREEQEEDDVRKGDSWVEVISWEP  371
            +AF I S    ++G+  A D+++  H T+       E+E+Q          W EVISWEP
Sbjct  58   VAFVIFSHQVRTKGTPSAKDITSFLHKTVKSFDGLGEKEQQ----------WTEVISWEP  107

Query  372  RAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIR  551
            RA V+HNFLS+ ECEYLI LAKP M+KS VVDS TGKS DS VRTSSGTFL RG DKI+R
Sbjct  108  RAAVFHNFLSREECEYLIGLAKPRMEKSEVVDSTTGKSVDSGVRTSSGTFLTRGHDKIVR  167

Query  552  NIEKRIADFTFIPAEHGEGLQILHYE  629
            +IE+RIA  TFIP EHGEGL +L YE
Sbjct  168  SIEERIAKSTFIPVEHGEGLHVLRYE  193



>ref|XP_003629231.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03707.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=279

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 120/175 (69%), Gaps = 13/175 (7%)
 Frame = +3

Query  108  MAKGKYGRGLPRRTTSLATTAFAVFAILSLVVLMLLAFGILSIPSSSRGSQKAHDLSTIA  287
            M K K+ R  PR+   L T+   +F +    + +++   +LS+    R  +  H L++I 
Sbjct  1    MGKLKHSRVGPRKPL-LPTSRTLIFTLFVTFIFLIIFLILLSL----RIPKPKH-LNSIT  54

Query  288  H-NTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVV  464
            H N L R++   DD ++   WVE++SWEPR F+YHNFL+K ECE+LIN+AKP +QKSTVV
Sbjct  55   HINNLRRDD---DDNKR---WVEIVSWEPRVFLYHNFLAKEECEHLINIAKPDVQKSTVV  108

Query  465  DSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            D  TGKS +S  RTSSGTF+ RG DKI+ +IEKRIADFTFIP EHGE + ILHYE
Sbjct  109  DDTTGKSVNSSARTSSGTFIDRGYDKILSDIEKRIADFTFIPVEHGEDVNILHYE  163



>ref|XP_003629236.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03712.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=326

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +3

Query  261  KAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKP  440
            K + L++I H+   R   E+DD ++   WV++ISWEPRAF+YHNFL+K ECE+LIN+AKP
Sbjct  91   KPNHLNSITHSNTLR--NEDDDNKR---WVQIISWEPRAFLYHNFLTKEECEHLINIAKP  145

Query  441  HMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQIL  620
             M KS V+D ETG   DSR RTSSG FL RG D+I++NIE+RIADFTFIP EHGE   +L
Sbjct  146  SMHKSAVIDEETGNGVDSRERTSSGAFLKRGSDRIVKNIERRIADFTFIPVEHGENFNVL  205

Query  621  HYE  629
            HYE
Sbjct  206  HYE  208



>gb|AET03711.2| prolyl 4-hydroxylase alpha subunit, putative [Medicago truncatula]
Length=227

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 92/111 (83%), Gaps = 4/111 (4%)
 Frame = +3

Query  297  LEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSET  476
            L + + E+DD ++   WVE++SWEPRAF+YHNFL+K ECE+LIN+AKP M KSTV D ET
Sbjct  14   LLKNKSEDDDNKR---WVEIVSWEPRAFLYHNFLTKEECEHLINIAKPSMHKSTV-DDET  69

Query  477  GKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            GKS D+  RTSSGTF++RG DKI+RNIE+RIADFTFIP E+GE + ILHYE
Sbjct  70   GKSVDNSARTSSGTFINRGHDKILRNIEQRIADFTFIPVENGESVNILHYE  120



>gb|KJB59735.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=284

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  330  RKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTS  509
            ++G+ W EV+SWEPRAF+YHNFLSK ECEYLINLAKPHM KSTVVDS+TGKSKDSRVRTS
Sbjct  70   KRGEQWTEVLSWEPRAFIYHNFLSKEECEYLINLAKPHMVKSTVVDSKTGKSKDSRVRTS  129

Query  510  SGTFLHRGRDKIIRNIEKRIADFTFIPA  593
            SG FL RG+DKII++IEKRIAD++FIP+
Sbjct  130  SGMFLRRGQDKIIKDIEKRIADYSFIPS  157



>gb|KJB59736.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=276

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  375  AFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRN  554
            AF+YHNFLSK ECEYLINLAKPHM KSTVVDS+TGKSKDSRVRTSSG FL RG+DKII++
Sbjct  74   AFIYHNFLSKEECEYLINLAKPHMVKSTVVDSKTGKSKDSRVRTSSGMFLRRGQDKIIKD  133

Query  555  IEKRIADFTFIPAEHGEGLQILHYE  629
            IEKRIAD++FIP EHGEGLQ+LHYE
Sbjct  134  IEKRIADYSFIPVEHGEGLQVLHYE  158



>ref|XP_006598732.1| PREDICTED: uncharacterized protein LOC100782154 isoform X1 [Glycine 
max]
 ref|XP_006598733.1| PREDICTED: uncharacterized protein LOC100782154 isoform X2 [Glycine 
max]
 gb|KHN35553.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=295

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 105/147 (71%), Gaps = 5/147 (3%)
 Frame = +3

Query  192  SLVVLMLLAFGILSIP--SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISW  365
            S ++L+ LA  ILS P  +SS    K +DL+++  NT    E E + V++   WVEV+SW
Sbjct  33   SFLILIPLALRILSTPHVNSSSALSKPNDLNSVPRNTHVSSEGENNRVKR---WVEVMSW  89

Query  366  EPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKI  545
            EPRAF+YHNFL+K ECEYLIN A P+M KS V+D+E+G+  ++  RTS+   + RG+DKI
Sbjct  90   EPRAFLYHNFLTKEECEYLINTATPNMLKSLVIDNESGEGIETSYRTSTEYVVERGKDKI  149

Query  546  IRNIEKRIADFTFIPAEHGEGLQILHY  626
            +RNIEKRIAD TFIP EHGE L ++ Y
Sbjct  150  VRNIEKRIADVTFIPIEHGEPLHVIRY  176



>gb|AGP04974.1| prolyl-4-hydroxylase 5 [Physcomitrella patens]
Length=280

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 19/142 (13%)
 Frame = +3

Query  222  GILSIPSSSRGSQ------KAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISWEPRAFV  383
            G +++PS+S GS       K         N L R             WVEV+SWEPRAF+
Sbjct  34   GFVAMPSASHGSSADVVEIKLPSHRHFGANPLSR-------------WVEVLSWEPRAFL  80

Query  384  YHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEK  563
            YH+FL++ EC +LI +A+P + KSTVVDS+TGKSKDSRVRTSSGTFL RG+D +I+ IEK
Sbjct  81   YHHFLTEEECNHLIEVARPSLVKSTVVDSDTGKSKDSRVRTSSGTFLMRGQDPVIKRIEK  140

Query  564  RIADFTFIPAEHGEGLQILHYE  629
            RIADFTFIPAE GEGLQ+L Y+
Sbjct  141  RIADFTFIPAEQGEGLQVLQYK  162



>ref|XP_004982729.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=308

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +3

Query  333  KGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSS  512
            KG+ W EV+SWEPRAFVYHNFLSK ECEYLI+LAKP M+KSTVVD+ TG SKDSRVRTSS
Sbjct  92   KGEPWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPQMKKSTVVDAATGGSKDSRVRTSS  151

Query  513  GTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
            G FL RG+DKIIR IEKRIAD+TFIP EHGEGLQ+LHYE
Sbjct  152  GMFLRRGQDKIIRIIEKRIADYTFIPVEHGEGLQVLHYE  190



>ref|XP_001754091.1| predicted protein [Physcomitrella patens]
 gb|EDQ80992.1| predicted protein, partial [Physcomitrella patens]
Length=214

 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +3

Query  345  WVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFL  524
            WVEV+SWEPRAF+YH+FL++ EC +LI +A+P + KSTVVDS+TGKSKDSR+RTSSGTFL
Sbjct  2    WVEVLSWEPRAFLYHHFLTEEECNHLIEVARPSLVKSTVVDSDTGKSKDSRLRTSSGTFL  61

Query  525  HRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHYE  629
             RG+D +I+ IEKRIADFTFIPAE GEGLQ+L Y+
Sbjct  62   MRGQDPVIKRIEKRIADFTFIPAEQGEGLQVLQYK  96



>ref|XP_001782374.1| predicted protein [Physcomitrella patens]
 gb|EDQ52828.1| predicted protein, partial [Physcomitrella patens]
Length=211

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  WVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFL  524
            WVEV+SWEPRAF+YH+FL++ EC +LI +AKP + KSTV+DS TGKSKDSRVRTSSGTFL
Sbjct  1    WVEVLSWEPRAFLYHHFLTQVECNHLIEVAKPSLVKSTVIDSATGKSKDSRVRTSSGTFL  60

Query  525  HRGRDKIIRNIEKRIADFTFIPAEHGEGLQILHY  626
             RG+D II+ IEKRIADFTFIP E GEGLQ+L Y
Sbjct  61   VRGQDHIIKRIEKRIADFTFIPVEQGEGLQVLQY  94



>ref|NP_001242181.1| uncharacterized protein LOC100782154 [Glycine max]
 gb|ACU22735.1| unknown [Glycine max]
Length=285

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 105/147 (71%), Gaps = 6/147 (4%)
 Frame = +3

Query  192  SLVVLMLLAFGILSIP--SSSRGSQKAHDLSTIAHNTLEREEQEEDDVRKGDSWVEVISW  365
            S ++L+ LA  ILS P  +SS    K +DL+++  NT    E E + V++   WVEV+SW
Sbjct  33   SFLILIPLALRILSTPHVNSSSALSKPNDLNSVPRNT-HVSEGENNRVKR---WVEVMSW  88

Query  366  EPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKI  545
            EPRAF+YHNFL+K ECEYLIN A P+M KS V+D+E+G+  ++  RTS+   + RG+DKI
Sbjct  89   EPRAFLYHNFLTKEECEYLINTATPNMLKSLVIDNESGEGIETSYRTSTEYVVERGKDKI  148

Query  546  IRNIEKRIADFTFIPAEHGEGLQILHY  626
            +RNIEKRIAD TFIP EHGE L ++ Y
Sbjct  149  VRNIEKRIADVTFIPIEHGEPLHVIRY  175



>ref|XP_009388317.1| PREDICTED: probable prolyl 4-hydroxylase 3, partial [Musa acuminata 
subsp. malaccensis]
Length=149

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  336  GDSWVEVISWEPRAFVYHNFLSKYECEYLINLAKPHMQKSTVVDSETGKSKDSRVRTSSG  515
            G+ W EV+SWEPRAF+YHNFLSK EC+YLI LAKP+M+KSTVVDS TG+S DSRVRTSSG
Sbjct  64   GEQWTEVLSWEPRAFLYHNFLSKEECKYLIELAKPYMKKSTVVDSTTGRSTDSRVRTSSG  123

Query  516  TFLHRGRDKIIRNIEKRIADFTFIP  590
             FL RG+DKIIR IEKRIADFTFIP
Sbjct  124  MFLRRGQDKIIRAIEKRIADFTFIP  148



>ref|XP_003629237.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03713.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
 gb|AFK44766.1| unknown [Medicago truncatula]
 gb|AFK46234.1| unknown [Medicago truncatula]
Length=275

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 9/124 (7%)
 Frame = +3

Query  261  KAHDLSTIAH-NTLEREEQEEDDVRKGDSWVEVISWEPRAFVYHNFLSKYECEYLINLAK  437
            K + L++I H NTL  ++ +         WV++ISWEPRAF+YHNFL+K ECE+LIN+AK
Sbjct  44   KLNHLNSITHSNTLRNDDNKR--------WVQIISWEPRAFLYHNFLTKEECEHLINIAK  95

Query  438  PHMQKSTVVDSETGKSKDSRVRTSSGTFLHRGRDKIIRNIEKRIADFTFIPAEHGEGLQI  617
            P M KS V+D +TGKS +S +RTSSGTFL R  D+I+ NIEKRIADFTFIP EHGE   +
Sbjct  96   PSMHKSEVIDEKTGKSLNSSIRTSSGTFLDREGDEIVSNIEKRIADFTFIPVEHGESFNV  155

Query  618  LHYE  629
            LHYE
Sbjct  156  LHYE  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875