BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020D10

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597420.1|  PREDICTED: psbQ-like protein 2, chloroplastic      296   5e-98   Nicotiana tomentosiformis
ref|XP_009772888.1|  PREDICTED: psbQ-like protein 2, chloroplastic      288   3e-94   Nicotiana sylvestris
ref|XP_006352484.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    275   1e-89   Solanum tuberosum [potatoes]
ref|XP_011095313.1|  PREDICTED: psbQ-like protein 2, chloroplastic      274   2e-88   Sesamum indicum [beniseed]
emb|CDP05807.1|  unnamed protein product                                261   6e-84   Coffea canephora [robusta coffee]
ref|XP_004248376.1|  PREDICTED: psbQ-like protein 2, chloroplastic      260   9e-84   Solanum lycopersicum
ref|XP_002282744.1|  PREDICTED: psbQ-like protein 2, chloroplastic      258   6e-83   Vitis vinifera
gb|KDP39041.1|  hypothetical protein JCGZ_00798                         254   2e-81   Jatropha curcas
ref|XP_010247012.1|  PREDICTED: psbQ-like protein 2, chloroplastic      253   8e-81   Nelumbo nucifera [Indian lotus]
ref|XP_008244339.1|  PREDICTED: psbQ-like protein 2, chloroplastic      249   1e-79   Prunus mume [ume]
ref|XP_009358084.1|  PREDICTED: psbQ-like protein 2, chloroplastic      246   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_008386026.1|  PREDICTED: psbQ-like protein 2, chloroplastic      242   9e-77   
ref|XP_009355577.1|  PREDICTED: psbQ-like protein 2, chloroplastic      240   9e-76   Pyrus x bretschneideri [bai li]
ref|XP_010092309.1|  Oxygen-evolving enhancer protein 3-1               240   1e-75   Morus notabilis
ref|XP_008355351.1|  PREDICTED: psbQ-like protein 2, chloroplastic      239   1e-75   Malus domestica [apple tree]
ref|XP_004294334.1|  PREDICTED: photosynthetic NDH subunit of lum...    238   4e-75   Fragaria vesca subsp. vesca
ref|XP_002522826.1|  Oxygen-evolving enhancer protein 3-1, chloro...    238   5e-75   Ricinus communis
gb|EYU19203.1|  hypothetical protein MIMGU_mgv1a013464mg                235   5e-74   Erythranthe guttata [common monkey flower]
ref|XP_007021089.1|  PsbQ-like 1                                        232   1e-72   
ref|XP_010060439.1|  PREDICTED: psbQ-like protein 2, chloroplastic      229   1e-71   Eucalyptus grandis [rose gum]
gb|KCW67214.1|  hypothetical protein EUGRSUZ_F00997                     230   3e-71   Eucalyptus grandis [rose gum]
gb|KJB81837.1|  hypothetical protein B456_013G164200                    228   4e-71   Gossypium raimondii
gb|EYU19204.1|  hypothetical protein MIMGU_mgv1a013464mg                227   8e-71   Erythranthe guttata [common monkey flower]
gb|KJB81838.1|  hypothetical protein B456_013G164200                    225   7e-70   Gossypium raimondii
ref|XP_006475299.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    225   1e-69   Citrus sinensis [apfelsine]
ref|XP_006452143.1|  hypothetical protein CICLE_v10009429mg             224   1e-69   Citrus clementina [clementine]
gb|KDO46378.1|  hypothetical protein CISIN_1g026590mg                   223   6e-69   Citrus sinensis [apfelsine]
ref|XP_006409231.1|  hypothetical protein EUTSA_v10022842mg             219   1e-67   Eutrema salsugineum [saltwater cress]
ref|XP_007212107.1|  hypothetical protein PRUPE_ppa011900mg             216   8e-67   
ref|XP_004151964.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    216   1e-66   Cucumis sativus [cucumbers]
ref|XP_010463522.1|  PREDICTED: psbQ-like protein 2, chloroplastic      216   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010485415.1|  PREDICTED: psbQ-like protein 2, chloroplastic      215   6e-66   Camelina sativa [gold-of-pleasure]
emb|CDY49054.1|  BnaC05g48820D                                          214   1e-65   Brassica napus [oilseed rape]
ref|XP_006408504.1|  hypothetical protein EUTSA_v10021484mg             214   1e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010550108.1|  PREDICTED: psbQ-like protein 2, chloroplastic      213   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_008454569.1|  PREDICTED: psbQ-like protein 2, chloroplastic      213   2e-65   Cucumis melo [Oriental melon]
ref|NP_566137.1|  PsbQ-like protein 1                                   213   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370609.1|  oxygen evolving enhancer 3 family protein          213   6e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002884281.1|  oxygen evolving enhancer 3 family protein          212   7e-65   
gb|AAM61735.1|  unknown                                                 212   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147432.1|  PREDICTED: psbQ-like protein 2, chloroplastic      212   9e-65   Brassica rapa
ref|XP_009418216.1|  PREDICTED: psbQ-like protein 2, chloroplastic      211   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011048276.1|  PREDICTED: psbQ-like protein 2, chloroplastic      211   3e-64   Populus euphratica
ref|XP_006298510.1|  hypothetical protein CARUB_v10014586mg             207   4e-63   Capsella rubella
ref|XP_004487618.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    201   1e-60   Cicer arietinum [garbanzo]
ref|XP_010694269.1|  PREDICTED: psbQ-like protein 2, chloroplastic      201   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003596609.1|  Oxygen-evolving enhancer protein 3-1               201   3e-60   Medicago truncatula
gb|KFK37610.1|  hypothetical protein AALP_AA3G005500                    200   3e-60   Arabis alpina [alpine rockcress]
gb|AFK42657.1|  unknown                                                 201   4e-60   Lotus japonicus
ref|XP_009125021.1|  PREDICTED: psbQ-like protein 2, chloroplastic      197   6e-59   Brassica rapa
gb|KHN27980.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic     197   9e-59   Glycine soja [wild soybean]
ref|XP_003540422.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    197   1e-58   Glycine max [soybeans]
gb|AFK39659.1|  unknown                                                 193   1e-57   Medicago truncatula
gb|KHN36736.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic     192   4e-57   Glycine soja [wild soybean]
ref|XP_006837007.1|  hypothetical protein AMTR_s00098p00154060          190   2e-56   
ref|XP_010931504.1|  PREDICTED: psbQ-like protein 2, chloroplastic      186   1e-54   Elaeis guineensis
ref|XP_008793744.1|  PREDICTED: LOW QUALITY PROTEIN: psbQ-like pr...    184   5e-54   
ref|XP_007149690.1|  hypothetical protein PHAVU_005G090800g             173   2e-49   Phaseolus vulgaris [French bean]
ref|XP_010445018.1|  PREDICTED: psbQ-like protein 2, chloroplastic      167   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006452142.1|  hypothetical protein CICLE_v10009429mg             160   2e-45   
ref|XP_003557699.1|  PREDICTED: psbQ-like protein 2, chloroplastic      161   5e-45   Brachypodium distachyon [annual false brome]
gb|ACG26647.1|  oxygen evolving enhancer protein 3 containing pro...    152   2e-41   Zea mays [maize]
ref|NP_001141040.1|  oxygen evolving enhancer protein 3 containin...    151   4e-41   Zea mays [maize]
ref|XP_002459208.1|  hypothetical protein SORBIDRAFT_02g000550          149   3e-40   Sorghum bicolor [broomcorn]
ref|XP_004987261.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    147   2e-39   Setaria italica
ref|NP_001058698.1|  Os07g0105600                                       146   3e-39   
gb|EMT10187.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic     144   1e-38   
ref|XP_006658201.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    134   1e-34   Oryza brachyantha
gb|EMS67145.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic     132   1e-33   Triticum urartu
gb|EMS66651.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic     125   2e-32   Triticum urartu
gb|EAZ38418.1|  hypothetical protein OsJ_22796                          122   4e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006304628.1|  hypothetical protein CARUB_v10011728mg             106   3e-25   
ref|XP_008340487.1|  PREDICTED: psbQ-like protein 2, chloroplastic      104   1e-24   Malus domestica [apple tree]
ref|XP_009351673.1|  PREDICTED: psbQ-like protein 2, chloroplastic      104   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_008389111.1|  PREDICTED: psbQ-like protein 2, chloroplastic      102   2e-23   Malus domestica [apple tree]
ref|XP_008221012.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    101   3e-23   
ref|XP_008221011.1|  PREDICTED: psbQ-like protein 2, chloroplasti...    101   3e-23   Prunus mume [ume]
ref|XP_007227647.1|  hypothetical protein PRUPE_ppa017854mg             100   5e-23   
ref|XP_006847942.1|  hypothetical protein AMTR_s00029p00134930          100   6e-23   Amborella trichopoda
ref|XP_010940303.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  97.4    7e-22   Elaeis guineensis
ref|XP_010940302.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  95.1    2e-20   
ref|XP_009389206.1|  PREDICTED: psbQ-like protein 2, chloroplastic    92.0    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907837.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  90.5    3e-19   
ref|XP_008810530.1|  PREDICTED: psbQ-like protein 2, chloroplastic    86.7    8e-18   
ref|XP_008803881.1|  PREDICTED: psbQ-like protein 2, chloroplastic    86.3    9e-18   Phoenix dactylifera
ref|XP_009383037.1|  PREDICTED: psbQ-like protein 2, chloroplastic    85.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297769.1|  PREDICTED: oxygen-evolving enhancer protein ...  85.9    2e-17   Fragaria vesca subsp. vesca
ref|XP_004297771.1|  PREDICTED: oxygen-evolving enhancer protein ...  85.1    2e-17   Fragaria vesca subsp. vesca
ref|NP_193860.1|  oxygen evolving complex of photosystem II subun...  86.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813765.1|  PREDICTED: psbQ-like protein 2, chloroplastic    83.6    8e-17   Phoenix dactylifera
ref|XP_010449093.1|  PREDICTED: oxygen-evolving enhancer protein ...  85.9    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006284392.1|  hypothetical protein CARUB_v10005561mg           85.5    2e-16   
ref|NP_001031687.1|  oxygen evolving complex of photosystem II su...  85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935465.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  82.0    3e-16   Elaeis guineensis
ref|XP_010935464.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  82.0    5e-16   
ref|XP_002317563.1|  oxygen evolving enhancer 3 family protein        80.9    7e-16   
ref|NP_001053342.1|  Os04g0522800                                     80.9    9e-16   
gb|ABQ23675.1|  photosynthetic oxygen-evolving protein 16 kDa sub...  82.4    2e-15   Salicornia veneta
ref|XP_010434201.1|  PREDICTED: oxygen-evolving enhancer protein ...  82.4    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006288420.1|  hypothetical protein CARUB_v10001680mg           82.4    2e-15   
dbj|BAG70023.1|  16 kDa precursor protein of the oxygen-evolving ...  80.9    5e-15   Salicornia europaea [chicken-claws]
ref|XP_002869896.1|  PSBQ/PSBQ-1                                      80.5    6e-15   
ref|XP_010439496.1|  PREDICTED: oxygen-evolving enhancer protein ...  80.1    1e-14   Camelina sativa [gold-of-pleasure]
gb|AID21623.1|  At4g21280p-like protein                               79.7    1e-14   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006413799.1|  hypothetical protein EUTSA_v10026172mg           79.0    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010422414.1|  PREDICTED: oxygen-evolving enhancer protein ...  79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010431656.1|  PREDICTED: oxygen-evolving enhancer protein ...  78.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010455854.1|  PREDICTED: oxygen-evolving enhancer protein ...  78.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010240150.1|  PREDICTED: psbQ-like protein 2, chloroplastic    76.3    4e-14   Brachypodium distachyon [annual false brome]
gb|KFK32219.1|  hypothetical protein AALP_AA6G213300                  77.8    6e-14   Arabis alpina [alpine rockcress]
dbj|BAJ99369.1|  predicted protein                                    75.9    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_192427.1|  photosystem II subunit Q-2                          77.8    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002446802.1|  hypothetical protein SORBIDRAFT_06g022890        75.9    8e-14   Sorghum bicolor [broomcorn]
ref|XP_006396622.1|  hypothetical protein EUTSA_v10028939mg           75.1    5e-13   
ref|XP_004976265.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  73.2    6e-13   
gb|KJB57693.1|  hypothetical protein B456_009G175700                  74.3    1e-12   Gossypium raimondii
ref|XP_003575415.2|  PREDICTED: uncharacterized protein LOC100845...  73.2    1e-12   
emb|CDX82819.1|  BnaC01g12690D                                        73.6    1e-12   
ref|XP_010247010.1|  PREDICTED: oxygen-evolving enhancer protein ...  73.6    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010235737.1|  PREDICTED: uncharacterized protein LOC100845...  71.6    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_002518571.1|  Oxygen-evolving enhancer protein 3, chloropl...  72.8    3e-12   Ricinus communis
dbj|BAA96362.1|  oxygen evolving enhancer protein 3                   70.9    3e-12   Bruguiera gymnorhiza [Burma mangrove]
emb|CDO99700.1|  unnamed protein product                              71.6    7e-12   Coffea canephora [robusta coffee]
ref|XP_007025914.1|  Photosystem II subunit Q-2                       71.6    8e-12   Theobroma cacao [chocolate]
ref|XP_006837010.1|  hypothetical protein AMTR_s00098p00157610        71.6    9e-12   Amborella trichopoda
gb|KHG15487.1|  Oxygen-evolving enhancer 3, chloroplastic             71.2    9e-12   Gossypium arboreum [tree cotton]
ref|NP_001144977.1|  hypothetical protein                             69.3    1e-11   Zea mays [maize]
ref|XP_002874836.1|  photosystem II subunit Q-2                       71.2    1e-11   Arabidopsis lyrata subsp. lyrata
gb|ABK26810.1|  unknown                                               70.9    1e-11   Picea sitchensis
emb|CDY39157.1|  BnaC09g21870D                                        70.9    1e-11   Brassica napus [oilseed rape]
gb|EEC77663.1|  hypothetical protein OsI_16689                        68.9    2e-11   Oryza sativa Indica Group [Indian rice]
gb|ABK26835.1|  unknown                                               70.5    2e-11   Picea sitchensis
emb|CBI23524.3|  unnamed protein product                              70.1    2e-11   Vitis vinifera
gb|ABK23819.1|  unknown                                               70.5    2e-11   Picea sitchensis
ref|XP_002275624.1|  PREDICTED: oxygen-evolving enhancer protein ...  70.1    2e-11   Vitis vinifera
gb|AAP43511.1|  oxygen-evolving enhancer protein 3 precursor          69.7    3e-11   Pisum sativum [garden pea]
ref|XP_010538115.1|  PREDICTED: oxygen-evolving enhancer protein ...  69.7    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_009114497.1|  PREDICTED: oxygen-evolving enhancer protein ...  69.7    4e-11   Brassica rapa
gb|EMS61967.1|  hypothetical protein TRIUR3_14009                     68.9    4e-11   Triticum urartu
gb|AAW80967.1|  chloroplast oxygen-evolving protein 16 kDa subunit    69.3    5e-11   Nicotiana tabacum [American tobacco]
ref|XP_010907836.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  67.4    5e-11   Elaeis guineensis
gb|AFK41829.1|  unknown                                               68.9    6e-11   Lotus japonicus
ref|XP_006396623.1|  hypothetical protein EUTSA_v10028939mg           68.6    8e-11   Eutrema salsugineum [saltwater cress]
ref|XP_007211975.1|  hypothetical protein PRUPE_ppa010884mg           68.6    1e-10   Prunus persica
gb|EPS69028.1|  hypothetical protein M569_05739                       68.2    1e-10   Genlisea aurea
ref|XP_002305643.1|  Oxygen-evolving enhancer protein 3-1             68.2    1e-10   Populus trichocarpa [western balsam poplar]
gb|KJB69352.1|  hypothetical protein B456_011G018700                  68.2    1e-10   Gossypium raimondii
gb|KHG03565.1|  Oxygen-evolving enhancer 3, chloroplastic             68.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_006449139.1|  hypothetical protein CICLE_v10016525mg           67.8    1e-10   Citrus clementina [clementine]
gb|AFH58005.1|  chloroplast PsbQ1 precursor                           67.8    1e-10   Nicotiana benthamiana
gb|AAW80966.1|  chloroplast oxygen-evolving protein 16 kDa subunit    67.8    2e-10   Nicotiana benthamiana
gb|KDO75611.1|  hypothetical protein CISIN_1g026780mg                 67.8    2e-10   Citrus sinensis [apfelsine]
ref|XP_009791746.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.8    2e-10   Nicotiana sylvestris
ref|XP_006467954.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.8    2e-10   Citrus sinensis [apfelsine]
gb|ABK95035.1|  unknown                                               67.4    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004515373.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.4    2e-10   Cicer arietinum [garbanzo]
gb|ABK26098.1|  unknown                                               67.4    3e-10   Picea sitchensis
ref|XP_008224877.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.4    3e-10   Prunus mume [ume]
gb|ACA58355.1|  chloroplast oxygen-evolving protein                   65.5    3e-10   Arachis diogoi
ref|XP_002317273.1|  Oxygen-evolving enhancer protein 3-1             67.0    3e-10   
ref|XP_009366538.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.0    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_011096124.1|  PREDICTED: oxygen-evolving enhancer protein ...  67.0    3e-10   Sesamum indicum [beniseed]
gb|AFK43187.1|  unknown                                               66.6    4e-10   Medicago truncatula
ref|XP_008371207.1|  PREDICTED: oxygen-evolving enhancer protein ...  66.6    4e-10   Malus domestica [apple tree]
gb|AFK40956.1|  unknown                                               65.5    5e-10   Lotus japonicus
ref|XP_010088099.1|  Oxygen-evolving enhancer protein 3-2             66.2    6e-10   Morus notabilis
ref|NP_001234528.1|  photosystem II oxygen-evolving complex prote...  65.9    7e-10   Solanum lycopersicum
ref|XP_009418767.1|  PREDICTED: oxygen-evolving enhancer protein ...  65.9    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV74404.1|  chloroplast oxygen-evolving enhancer protein          65.9    7e-10   Manihot esculenta [manioc]
ref|XP_009398847.1|  PREDICTED: psbQ-like protein 2, chloroplastic    63.9    8e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142803.1|  uncharacterized protein LOC100275181             64.7    8e-10   Zea mays [maize]
ref|XP_004957939.1|  PREDICTED: oxygen-evolving enhancer protein ...  65.1    1e-09   
ref|XP_010999549.1|  PREDICTED: oxygen-evolving enhancer protein ...  65.5    1e-09   Populus euphratica
ref|XP_006658664.1|  PREDICTED: oxygen-evolving enhancer protein ...  64.3    1e-09   
ref|NP_001288549.1|  oxygen-evolving enhancer protein 3-1, chloro...  64.7    2e-09   Zea mays [maize]
ref|XP_009587329.1|  PREDICTED: oxygen-evolving enhancer protein ...  65.1    2e-09   Nicotiana tomentosiformis
gb|KDP20229.1|  hypothetical protein JCGZ_09861                       65.1    2e-09   Jatropha curcas
emb|CAE05707.2|  OSJNBb0065J09.3                                      67.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562967.2|  PREDICTED: beta-amylase                          67.0    2e-09   
gb|EYU27845.1|  hypothetical protein MIMGU_mgv1a013205mg              64.7    2e-09   Erythranthe guttata [common monkey flower]
tpg|DAA41058.1|  TPA: oxygen-evolving enhancer protein 3-1            64.3    2e-09   
ref|XP_002315041.1|  oxygen evolving enhancer 3 family protein        63.9    2e-09   Populus trichocarpa [western balsam poplar]
dbj|BAD97359.1|  PsbQ                                                 64.3    3e-09   Nicotiana tabacum [American tobacco]
ref|XP_006365879.1|  PREDICTED: oxygen-evolving enhancer protein ...  64.3    3e-09   Solanum tuberosum [potatoes]
gb|AFK38240.1|  unknown                                               63.5    4e-09   Lotus japonicus
emb|CDY46373.1|  BnaA09g19870D                                        63.5    4e-09   Brassica napus [oilseed rape]
ref|XP_003613863.1|  Oxygen-evolving enhancer protein 3-2             64.3    4e-09   
ref|XP_010686934.1|  PREDICTED: oxygen-evolving enhancer protein ...  63.9    5e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ86175.1|  unknown                                               63.2    5e-09   Medicago truncatula
ref|XP_004490109.1|  PREDICTED: LOW QUALITY PROTEIN: psbQ-like pr...  63.9    6e-09   
ref|XP_008441634.1|  PREDICTED: oxygen-evolving enhancer protein ...  63.5    7e-09   Cucumis melo [Oriental melon]
ref|XP_010937194.1|  PREDICTED: psbQ-like protein 1, chloroplastic    62.4    7e-09   Elaeis guineensis
gb|KFK28701.1|  hypothetical protein AALP_AA7G035500                  62.8    1e-08   Arabis alpina [alpine rockcress]
ref|NP_001236143.1|  uncharacterized protein LOC100499794             62.8    1e-08   Glycine max [soybeans]
ref|XP_009588901.1|  PREDICTED: oxygen-evolving enhancer protein ...  62.8    1e-08   Nicotiana tomentosiformis
pdb|1NZE|A  Chain A, Crystal Structure Of Psbq Polypeptide Of Pho...  61.2    1e-08   Spinacia oleracea
dbj|BAJ88044.1|  predicted protein                                    62.4    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11196.1|  Oxygen-evolving enhancer protein 3-1, chloroplastic   61.2    1e-08   
dbj|BAJ89010.1|  predicted protein                                    62.0    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004145092.1|  PREDICTED: oxygen-evolving enhancer protein ...  62.0    2e-08   Cucumis sativus [cucumbers]
dbj|BAJ88009.1|  predicted protein                                    62.0    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011003398.1|  PREDICTED: oxygen-evolving enhancer protein ...  62.0    2e-08   Populus euphratica
ref|NP_001288977.1|  oxygen-evolving enhancer protein 3-1, chloro...  62.0    2e-08   Brassica rapa
gb|EMS52833.1|  Beta-amylase                                          63.5    2e-08   Triticum urartu
dbj|BAJ90882.1|  predicted protein                                    62.0    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU22404.1|  hypothetical protein MIMGU_mgv1a014459mg              61.2    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_010923989.1|  PREDICTED: oxygen-evolving enhancer protein ...  61.6    3e-08   Elaeis guineensis
dbj|BAJ93485.1|  predicted protein                                    58.9    4e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P12301.1|PSBQ_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...  61.2    4e-08   Spinacia oleracea
gb|EMT14797.1|  hypothetical protein F775_22951                       59.7    4e-08   
ref|NP_001236541.1|  uncharacterized protein LOC100306034             61.2    5e-08   Glycine max [soybeans]
ref|XP_010539217.1|  PREDICTED: oxygen-evolving enhancer protein ...  59.7    5e-08   
gb|ACJ61487.1|  oxygen-evolving enhancer protein 3                    60.8    5e-08   Glycine max [soybeans]
gb|KHN34510.1|  Oxygen-evolving enhancer protein 3-2, chloroplastic   60.8    5e-08   Glycine soja [wild soybean]
ref|XP_009398204.1|  PREDICTED: oxygen-evolving enhancer protein ...  60.8    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN44565.1|  Oxygen-evolving enhancer protein 3-2, chloroplastic   60.5    7e-08   Glycine soja [wild soybean]
ref|XP_010267815.1|  PREDICTED: oxygen-evolving enhancer protein ...  60.5    7e-08   Nelumbo nucifera [Indian lotus]
gb|AHA84172.1|  chloroplast oxygen-evolving enhancer protein          60.5    7e-08   Phaseolus vulgaris [French bean]
ref|XP_007134497.1|  hypothetical protein PHAVU_010G052300g           60.1    8e-08   Phaseolus vulgaris [French bean]
ref|XP_008793745.1|  PREDICTED: oxygen-evolving enhancer protein ...  60.5    9e-08   Phoenix dactylifera
ref|NP_001047498.1|  Os02g0631100                                     58.2    1e-07   
ref|XP_008783622.1|  PREDICTED: psbQ-like protein 1, chloroplastic    58.9    2e-07   Phoenix dactylifera
ref|XP_010999548.1|  PREDICTED: oxygen-evolving enhancer protein ...  59.7    2e-07   Populus euphratica
gb|AAW28572.1|  Putative oxygen evolving enhancer protein 3, iden...  58.5    2e-07   Solanum demissum
ref|XP_009401413.1|  PREDICTED: psbQ-like protein 1, chloroplastic    58.2    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT06871.1|  hypothetical protein F775_26551                       56.6    4e-07   
ref|XP_008339879.1|  PREDICTED: psbQ-like protein 1, chloroplastic    57.8    4e-07   
ref|XP_004133817.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  57.8    5e-07   Cucumis sativus [cucumbers]
ref|XP_006355121.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  57.8    5e-07   Solanum tuberosum [potatoes]
ref|XP_006827305.1|  hypothetical protein AMTR_s00010p00265990        57.8    5e-07   Amborella trichopoda
ref|XP_010258294.1|  PREDICTED: psbQ-like protein 1, chloroplastic    57.4    7e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008437911.1|  PREDICTED: psbQ-like protein 1, chloroplastic    57.0    7e-07   Cucumis melo [Oriental melon]
dbj|BAJ92149.1|  predicted protein                                    55.5    7e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001059911.1|  Os07g0544800                                     57.4    9e-07   
ref|XP_006647554.1|  PREDICTED: psbQ-like protein 2, chloroplasti...  55.5    9e-07   
dbj|BAC83128.1|  putative Oxygen-evolving enhancer protein 3-1, c...  57.4    9e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ40187.1|  hypothetical protein OsJ_24632                        57.4    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760875.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  57.0    9e-07   Nicotiana sylvestris
ref|XP_006483122.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  57.0    1e-06   Citrus sinensis [apfelsine]
ref|XP_002272064.1|  PREDICTED: psbQ-like protein 1, chloroplastic    56.6    1e-06   Vitis vinifera
gb|AAU90312.1|  Putative oxygen evolving enhancer protein, identical  56.2    1e-06   Solanum demissum
gb|KHG11453.1|  Oxygen-evolving enhancer 3, chloroplastic             56.6    2e-06   Gossypium arboreum [tree cotton]
ref|XP_008776116.1|  PREDICTED: oxygen-evolving enhancer protein ...  56.6    2e-06   Phoenix dactylifera
gb|KJB66602.1|  hypothetical protein B456_010G146500                  56.6    2e-06   Gossypium raimondii
ref|XP_004298419.1|  PREDICTED: photosynthetic NDH subunit of lum...  55.8    2e-06   Fragaria vesca subsp. vesca
ref|XP_008389447.1|  PREDICTED: psbQ-like protein 1, chloroplastic    55.8    2e-06   Malus domestica [apple tree]
ref|XP_011070986.1|  PREDICTED: psbQ-like protein 1, chloroplastic    55.8    2e-06   Sesamum indicum [beniseed]
gb|EMS68689.1|  hypothetical protein TRIUR3_30148                     54.7    3e-06   Triticum urartu
ref|XP_010320690.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  55.5    3e-06   Solanum lycopersicum
ref|XP_007046041.1|  PsbQ-like 2                                      55.8    3e-06   Theobroma cacao [chocolate]
gb|ABO70330.1|  putative oxygen-evolving complex precursor            55.5    3e-06   Triticum aestivum [Canadian hard winter wheat]
gb|KJB80227.1|  hypothetical protein B456_013G087300                  55.5    4e-06   Gossypium raimondii
dbj|BAJ86288.1|  predicted protein                                    55.5    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010066898.1|  PREDICTED: psbQ-like protein 1, chloroplastic    55.1    5e-06   Eucalyptus grandis [rose gum]
ref|XP_009606199.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  54.7    5e-06   Nicotiana tomentosiformis
ref|XP_010931512.1|  PREDICTED: oxygen-evolving enhancer protein ...  55.5    5e-06   Elaeis guineensis
ref|XP_008802571.1|  PREDICTED: psbQ-like protein 1, chloroplastic    54.7    5e-06   Phoenix dactylifera
ref|XP_007225851.1|  hypothetical protein PRUPE_ppa011707mg           54.7    6e-06   Prunus persica
ref|XP_008221594.1|  PREDICTED: psbQ-like protein 1, chloroplastic    54.7    6e-06   Prunus mume [ume]
ref|XP_009117931.1|  PREDICTED: psbQ-like protein 1, chloroplastic    54.7    6e-06   Brassica rapa
ref|XP_002522463.1|  calcium ion binding protein, putative            54.7    6e-06   Ricinus communis
ref|XP_002454061.1|  hypothetical protein SORBIDRAFT_04g023940        55.1    6e-06   Sorghum bicolor [broomcorn]
ref|XP_003575224.1|  PREDICTED: psbQ-like protein 1, chloroplastic    55.1    6e-06   Brachypodium distachyon [annual false brome]
ref|XP_010939824.1|  PREDICTED: psbQ-like protein 1, chloroplastic    54.3    7e-06   Elaeis guineensis
gb|ACG30211.1|  oxygen evolving enhancer protein 3                    54.7    8e-06   Zea mays [maize]
ref|XP_010458897.1|  PREDICTED: psbQ-like protein 1, chloroplastic    54.3    9e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010108692.1|  Oxygen-evolving enhancer protein 3-1             54.3    9e-06   Morus notabilis
ref|XP_009148697.1|  PREDICTED: psbQ-like protein 1, chloroplastic    53.9    1e-05   Brassica rapa
emb|CDY49108.1|  BnaA06g08980D                                        53.9    1e-05   Brassica napus [oilseed rape]
gb|KDO75612.1|  hypothetical protein CISIN_1g026780mg                 54.3    1e-05   Citrus sinensis [apfelsine]
emb|CDP00358.1|  unnamed protein product                              53.9    1e-05   Coffea canephora [robusta coffee]
ref|XP_006647415.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  52.8    1e-05   
gb|KEH17774.1|  oxygen-evolving enhancer protein                      54.7    1e-05   Medicago truncatula
ref|XP_006417049.1|  hypothetical protein EUTSA_v10008853mg           53.5    1e-05   Eutrema salsugineum [saltwater cress]
ref|XP_010476452.1|  PREDICTED: psbQ-like protein 1, chloroplastic    53.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010495800.1|  PREDICTED: psbQ-like protein 1, chloroplastic    53.1    2e-05   Camelina sativa [gold-of-pleasure]
gb|ACG28532.1|  oxygen evolving enhancer protein 3                    53.5    2e-05   Zea mays [maize]
ref|XP_006305655.1|  hypothetical protein CARUB_v10010358mg           53.1    2e-05   Capsella rubella
ref|XP_008678727.1|  PREDICTED: psbQ-like protein 1, chloroplastic    53.5    2e-05   Zea mays [maize]
gb|KDP41224.1|  hypothetical protein JCGZ_15631                       53.1    2e-05   
gb|KHG13552.1|  Oxygen-evolving enhancer 3-2, chloroplastic -like...  53.5    3e-05   
dbj|BAF01486.1|  hypothetical protein                                 52.4    3e-05   
ref|XP_010683142.1|  PREDICTED: psbQ-like protein 1, chloroplastic    52.8    3e-05   
ref|XP_002977122.1|  hypothetical protein SELMODRAFT_106248           52.4    3e-05   
ref|XP_011001577.1|  PREDICTED: psbQ-like protein 3, chloroplastic    52.4    4e-05   
ref|NP_563937.1|  photosynthetic NDH subcomplex L2                    52.0    5e-05   
ref|XP_002890040.1|  hypothetical protein ARALYDRAFT_471574           52.0    5e-05   
ref|XP_004309658.1|  PREDICTED: oxygen-evolving enhancer protein ...  52.4    6e-05   
ref|XP_004952885.1|  PREDICTED: psbQ-like protein 1, chloroplasti...  52.0    7e-05   
ref|XP_003518016.2|  PREDICTED: psbQ-like protein 1, chloroplasti...  52.4    8e-05   
ref|XP_004953179.1|  PREDICTED: uncharacterized protein LOC101755864  49.3    2e-04   
ref|XP_006372574.1|  hypothetical protein POPTR_0017s02910g           50.4    2e-04   
gb|KHN01254.1|  Oxygen-evolving enhancer protein 3-2, chloroplastic   50.4    2e-04   
ref|XP_007153552.1|  hypothetical protein PHAVU_003G045300g           50.8    3e-04   
ref|NP_001047226.1|  Os02g0578400                                     50.1    4e-04   



>ref|XP_009597420.1| PREDICTED: psbQ-like protein 2, chloroplastic [Nicotiana tomentosiformis]
Length=222

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 178/222 (80%), Gaps = 3/222 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   NLN I EALSL PKLHG    +K+   + F  KK  EIQEN  LP  T RRLA+G
Sbjct  1    MANTTNLNCIFEALSLIPKLHGIEKIQKKTKPVSFFSKKTEEIQEN--LPAKTTRRLALG  58

Query  190  LASIAVFGSSGIGKSLAEDN-GFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LASIA+F +SGIGKSLAEDN GF++ GPLP+P+ +++I NKETGTRSF+K  +YIANIGT
Sbjct  59   LASIALFANSGIGKSLAEDNNGFFINGPLPVPSASNNIINKETGTRSFLKKGIYIANIGT  118

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG MYRL + AFDL+ALGDLIGSDAW+YV +YL IK+TFMYFDFD+VIS A+ N+KQPLT
Sbjct  119  KGRMYRLKRYAFDLLALGDLIGSDAWNYVRKYLCIKSTFMYFDFDEVISAAQVNDKQPLT  178

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFDN+E+LEDAVK++NL  T++ Y+ T  +LQEVM K
Sbjct  179  DLANRLFDNVEKLEDAVKQKNLPQTQTCYQETTTILQEVMEK  220



>ref|XP_009772888.1| PREDICTED: psbQ-like protein 2, chloroplastic [Nicotiana sylvestris]
Length=243

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +1

Query  7    AMAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAV  186
             MA   NLN I EALSL PKLH     +K+   + F  KK  EIQE   LP  T RRLA+
Sbjct  21   VMANTTNLNCIFEALSLIPKLHCVEKIQKKTKPVSFLSKKTEEIQEK--LPTQTTRRLAL  78

Query  187  GLASIAVFGSSGIGKSLAEDN-GFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            GLASIA+F +SGIG SLAEDN GF++TGPLP+P  +++I NKETGTR+F+K  +YIANIG
Sbjct  79   GLASIALFANSGIGNSLAEDNNGFFITGPLPVPLASNNIINKETGTRTFLKKGIYIANIG  138

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG ++RL + AFDL+ALGDLIGSDAW+YV +YLRIK+TFMYFDFD+VIS A+ N+KQPL
Sbjct  139  TKGRIHRLKRYAFDLLALGDLIGSDAWNYVRKYLRIKSTFMYFDFDEVISAAQVNDKQPL  198

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             DLANRLFDN+E+LEDAVK++NL  T++ Y+ T  +LQEVM K
Sbjct  199  MDLANRLFDNVEKLEDAVKQKNLPQTQTCYQETTTILQEVMEK  241



>ref|XP_006352484.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Solanum tuberosum]
Length=219

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 176/222 (79%), Gaps = 6/222 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   NLN+I EALSL PK+H     +K+A  I    +K  EIQEN P P+ T RRLA+ 
Sbjct  1    MANTTNLNIIFEALSLIPKIHNIEKIQKKAKTIS---QKKEEIQENSP-PKTT-RRLALS  55

Query  190  LASIAVFGSSGIGKSLAEDN-GFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            + SIA+F +S IG SLAEDN GF++TGPL  P+V+++I NKETGTRSF+K  MYIANIGT
Sbjct  56   IGSIALFANSRIGNSLAEDNNGFFITGPLQDPSVSTNIINKETGTRSFLKKGMYIANIGT  115

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG ++RL + AFDL+ALGDLIG+DAW+YV +YLRIK+TFMY+DFD+VI+ AE N+KQPLT
Sbjct  116  KGRIHRLKRYAFDLLALGDLIGTDAWNYVRKYLRIKSTFMYYDFDEVITAAEMNDKQPLT  175

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFDN+E+LEDAVKK+NL  T+S Y+ T  +LQ+VM +
Sbjct  176  DLANRLFDNVEKLEDAVKKKNLPQTQSCYQETTTILQQVMDR  217



>ref|XP_011095313.1| PREDICTED: psbQ-like protein 2, chloroplastic [Sesamum indicum]
Length=265

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 170/222 (77%), Gaps = 4/222 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   NLN I EAL   P+  G     K++    F DKK  E+QE   +P    RRLA+G
Sbjct  45   MATTANLNGIFEALPAIPRHRGIDKNPKKSRITCFLDKKKDEVQE---IPAQATRRLAIG  101

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+FG+  IGKSLAEDNGFWLTGPLP+P   + I N+ETGTRSF+K  +YIANIGTK
Sbjct  102  LASIALFGNISIGKSLAEDNGFWLTGPLPVPYANNKINNEETGTRSFLKKGIYIANIGTK  161

Query  370  GSMYRLNKCAFDLMALGDLIG-SDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            G M+RL + AFDL+A+GDLI   DAW+YV RYLR+K+TFMYFDFD+VIS A A++K+ LT
Sbjct  162  GRMHRLKRYAFDLIAMGDLIAQQDAWNYVRRYLRLKSTFMYFDFDEVISAAPADDKKSLT  221

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFDNIE+LEDAV+K+N+S TES Y+ T ++LQEVM++
Sbjct  222  DLANRLFDNIEKLEDAVRKQNVSQTESSYQATTLVLQEVMNR  263



>emb|CDP05807.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   261 bits (666),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 169/222 (76%), Gaps = 4/222 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   NL+ I EA S+ PKLH     RK+A  ++F  K+  E+QE+      T RRLA+G
Sbjct  1    MARATNLSGIFEAFSIIPKLHEVENIRKKATDVNFLSKRTDELQEDTL---QTTRRLALG  57

Query  190  LASIAVFGSS-GIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LAS+A+F +S   G SLAEDNG+WLTGP+P+P+  + I N++TGTRSF+K  +YIANIGT
Sbjct  58   LASLAIFSTSRAAGISLAEDNGYWLTGPIPVPSAKNKITNEDTGTRSFLKRGIYIANIGT  117

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG M+RL K AFDL+AL DLIG D ++YVL+YLR+K+TFMYFDFD+VI+ A   EKQPLT
Sbjct  118  KGRMHRLKKYAFDLLALEDLIGPDTFNYVLKYLRLKSTFMYFDFDEVITAAADGEKQPLT  177

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFD++E+LEDA K +NL  T+S Y+ T V+LQEVM++
Sbjct  178  DLANRLFDSVEKLEDAAKNQNLPRTQSLYQDTTVILQEVMNR  219



>ref|XP_004248376.1| PREDICTED: psbQ-like protein 2, chloroplastic [Solanum lycopersicum]
Length=216

 Score =   260 bits (665),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 174/222 (78%), Gaps = 9/222 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   NLN+I EAL L PK+      +K+A  I    +K  EIQEN P P++T RRLA+ 
Sbjct  1    MANTTNLNIIFEALPLIPKIE---KIQKKAKTIS---QKNKEIQENSP-PKIT-RRLALS  52

Query  190  LASIAVFGSSGIGKSLAEDN-GFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            + SIA+F +S I  SLAEDN GF++TGPL  P+++++I NKETGTRSF+K  MYIANIGT
Sbjct  53   IGSIALFANSRIDISLAEDNNGFFITGPLQDPSISTNIINKETGTRSFLKKGMYIANIGT  112

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG ++RL + AFDL+ALGDLIG+D+W+YV +YLRIK+TFMY+DFD+VI+ A+ N+KQPLT
Sbjct  113  KGRIHRLKRYAFDLLALGDLIGTDSWNYVRKYLRIKSTFMYYDFDEVITAAQVNDKQPLT  172

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFDN+E+LEDAVKK+NL  T+S Y+ T  +LQ+VM +
Sbjct  173  DLANRLFDNVEKLEDAVKKKNLPQTQSCYQETTTILQQVMDR  214



>ref|XP_002282744.1| PREDICTED: psbQ-like protein 2, chloroplastic [Vitis vinifera]
 emb|CAN78127.1| hypothetical protein VITISV_028757 [Vitis vinifera]
 emb|CBI20497.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   258 bits (660),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 164/222 (74%), Gaps = 4/222 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTAR-RKRAAAIHFADKKAPEIQENQPLPEVTKRRLAV  186
            MA + NL+   E L    KL G   R RKR   I F  KKA +IQE         RR A+
Sbjct  1    MAHLANLHGASETLPSIFKLRGDLRRTRKRVTIIGFLCKKAEQIQEQSF---QATRRSAL  57

Query  187  GLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            GL+SIA+ G+SGIG +LAEDNG+WLTGPLP+PTV +DI NKETGTRSF+K  +YIA++GT
Sbjct  58   GLSSIAILGNSGIGPALAEDNGYWLTGPLPVPTVDNDIVNKETGTRSFLKKGLYIADVGT  117

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG M RL K AFDL+AL DL+  DAW+Y  +YLR+K+TFMY+DFDK+IS    +EKQPLT
Sbjct  118  KGRMLRLKKYAFDLIALEDLMDKDAWNYFTKYLRLKSTFMYYDFDKLISAVPVDEKQPLT  177

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFD +E+LEDAVK R++S TESRY+ T  +LQEVM +
Sbjct  178  DLANRLFDCVEKLEDAVKIRDISQTESRYKDTKTVLQEVMDR  219



>gb|KDP39041.1| hypothetical protein JCGZ_00798 [Jatropha curcas]
Length=225

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 159/224 (71%), Gaps = 3/224 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN I E L   PKL      +KR   I F  KK     + Q     T RRLA+G
Sbjct  1    MAYLSNLNGITETLPATPKLTNKQKTQKRTKIIGFLGKKQVNFDQEQSFH--TTRRLALG  58

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTG-PLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LASIA+ G+ G G SLAEDNGFWL   PLP PTV + I N++TGTRSF+K  +Y+ANIG 
Sbjct  59   LASIALTGNFGNGISLAEDNGFWLLDFPLPSPTVDNKIANEKTGTRSFIKKGVYMANIGV  118

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
             GSMYR+ K AFDL+AL DLIG D  +YV +YLR+K+TFMY+DFDKVIS A  N+KQPLT
Sbjct  119  AGSMYRIRKYAFDLLALEDLIGPDTLNYVRKYLRLKSTFMYYDFDKVISAAPVNDKQPLT  178

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
            DLANRLFDN EELEDA +++NL  TES Y+GT V+LQEVM + P
Sbjct  179  DLANRLFDNFEELEDASRRKNLPQTESSYQGTKVILQEVMDRMP  222



>ref|XP_010247012.1| PREDICTED: psbQ-like protein 2, chloroplastic [Nelumbo nucifera]
Length=223

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + N N   E +   PK  G  +RR R   + FA K     +E+Q LP  T RR+A+G
Sbjct  5    MACVANFNGACEVIPTRPKTFGDLSRR-RTTVVGFACKNT---EESQRLPLQTTRRIAIG  60

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            L +IA+      G SLAEDNGFWLTGP+P+P V + I N+ETGTRSF+K  +YIAN+G K
Sbjct  61   LPAIALSFPFSSGASLAEDNGFWLTGPIPVPPVFNKIANEETGTRSFLKKGIYIANVGPK  120

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            GS YRL K AFDLMALGDLIG DAWSY+ +YLR+K+T MY+DFD VIS A AN+KQPL  
Sbjct  121  GSAYRLRKYAFDLMALGDLIGKDAWSYIRKYLRLKSTIMYYDFDTVISAAPANDKQPLIG  180

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LAN+LFD++E+LEDAVK +NL  T+S Y+ T  LLQEVM++
Sbjct  181  LANKLFDSVEKLEDAVKMQNLPQTQSCYQDTTALLQEVMNQ  221



>ref|XP_008244339.1| PREDICTED: psbQ-like protein 2, chloroplastic [Prunus mume]
Length=220

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L   P+L G    +KR + + F  KK  ++QE QPL   T RRLA+G
Sbjct  1    MAHLANLNGVSETLPAIPRLPGIQWTQKRVSIVGFMGKKKDDLQE-QPLH--TTRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+S  G SLAE NGFW+ GPLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASIALVGNSCNGVSLAEGNGFWIDGPLPVPSAENKIANEKTGTRSFLKKGLYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K AFDL+A+ DLI  D  +YV R+LR+K+TFMYFDFD+VIS A  +EKQPLTD
Sbjct  118  GRKFRLKKYAFDLLAMADLIAQDTLNYVRRFLRLKSTFMYFDFDQVISAAPVDEKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD +E+L+ AVK+RNLS TES Y+ T V+LQEVM +
Sbjct  178  LANRLFDTVEKLDGAVKQRNLSETESYYKDTTVILQEVMDR  218



>ref|XP_009358084.1| PREDICTED: psbQ-like protein 2, chloroplastic [Pyrus x bretschneideri]
 ref|XP_009358085.1| PREDICTED: psbQ-like protein 2, chloroplastic [Pyrus x bretschneideri]
Length=220

 Score =   246 bits (627),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 162/221 (73%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L + P+       RK+A+ I F  KK+ + QE QPL   T RR+A+G
Sbjct  1    MARLANLNGVSETLPVLPRFPSVQTTRKKASIICFTGKKSDDFQE-QPLQ--TTRRIALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LAS+A+ G+   G SLAE NGFWL GPLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASVALVGNFCNGVSLAEGNGFWLDGPLPVPSAQNKIANEKTGTRSFLKRGLYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K AFDL+A+ DLI  D  +YV RYLR+K+TFMYFDFD+VIS A  +EKQPLTD
Sbjct  118  GRKFRLKKYAFDLLAMADLIAKDTLNYVRRYLRLKSTFMYFDFDQVISAAPVDEKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD +E+L+ AVK+R+L  TE+ Y+ T V+LQEVM +
Sbjct  178  LANRLFDTVEKLDGAVKQRDLPRTETYYKDTTVVLQEVMDR  218



>ref|XP_008386026.1| PREDICTED: psbQ-like protein 2, chloroplastic [Malus domestica]
Length=220

 Score =   242 bits (618),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            M+ + N N + E L + P+        K+A+ I F  KK+  +QE QPL   T RRLA+G
Sbjct  1    MSHLXNXNGVSETLPVIPRFPSVQTTXKKASIICFMSKKSDGLQE-QPLQ--TTRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+S  G SLAE NGFWL GPLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASIALVGNSCNGVSLAEGNGFWLDGPLPVPSAENKIANEKTGTRSFLKRGIYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K AFDL+A+ DLI  D  +YV RYLR+K+TFMYFDFD+VIS A  +EKQPLTD
Sbjct  118  GRKFRLKKYAFDLLAMADLIAKDTLNYVRRYLRLKSTFMYFDFDRVISAAPVDEKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD +E+L+ AVK+R+L  TE+ Y+ T V+LQEVM +
Sbjct  178  LANRLFDTVEKLDGAVKQRDLLQTETYYKDTTVILQEVMDR  218



>ref|XP_009355577.1| PREDICTED: psbQ-like protein 2, chloroplastic [Pyrus x bretschneideri]
Length=220

 Score =   240 bits (612),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            M+ + NL  + E L++ P+       RK+A+ I F  KK+  +QE QPL ++T RRLA+G
Sbjct  1    MSRLANLKGVSETLTVIPRFPSVQTTRKKASIICFMSKKSDGLQE-QPL-QIT-RRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+   G SLAE NGFWL  PLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASIALVGNCCNGVSLAEGNGFWLDDPLPVPSAENKIANEKTGTRSFLKRGLYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K AFDL+A+ DLI  D  +YV RYLR+K+TFMYFDFD+VIS A  +EKQPLTD
Sbjct  118  GRKFRLKKYAFDLLAMADLIAKDTLNYVRRYLRLKSTFMYFDFDRVISAAPVDEKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD +E+L+ AVK+R+L  TE+ Y+ T V+LQ+VM +
Sbjct  178  LANRLFDTVEKLDGAVKQRDLLQTETYYKDTTVILQDVMDR  218



>ref|XP_010092309.1| Oxygen-evolving enhancer protein 3-1 [Morus notabilis]
 gb|EXB50943.1| Oxygen-evolving enhancer protein 3-1 [Morus notabilis]
Length=224

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 163/222 (73%), Gaps = 1/222 (0%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN I E L+   +L      +KRA  + F  KK  +  +++   + T+R+LA+G
Sbjct  1    MARLANLNGISETLAGALRLPSLRRTQKRANIVGFQGKKKDDHSQSEHNVQTTRRKLALG  60

Query  190  LASIAVFGSSGI-GKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LASIA+ G++   G SLAEDNGFW+ GPLP+PTV ++I N++TGTRSF+K  +Y+A+IGT
Sbjct  61   LASIALVGNTTCNGVSLAEDNGFWIDGPLPVPTVDNNIANEKTGTRSFLKKGIYMADIGT  120

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            K   YRL KCAFDL+AL DLIG D  +YV +YLR+K+TFMY+DFDKVI+ A  ++KQPLT
Sbjct  121  KNRKYRLRKCAFDLLALEDLIGKDTLNYVQKYLRLKSTFMYYDFDKVITAATVDDKQPLT  180

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             LANRLFD+ E+LE A K+RNL  TE+ Y+ T V+LQEVM +
Sbjct  181  HLANRLFDSFEKLEGATKQRNLPETETFYKDTKVILQEVMDR  222



>ref|XP_008355351.1| PREDICTED: psbQ-like protein 2, chloroplastic [Malus domestica]
Length=220

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (73%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L + P+       RK+A+ I F  KK+ + QE QPL   T RR+A+G
Sbjct  1    MARLANLNGVSETLPVLPRFPSVQTTRKKASFICFTGKKSNDFQE-QPLQ--TTRRIALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LAS+A+ G+   G SLAE NGFWL GPLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASVALVGNPCNGVSLAEGNGFWLDGPLPVPSAQNKIANEKTGTRSFLKRGLYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K A DL+A+ DLI  D  +YV RYLR+K+TFMYFDFD+VIS A  +EKQPLT+
Sbjct  118  GRKFRLKKYANDLLAMADLITKDTLNYVRRYLRLKSTFMYFDFDQVISAAPVDEKQPLTN  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD +E+L+ AVK+R+L  TE+ Y+ T V+LQEVM +
Sbjct  178  LANRLFDTVEKLDGAVKQRDLPQTETYYKDTTVVLQEVMDR  218



>ref|XP_004294334.1| PREDICTED: photosynthetic NDH subunit of lumenal location 3, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=222

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN I E L +  +L      RKR + I    KK       QPL   T RRLA+G
Sbjct  1    MAQLANLNGISETLPVLHRLPSIQKTRKRVSIIGCLGKKKDHDVLEQPLQ--TTRRLALG  58

Query  190  LASIAVFGSSGIGKSLAE-DNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LASIA+ G+S    +LAE +NGFWL GPLP+P+  + I N+ETGTRSF+KN +Y+A+IGT
Sbjct  59   LASIALVGNSSSEAALAEGNNGFWLDGPLPVPSADNKIANEETGTRSFLKNHLYMADIGT  118

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG  YRL K AFDL+A+ DLI  D  +YV +YLR+K+TFMYFDFDKVI+ A   EKQPLT
Sbjct  119  KGRKYRLKKYAFDLLAMADLIAQDTLNYVQKYLRLKSTFMYFDFDKVITAAPVTEKQPLT  178

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLF+ +E+L+ AV++RNLS TE+ Y+ T V+LQEVM +
Sbjct  179  DLANRLFNTVEKLDGAVRQRNLSETETYYQDTTVILQEVMDR  220



>ref|XP_002522826.1| Oxygen-evolving enhancer protein 3-1, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF39524.1| Oxygen-evolving enhancer protein 3-1, chloroplast precursor, 
putative [Ricinus communis]
Length=224

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 159/224 (71%), Gaps = 4/224 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN I E     PK+      ++RA  I    KK    +E+   P  T RRLA+G
Sbjct  1    MAHLANLNGISENCPAIPKITNKQRTKRRANIIGLLGKKQVNYEEH---PLQTTRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFW-LTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LAS+A+ G+SG G S AEDNGFW L  PL +P+V + + N++TGTRSF+K  +Y+A+IG 
Sbjct  58   LASVALIGNSGNGVSHAEDNGFWQLDFPLIVPSVDNKLANEKTGTRSFLKKGIYMADIGV  117

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KGSMYR+ KC FDL+AL DLIG D  +YV +YLR+K+TFMY+DFDKVIS A  ++KQ LT
Sbjct  118  KGSMYRIRKCGFDLLALEDLIGPDTLNYVRKYLRLKSTFMYYDFDKVISAAPVSDKQSLT  177

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
            DLAN+LFDN EELEDA +++NL  TE  Y+GT V+LQEVM + P
Sbjct  178  DLANKLFDNFEELEDASRRKNLPETELSYQGTKVILQEVMDRMP  221



>gb|EYU19203.1| hypothetical protein MIMGU_mgv1a013464mg [Erythranthe guttata]
Length=219

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 162/225 (72%), Gaps = 12/225 (5%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAP---EIQENQPLPEVTKRRL  180
            MA   N N+I       P +      +KRA    F DKK     E+  +  +  +T RRL
Sbjct  1    MATRANFNVI-------PTICSVEKIQKRARIACFFDKKKADEEEVDRDNSVQTIT-RRL  52

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            A+G+++IA+FG++ +GKS+A+DNGFWL GPLP+P  T+ I N+ETGTRSF++  +YIA++
Sbjct  53   AIGISTIALFGTATVGKSIADDNGFWLNGPLPVPYATNKINNEETGTRSFLRKGLYIADV  112

Query  361  GTKGSMYRLNKCAFDLMALGDLIGS-DAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            GTKG ++RL K AFDL+A+GDLI   DAW+YV RYLR+K+TFMYFDFD+VIS A  ++K+
Sbjct  113  GTKGRIHRLKKYAFDLIAMGDLIEQRDAWNYVRRYLRLKSTFMYFDFDEVISAAPVDDKK  172

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             LTDLANRLFDN+E+LE AV+K+N    ES YE T  LL+EVM++
Sbjct  173  SLTDLANRLFDNVEKLEAAVRKQNYPNIESCYEETTTLLEEVMTR  217



>ref|XP_007021089.1| PsbQ-like 1 [Theobroma cacao]
 gb|EOY12614.1| PsbQ-like 1 [Theobroma cacao]
Length=220

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 157/221 (71%), Gaps = 3/221 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            M  + NLN I E L   PKL      RK A  I F  K   +++E QPL ++T RR+A+ 
Sbjct  1    MVHLANLNGITETLPAIPKLPSIQRSRKTAKIIGFLGKNTEDLRE-QPL-QMT-RRMALS  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+S    SLAEDNG+W+T  LP+P+V ++I N++TGTRSFVK  +Y+AN+ TK
Sbjct  58   LASIALVGTSSNSISLAEDNGYWITDLLPVPSVENNIANEKTGTRSFVKKGLYVANLNTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
              MYRL K AFDL+A+ DLIG    SYV +YLR+K+T MY+DFDK+IS A  ++KQPLT 
Sbjct  118  NRMYRLKKYAFDLLAMADLIGPGTLSYVKKYLRLKSTVMYYDFDKIISAAPVDDKQPLTT  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFD+ E+LEDA K RNL  TES Y+ T V+LQEVM +
Sbjct  178  LANRLFDSFEKLEDAAKTRNLPQTESCYQNTKVILQEVMDR  218



>ref|XP_010060439.1| PREDICTED: psbQ-like protein 2, chloroplastic [Eucalyptus grandis]
Length=223

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 157/223 (70%), Gaps = 4/223 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNP--KLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLA  183
            M  + NLN + + L L+P   L    A RKR          +  +QE   L   T RR A
Sbjct  1    MEGLANLNGLSKTL-LSPVLALLSRRAARKRLTVNEHLGLTSDNLQEPH-LTLQTSRRTA  58

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            +GL S+A+ GS G G +LAEDNG+WLTGP+P+P + + I N++TGTRSFV+N +YIA+I 
Sbjct  59   LGLTSVALVGSLGSGLALAEDNGYWLTGPIPVPPIYNKIANEKTGTRSFVRNGIYIADIK  118

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
             KGSM+RL K AFDL+ALGDLIG D  +YV +YLR+K T MY+DFDKVIS A A++KQPL
Sbjct  119  VKGSMFRLRKYAFDLLALGDLIGKDVLNYVRKYLRLKGTVMYYDFDKVISAASASDKQPL  178

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLFD+ E+LEDA KK +L  T+S Y+ T ++LQEVM +
Sbjct  179  TDLANRLFDDFEKLEDAAKKEDLPETQSCYQDTSIILQEVMDR  221



>gb|KCW67214.1| hypothetical protein EUGRSUZ_F00997 [Eucalyptus grandis]
Length=275

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 158/224 (71%), Gaps = 4/224 (2%)
 Frame = +1

Query  7    AMAAIPNLNLILEALSLNP--KLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRL  180
            +M  + NLN + + L L+P   L    A RKR          +  +QE   L   T RR 
Sbjct  52   SMEGLANLNGLSKTL-LSPVLALLSRRAARKRLTVNEHLGLTSDNLQEPH-LTLQTSRRT  109

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            A+GL S+A+ GS G G +LAEDNG+WLTGP+P+P + + I N++TGTRSFV+N +YIA+I
Sbjct  110  ALGLTSVALVGSLGSGLALAEDNGYWLTGPIPVPPIYNKIANEKTGTRSFVRNGIYIADI  169

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
              KGSM+RL K AFDL+ALGDLIG D  +YV +YLR+K T MY+DFDKVIS A A++KQP
Sbjct  170  KVKGSMFRLRKYAFDLLALGDLIGKDVLNYVRKYLRLKGTVMYYDFDKVISAASASDKQP  229

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LTDLANRLFD+ E+LEDA KK +L  T+S Y+ T ++LQEVM +
Sbjct  230  LTDLANRLFDDFEKLEDAAKKEDLPETQSCYQDTSIILQEVMDR  273



>gb|KJB81837.1| hypothetical protein B456_013G164200 [Gossypium raimondii]
Length=223

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 150/223 (67%), Gaps = 2/223 (1%)
 Frame = +1

Query  4    LAMAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLA  183
            + MA + +LN I E L   PKL      RK +  I F  K         PL   T RR+A
Sbjct  1    MKMAHLASLNGITETLPAIPKLPTIRRTRKTSKIIGFLGKNTSNFHGQPPLQ--TTRRMA  58

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            +  ASIA+ G+S  G SLAEDNG+W+T  LP+P+V + I N +TGTRSFVK  +Y+AN+ 
Sbjct  59   LAFASIALIGTSTNGISLAEDNGYWITDLLPVPSVKNKITNADTGTRSFVKKGLYVANLN  118

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TK  MYRL K AFDL+A+ DLIG D  +YV +YLR+K+T MY+DFDK+IS A  ++KQPL
Sbjct  119  TKNRMYRLKKYAFDLLAMADLIGPDTLNYVKKYLRLKSTVMYYDFDKIISAAATDDKQPL  178

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              LANRLFD+ E+LEDA K RNL  TES Y+ T V+LQEVM +
Sbjct  179  ITLANRLFDSFEKLEDAAKMRNLPQTESCYQDTKVILQEVMDR  221



>gb|EYU19204.1| hypothetical protein MIMGU_mgv1a013464mg [Erythranthe guttata]
Length=217

 Score =   227 bits (579),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 160/225 (71%), Gaps = 14/225 (6%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAP---EIQENQPLPEVTKRRL  180
            MA   N N+I       P +      +KRA    F DKK     E+  +  +  +T RRL
Sbjct  1    MATRANFNVI-------PTICSVEKIQKRARIACFFDKKKADEEEVDRDNSVQTIT-RRL  52

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            A+G+++IA+FG++ +GKS+A+DNGFWL GPLP+P  T+ I N+ETGTRSF++  +YIA++
Sbjct  53   AIGISTIALFGTATVGKSIADDNGFWLNGPLPVPYATNKINNEETGTRSFLRKGLYIADV  112

Query  361  GTKGSMYRLNKCAFDLMALGDLIGS-DAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            GTKG ++RL K AFDL+A+GDLI   DAW+YV RYLR+K+TFMYFDFD+VIS A  ++K+
Sbjct  113  GTKGRIHRLKKYAFDLIAMGDLIEQRDAWNYVRRYLRLKSTFMYFDFDEVISAAPVDDKK  172

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             LTDLANRLFDN+E+   AV+K+N    ES YE T  LL+EVM++
Sbjct  173  SLTDLANRLFDNVEKA--AVRKQNYPNIESCYEETTTLLEEVMTR  215



>gb|KJB81838.1| hypothetical protein B456_013G164200 [Gossypium raimondii]
Length=224

 Score =   225 bits (573),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 151/224 (67%), Gaps = 3/224 (1%)
 Frame = +1

Query  4    LAMAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLA  183
            + MA + +LN I E L   PKL      RK +  I F  K         PL   T RR+A
Sbjct  1    MKMAHLASLNGITETLPAIPKLPTIRRTRKTSKIIGFLGKNTSNFHGQPPLQ--TTRRMA  58

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTV-TSDIRNKETGTRSFVKNQMYIANI  360
            +  ASIA+ G+S  G SLAEDNG+W+T  LP+P+V  ++I N +TGTRSFVK  +Y+AN+
Sbjct  59   LAFASIALIGTSTNGISLAEDNGYWITDLLPVPSVKNTEITNADTGTRSFVKKGLYVANL  118

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
             TK  MYRL K AFDL+A+ DLIG D  +YV +YLR+K+T MY+DFDK+IS A  ++KQP
Sbjct  119  NTKNRMYRLKKYAFDLLAMADLIGPDTLNYVKKYLRLKSTVMYYDFDKIISAAATDDKQP  178

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            L  LANRLFD+ E+LEDA K RNL  TES Y+ T V+LQEVM +
Sbjct  179  LITLANRLFDSFEKLEDAAKMRNLPQTESCYQDTKVILQEVMDR  222



>ref|XP_006475299.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Citrus sinensis]
Length=236

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 153/223 (69%), Gaps = 5/223 (2%)
 Frame = +1

Query  7    AMAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAV  186
            +MA + NLN + E L   P L      +KRA  I     KA   Q+   +     RR+++
Sbjct  16   SMAHLANLNGVSETLPAVPNLPKFQKFQKRAKIIGLLGHKAENFQDQAQI----TRRVSL  71

Query  187  GLASIAVFGSSGI-GKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            GLAS+A+ GS+   G SLAEDNG W+TGPLP+P V ++I N++TGTRSF+K  +YIANIG
Sbjct  72   GLASLALIGSTSTNGVSLAEDNGLWVTGPLPVPPVYNNIANEKTGTRSFLKKAIYIANIG  131

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG ++RL + AFDL+A+ DLIG D  +YV +YLR+K+TFMY+DFD VIS A   +KQPL
Sbjct  132  TKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPTDKQPL  191

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLF++ E+LE AV  +N   T+S Y  T V+L EVM +
Sbjct  192  TDLANRLFESFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDR  234



>ref|XP_006452143.1| hypothetical protein CICLE_v10009429mg [Citrus clementina]
 gb|ESR65383.1| hypothetical protein CICLE_v10009429mg [Citrus clementina]
Length=220

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 153/222 (69%), Gaps = 5/222 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L   P L      +KRA  I     KA   Q+   +     RR+++G
Sbjct  1    MAHLANLNGVSETLPAVPNLPKFQKFQKRAKIIGLLGHKAENFQDQAQI----TRRVSLG  56

Query  190  LASIAVFGS-SGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGT  366
            LAS+A+ GS S  G SLAEDNG W+TGPLP+P V ++I +++TGTRSF+K  +YIANIGT
Sbjct  57   LASLALIGSTSSNGASLAEDNGLWVTGPLPVPPVYNNIASEKTGTRSFLKKAIYIANIGT  116

Query  367  KGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLT  546
            KG ++RL + AFDL+A+ DLIG D  +YV +YLR+K+TFMY+DFD VIS A  ++KQPLT
Sbjct  117  KGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPSDKQPLT  176

Query  547  DLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            DLANRLFD+ E+LE AV  +N   T+S Y  T V+L EVM +
Sbjct  177  DLANRLFDSFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDR  218



>gb|KDO46378.1| hypothetical protein CISIN_1g026590mg [Citrus sinensis]
Length=236

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 152/223 (68%), Gaps = 5/223 (2%)
 Frame = +1

Query  7    AMAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAV  186
            +MA + NLN + E L   P L       KRA  I     KA   Q+   +     RR+++
Sbjct  16   SMAHLANLNGVSETLPAVPNLPKFQKFPKRAKIIGLLGHKAENFQDQAQI----TRRVSL  71

Query  187  GLASIAVFGSSGI-GKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            GLAS+A+ GS+   G SLAEDNG W+TGPLP+P V ++I N++TGTRSF+K  +YIANIG
Sbjct  72   GLASLALIGSTSTNGVSLAEDNGLWVTGPLPVPPVYNNIANEKTGTRSFLKKAIYIANIG  131

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG ++RL + AFDL+A+ DLIG D  +YV +YLR+K+TFMY+DFD VIS A   +KQPL
Sbjct  132  TKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPTDKQPL  191

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLF++ E+LE AV  +N   T+S Y  T V+L EVM +
Sbjct  192  TDLANRLFESFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDR  234



>ref|XP_006409231.1| hypothetical protein EUTSA_v10022842mg [Eutrema salsugineum]
 gb|ESQ50684.1| hypothetical protein EUTSA_v10022842mg [Eutrema salsugineum]
Length=220

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 155/223 (70%), Gaps = 7/223 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +   L   PKL      RK   +  F  +K+ E QE  P      RR+ +G
Sbjct  1    MAHFVDLNSLTNILPSIPKL---PQSRKTGKSSGFVCRKSGEFQE--PDSVQLTRRMTLG  55

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SI + G+ GI   SLA+DNGFW+ GPLPIP + ++I N++TGTRSF+K  +Y+A+IG
Sbjct  56   FAVSIGLTGTFGINNTSLAQDNGFWIDGPLPIPPIYNNITNEQTGTRSFLKKGVYVADIG  115

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  116  TKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISVAASQDKQPL  175

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  176  TDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  218



>ref|XP_007212107.1| hypothetical protein PRUPE_ppa011900mg [Prunus persica]
 gb|EMJ13306.1| hypothetical protein PRUPE_ppa011900mg [Prunus persica]
Length=191

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L   P+L G    +KR + + F  KK  + QE QPL   T RRLA+G
Sbjct  1    MARLANLNGVSETLPAIPRLPGIQGTQKRVSIVGFMGKKKDDFQE-QPLQ--TTRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+S  G SLAE NGFW+ GPLP+P+  + I N++TGTRSF+K  +Y+ANIGTK
Sbjct  58   LASIALVGNSCNGVSLAEGNGFWIDGPLPVPSAENKIANEKTGTRSFLKKGLYMANIGTK  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  +RL K AFDL+A+ DLI  D  +YV R+LR+K+TFMYFDFD+VIS A  +EKQPLTD
Sbjct  118  GRKFRLKKYAFDLLAMADLIAQDTLNYVRRFLRLKSTFMYFDFDQVISAAPVDEKQPLTD  177

Query  550  LANRLFDNIEEL  585
            LANRLFD +E++
Sbjct  178  LANRLFDTVEKV  189



>ref|XP_004151964.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Cucumis sativus]
 ref|XP_004170326.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Cucumis sativus]
 gb|KGN57960.1| hypothetical protein Csa_3G414060 [Cucumis sativus]
Length=215

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 150/221 (68%), Gaps = 8/221 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN    A+   PKL     R K    +    KK  ++  +Q    +T+R     
Sbjct  1    MARLANLNGKFSAIPNLPKLQNIHKRLKITGFL----KKQTDVSSHQI--SLTRRLALTS  54

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            L S+A+FG++     +A  N +WL GPLP+P+V ++I N++TGTRSF+K  +YIANIGTK
Sbjct  55   LVSVALFGNAS--PEIASANEYWLDGPLPVPSVDNNIVNEQTGTRSFLKTGIYIANIGTK  112

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  YRL K AFDL+A+ DLIG D  +YV +YLR+K+TFMY+DFDKVIS A  +EKQPL D
Sbjct  113  GRKYRLKKYAFDLLAMADLIGKDTLNYVRKYLRLKSTFMYYDFDKVISAAADDEKQPLVD  172

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFDN E+LEDA K++NLS TES Y+ T  +LQEVM +
Sbjct  173  LANRLFDNFEKLEDAAKQKNLSETESYYQQTTPILQEVMDR  213



>ref|XP_010463522.1| PREDICTED: psbQ-like protein 2, chloroplastic [Camelina sativa]
Length=220

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 155/224 (69%), Gaps = 9/224 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRL---  180
            MA   NLN +   LS  PKL      RK +    FA ++  E QE   + ++T+R     
Sbjct  1    MAHFLNLNSLTNTLSSIPKL---PESRKISKPAGFACRRTVECQELDSV-QITRRMTLGS  56

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            AV +    +FG + +  SLA+DNGFW+ GPLPIP + ++I N++TGTR+F+K  +Y+A+I
Sbjct  57   AVSIGLTGIFGQNNV--SLAQDNGFWIDGPLPIPPIYNNIVNEQTGTRTFIKKGVYVADI  114

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            GTKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQ 
Sbjct  115  GTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQS  174

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LTDLANRLFDN E+LEDA K +NLS TES Y  T +LLQEVM++
Sbjct  175  LTDLANRLFDNFEKLEDAAKAKNLSKTESCYTDTKILLQEVMTR  218



>ref|XP_010485415.1| PREDICTED: psbQ-like protein 2, chloroplastic [Camelina sativa]
Length=220

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 157/224 (70%), Gaps = 9/224 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRR---L  180
            MA   +LN +   L   PKL      RK + +  FA ++  E QE   + ++T+R     
Sbjct  1    MAHFLDLNSLTNTLPSIPKL---PESRKISKSSGFACRRTVEFQEPDSV-QITRRMTLGF  56

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
             V +    +FG++ +  SLA+DNGFW+ GPLPIP + ++I N++TGTR+F+K  +Y+A+I
Sbjct  57   TVSIGLTGIFGANNV--SLAQDNGFWIDGPLPIPPIYNNIVNEQTGTRTFIKKGVYVADI  114

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            GTKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS+A + +KQP
Sbjct  115  GTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISSAASEDKQP  174

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LTDLANRLFDN E+LEDA K +NL+ TES Y  T +LLQEVM++
Sbjct  175  LTDLANRLFDNFEKLEDAAKAKNLTKTESCYIDTKILLQEVMTR  218



>emb|CDY49054.1| BnaC05g48820D [Brassica napus]
Length=223

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +  + +L P +     R K   +  F  +KA ++QE   + E+T RR+++G
Sbjct  1    MAHFLDLNTLATSSTL-PSIPKLPERSKTGKSSVFVCRKADKVQEQGSVQELT-RRMSLG  58

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SIA+ G+ G    SLA+DNGFW+ GPLP P + ++I N++TGTRSF+K  +Y+A+IG
Sbjct  59   FAVSIALTGALGESNVSLAKDNGFWIDGPLPTPPIYNNIVNEQTGTRSFLKKGVYVADIG  118

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG  YR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  119  TKGRTYRVKKYAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISVAASQDKQPL  178

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
            TDLANRLFDN E+LEDA K++NL+ TE+ Y+ T ++LQEVM
Sbjct  179  TDLANRLFDNFEKLEDAAKRKNLAETEACYKDTKLILQEVM  219



>ref|XP_006408504.1| hypothetical protein EUTSA_v10021484mg [Eutrema salsugineum]
 gb|ESQ49957.1| hypothetical protein EUTSA_v10021484mg [Eutrema salsugineum]
Length=220

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 153/223 (69%), Gaps = 7/223 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +   L   P+L      RK   +  F  +K  E QE  P      RR+ +G
Sbjct  1    MAHFIDLNSLTNILPSIPRL---PQSRKTGKSSGFVCRKTGEFQE--PDSVQLTRRMTLG  55

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SI + G+ GI   SLA+DNGFW+ GPLPIP + ++I N++TGTRSF+K  +Y+A+IG
Sbjct  56   FAVSIGLTGTFGINNTSLAQDNGFWIDGPLPIPPIYNNITNEQTGTRSFLKKGVYVADIG  115

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG MYR+ K AFDL+A+ DLI  D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  116  TKGRMYRVKKNAFDLLAMEDLIEPDTLNYVKKYLRLKSTFLFYDFDNLISVAASEDKQPL  175

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  176  TDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  218



>ref|XP_010550108.1| PREDICTED: psbQ-like protein 2, chloroplastic [Tarenaya hassleriana]
Length=221

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 152/224 (68%), Gaps = 8/224 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + +L  + ++L   PKL      RK    + F  +K  E QE  P    T RR A+G
Sbjct  1    MAHLTDLKSLTKSLPAIPKL---PLERKTGKPVAFVSRKTGESQE--PDSVQTTRRKALG  55

Query  190  LA-SIAVFGSSGIGK--SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
             A S+ V G    GK  S AEDNGFW+ GPLP+P V ++I+N++TGTRSF+K  +Y+A+I
Sbjct  56   FAVSVTVTGICTGGKNVSRAEDNGFWIDGPLPVPPVYNNIKNEKTGTRSFLKKGVYVADI  115

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            GTK   YR+ K AFDL+A+ DLI  D  +YV +YLR+K+TFMY+DFD +IS A A +KQP
Sbjct  116  GTKNRRYRIKKNAFDLLAMEDLIEPDKLNYVRKYLRLKSTFMYYDFDNLISAAAAEDKQP  175

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LTD ANRLFDN+E+LEDA K +N   TES Y+ T VLLQ+VM+K
Sbjct  176  LTDFANRLFDNLEKLEDAAKTKNFPETESCYKETKVLLQDVMAK  219



>ref|XP_008454569.1| PREDICTED: psbQ-like protein 2, chloroplastic [Cucumis melo]
Length=215

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 150/221 (68%), Gaps = 8/221 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN    A+   PKL     + K    +    KK  ++  +Q    +T+R     
Sbjct  1    MARLANLNGKFSAIPNLPKLQNIHKKLKITGFL----KKQTDVSSHQI--SLTRRLALTS  54

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            L S+A+FG++     +A  N +WL GPLP+P+V ++I N++TGTRSF+K  +YIANIGTK
Sbjct  55   LVSVALFGNAS--PEIASANEYWLDGPLPVPSVDNNIANEQTGTRSFLKTGIYIANIGTK  112

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            G  YRL K AFDL+A+ DLIG D  +YV +YLR+K+TFMY+DFDKVIS A  +EKQPL D
Sbjct  113  GRKYRLKKYAFDLLAMADLIGKDTLNYVRKYLRLKSTFMYYDFDKVISAAADDEKQPLVD  172

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LANRLFDN E+LE+A K++NLS TES Y+ T  +LQEVM +
Sbjct  173  LANRLFDNFEKLENAAKQKNLSETESYYQQTTPILQEVMDR  213



>ref|NP_566137.1| PsbQ-like protein 1 [Arabidopsis thaliana]
 sp|Q9SGH4.1|PNSL3_ARATH RecName: Full=Photosynthetic NDH subunit of lumenal location 
3, chloroplastic; AltName: Full=PsbQ-like protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF24614.1|AC010870_7 hypothetical protein [Arabidopsis thaliana]
 gb|AAL50085.1| AT3g01440/T13O15_8 [Arabidopsis thaliana]
 gb|AAM10361.1| AT3g01440/T13O15_8 [Arabidopsis thaliana]
 gb|AEE73667.1| photosynthetic NDH subcomplex L3 [Arabidopsis thaliana]
Length=220

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 153/223 (69%), Gaps = 7/223 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +   L   PKL      RK   +  FA ++  E QE  P      RR+ +G
Sbjct  1    MAHFIDLNSLTNTLPSLPKL---PESRKTGKSSGFACRRTEEFQE--PDSVQITRRMTLG  55

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SI + G  G    SLA+DNGFW+ GPLPIP + ++I N++TGTR+F+K  +Y+A+IG
Sbjct  56   FAVSIGLTGILGENNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTRTFIKKGVYVADIG  115

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  116  TKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQPL  175

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  176  TDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  218



>ref|XP_006370609.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
 gb|ERP67178.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
Length=236

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 149/223 (67%), Gaps = 3/223 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L   PKL      ++R        KK   +Q N      T RRLA+G
Sbjct  1    MAHLTNLNGVTETLPAIPKLINVQKPQRRMKITGLLGKKPVNLQGNS---FQTTRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+   G SLAEDN +    PLP+P+  + + N+ETGTRSF+K  +Y+AN+G +
Sbjct  58   LASIALIGNPSTGVSLAEDNWWARDIPLPVPSAENKLANEETGTRSFLKKGIYMANVGLQ  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            GS  R+ + AFDL+AL DLIG D  +YV +YLRIK+TFMY+D D++IS    ++KQPLTD
Sbjct  118  GSARRVKRYAFDLLALEDLIGPDTLNYVRKYLRIKSTFMYYDLDRIISAVPVDDKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
            LANRLFDN E+LEDA +++NLS T+S Y  T  LLQEVM + P
Sbjct  178  LANRLFDNFEKLEDASRRKNLSDTKSSYRDTKALLQEVMQQNP  220



>ref|XP_002884281.1| oxygen evolving enhancer 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60540.1| oxygen evolving enhancer 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=220

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 155/223 (70%), Gaps = 7/223 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +      +P +   +  RK   +  FA +++ E QE   L     RRL +G
Sbjct  1    MAHFLDLNSLTNT---SPLITNLSENRKTGKSGGFACRRSEEFQEPDSLHFT--RRLTLG  55

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SI + G  G    SLA+DNGFW+ GPLPIP + ++I N++TGTR+F+K  +Y+A+IG
Sbjct  56   FAVSIGLTGILGESNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTRTFIKKGVYVADIG  115

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  116  TKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQPL  175

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLANRLFDN E+LEDA K +NL+ TES Y+ T +LLQEVM++
Sbjct  176  TDLANRLFDNFEKLEDAAKTKNLAETESCYKNTKILLQEVMTR  218



>gb|AAM61735.1| unknown [Arabidopsis thaliana]
Length=220

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 153/223 (69%), Gaps = 7/223 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA   +LN +   L   PKL      RK   +  FA ++  E QE  P      RR+ +G
Sbjct  1    MAHFIDLNSLTNTLPSLPKL---PESRKTGKSSGFACRRTEEFQE--PDSVQITRRMTLG  55

Query  190  LA-SIAVFGSSGIGK-SLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
             A SI + G  G    SLA+DNGFW+ GPLPIP + ++I N++TGTR+F+K  +Y+A+IG
Sbjct  56   FAVSIGLTGILGENNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTRTFIKKGVYVADIG  115

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
            TKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQPL
Sbjct  116  TKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQPL  175

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TDLAN+LFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  176  TDLANKLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  218



>ref|XP_009147432.1| PREDICTED: psbQ-like protein 2, chloroplastic [Brassica rapa]
 emb|CDY37521.1| BnaA05g33860D [Brassica napus]
Length=223

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 154/222 (69%), Gaps = 6/222 (3%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRR---L  180
            MA   +LN +  + +L P +     R K      F  +KA ++QE   + E+T+R     
Sbjct  1    MAHFLDLNTLTTSSTL-PSIPKLPERSKTGKFSVFVCRKADKVQEQGSVQELTRRMSLGF  59

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            AV +A    FG S +  SLA+DNGFW+ GPLP P + ++I N++TGTRSF+K  +Y+A+I
Sbjct  60   AVSIALTGAFGESNV--SLAKDNGFWIDGPLPTPPIYNNIVNEQTGTRSFLKKGVYVADI  117

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            GTKG  YR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +KQP
Sbjct  118  GTKGRTYRVKKYAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISVAASQDKQP  177

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
            LTDLANRLFDN E+LEDA K+++L+ TE+ Y+ T ++LQEVM
Sbjct  178  LTDLANRLFDNFEKLEDAAKRKSLAETEACYKDTKLILQEVM  219



>ref|XP_009418216.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=222

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 148/217 (68%), Gaps = 4/217 (2%)
 Frame = +1

Query  19   IPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVGLAS  198
            + NL    + L   P L G +  + R   +  +  K    +E +  P    RR +V +A 
Sbjct  5    LSNLGGASQILPTRPTLRGDSKPQSRWLTVTMSASKN---REPKCYPVQVSRRASVSIAM  61

Query  199  IAVFGSSGIGKSLAED-NGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTKGS  375
             ++    GIG S AE+ NG WLTGPLP+P VTS+I NKETGTRSF++N +Y+ANIG + S
Sbjct  62   ASLLQQLGIGSSQAEEGNGLWLTGPLPVPAVTSEIANKETGTRSFLRNGIYMANIGPQMS  121

Query  376  MYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLA  555
             YRL   AFDL+ALGDLIG DAWSY+++YL +++T MY+DFDKVIS A   +KQPLTDLA
Sbjct  122  AYRLKHYAFDLLALGDLIGQDAWSYLMKYLCLRSTVMYYDFDKVISAAPEEQKQPLTDLA  181

Query  556  NRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             RLFD++E+LE+A KKR+ ++T++ Y  T  +L+EV+
Sbjct  182  IRLFDSVEKLEEAAKKRSDTMTQACYADTEAILKEVI  218



>ref|XP_011048276.1| PREDICTED: psbQ-like protein 2, chloroplastic [Populus euphratica]
Length=236

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 148/223 (66%), Gaps = 3/223 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVG  189
            MA + NLN + E L   PKL      ++R        K+   +QEN        RRLA+G
Sbjct  1    MAHLTNLNGVTETLPAIPKLINVQKPQRRMKITGLLGKQPVNLQENS---FHATRRLALG  57

Query  190  LASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTK  369
            LASIA+ G+   G S AEDN +    PLP+P+V + + N+ETGTRSF+K  +Y+AN+G +
Sbjct  58   LASIALIGNPSTGVSRAEDNWWARDIPLPVPSVENKLANEETGTRSFLKKGIYMANVGLQ  117

Query  370  GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTD  549
            GS  R+ + AFDL+AL DLIG D  +YV +YLRIK+TFMY+D DK+IS    ++KQPLTD
Sbjct  118  GSARRVKRYAFDLLALEDLIGPDTLNYVRKYLRIKSTFMYYDLDKIISAVPVDDKQPLTD  177

Query  550  LANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
            LANRLFDN E+LEDA +++NL  T+S Y  T  LLQEVM + P
Sbjct  178  LANRLFDNFEKLEDASRRKNLPDTKSSYRDTKALLQEVMQQNP  220



>ref|XP_006298510.1| hypothetical protein CARUB_v10014586mg [Capsella rubella]
 gb|EOA31408.1| hypothetical protein CARUB_v10014586mg [Capsella rubella]
Length=220

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 155/224 (69%), Gaps = 9/224 (4%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRL---  180
            MA   +LN + + L   PKL      RK   +  FA ++  E QE   + ++T+R     
Sbjct  1    MAHFLDLNSLTKTLPWIPKL---PESRKVGKSSGFACRRTGEFQEPDSV-QITRRMTLGS  56

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANI  360
            AV +    +FG++ +  SLA+DNGFW+ GPL IP + ++I N++TGTR+F+K  +Y+A+I
Sbjct  57   AVSIGLTGIFGANNV--SLAQDNGFWIDGPLTIPPIYNNIVNEKTGTRTFIKKGVYVADI  114

Query  361  GTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            GTKG MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +K P
Sbjct  115  GTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKLP  174

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LTDLANRLFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  175  LTDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  218



>ref|XP_004487618.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Cicer arietinum]
Length=223

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKN  339
              T+R  A+ L S+ +        SLA+DNGFW+ GP+P PTVT+DI N++TGTRSF+K 
Sbjct  45   HTTRRGTALSLVSLVLTWQFNEKISLAKDNGFWIEGPIPEPTVTNDIANEKTGTRSFIKK  104

Query  340  QMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            ++Y+ANIGTKGS+ R+ K AFDL+A+ DLI  D  +YV RYLR+K+TF+YFDFDKVIS A
Sbjct  105  KLYMANIGTKGSVLRIKKYAFDLLAMADLIAQDTLNYVRRYLRLKSTFIYFDFDKVISAA  164

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              ++KQ LTD+AN+LFDN E+LE+A + +NLS T++ Y+ T V+L++VM +
Sbjct  165  PVDDKQKLTDMANKLFDNFEKLEEASRNKNLSETQACYKETEVMLKDVMDR  215



>ref|XP_010694269.1| PREDICTED: psbQ-like protein 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=234

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 129/173 (75%), Gaps = 4/173 (2%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGS--SGIGKSLA-EDNGFWLTGPLP-IPTVTSDIRNKETGTRSFV  333
            T RR  +G+ASIA+     +    SLA E+N  WLTGPLP +P   + I N+ETGTR+F+
Sbjct  60   TTRRSVLGIASIALLAQLDTNNNDSLAVEENQLWLTGPLPGLPPAENKIFNEETGTRTFL  119

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K  +Y+ANIGTKGS +RL K AFDLMALGDLI  D ++YV RYLR+K TFMY+DFDKVIS
Sbjct  120  KKGIYMANIGTKGSAHRLRKYAFDLMALGDLITQDTFNYVRRYLRLKGTFMYYDFDKVIS  179

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             +   +KQPLTDLANRLFDN E+L+DAVK ++L  T+S Y  T V+LQEVM +
Sbjct  180  ASSVPDKQPLTDLANRLFDNFEKLQDAVKLKDLPQTQSCYNKTTVILQEVMDR  232



>ref|XP_003596609.1| Oxygen-evolving enhancer protein 3-1 [Medicago truncatula]
 gb|AES66860.1| oxygen-evolving enhancer protein [Medicago truncatula]
Length=230

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 149/223 (67%), Gaps = 3/223 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTAR--RKRAAAIHFADKKAPEIQENQPLPEVTKRRLA  183
            MA + NL+ + + L+    L     R  +     + F   K  +I E + +   T+R  A
Sbjct  1    MAPLTNLHGVSKTLTPITCLVPNAQRTFKTGQVVVGFLGSKTKKISECESV-NTTRRAAA  59

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            + L S+ + G      SLA+DNGFW+ GP+P PTVT++I N++TGTRSF+K ++Y+ANIG
Sbjct  60   ISLVSLVLTGQFSEKISLAKDNGFWIDGPIPEPTVTNNIANEKTGTRSFIKKKLYMANIG  119

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
             KGS+ R+ K AFDL+A+ DLI  D  +YV RYLR+K+TFMYFDFDKVIS     +KQ L
Sbjct  120  AKGSVLRIKKYAFDLLAMADLIAQDTLNYVRRYLRLKSTFMYFDFDKVISAVPVEDKQQL  179

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            TD+AN+LFDN E+LE+A + +NL  T++ Y+ T V+L++VM +
Sbjct  180  TDVANKLFDNFEKLEEASRNKNLLETQACYKETEVMLKDVMDR  222



>gb|KFK37610.1| hypothetical protein AALP_AA3G005500 [Arabis alpina]
Length=218

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 152/224 (68%), Gaps = 15/224 (7%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRR---L  180
            MA   +LN +   L   PKL G    RK   +I    +K  E+QE   + ++T+R     
Sbjct  1    MANFIDLNTLTNTLPAIPKLLGS---RKTGKSI----RKNGELQEPDSV-QITRRMTLGF  52

Query  181  AVGLASIAVFGSSGIGKSLA-EDNGFWLTGPLPIPTVTS-DIRNKETGTRSFVKNQMYIA  354
            AV +    VFG   +  SLA E+NGFW+ GPLPIP + + DI N++TGTR+F+K  +YIA
Sbjct  53   AVSIGLTGVFGEKNV--SLAQENNGFWIDGPLPIPPIYNLDITNEQTGTRTFLKKGVYIA  110

Query  355  NIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEK  534
            +IGTK  MYR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +IS A + +K
Sbjct  111  DIGTKNRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISVAASQDK  170

Query  535  QPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
            QPL DLANRLF+N E+LEDA K++NL+ TES Y+ T  LLQEVM
Sbjct  171  QPLIDLANRLFNNFEKLEDAAKRKNLTETESCYKDTKFLLQEVM  214



>gb|AFK42657.1| unknown [Lotus japonicus]
Length=247

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 150/225 (67%), Gaps = 9/225 (4%)
 Frame = +1

Query  7    AMAAIPNLNLI---LEALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRR  177
             MA + NL+ +   L  ++  P +H      +R   + F  +K+ E  E     + T+R 
Sbjct  19   TMAPLTNLHGVSKNLTPITCLPNVHRTL---RRGHVVGFLGRKSQEFSECSV--QSTRRA  73

Query  178  LAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIAN  357
             A+  A++ + G      SLA DNGFW+ GPLP P V + I N++TGTRSF+K ++Y+AN
Sbjct  74   AAISFATLLLTGQFKDNVSLA-DNGFWIDGPLPEPIVINKIANEKTGTRSFLKKRLYMAN  132

Query  358  IGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            IG KGS+YR+ K AFDL+A+ DL+  D  +YV RYLR+K+TFMY DFDKVIS    +EKQ
Sbjct  133  IGVKGSVYRIKKYAFDLLAMADLVKEDTLNYVRRYLRLKSTFMYHDFDKVISATPVDEKQ  192

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             LTD+AN+LFDN E+LE+A +K+NLS T+S Y+ + +LL+EVM +
Sbjct  193  QLTDMANKLFDNFEKLEEASRKKNLSETKSCYQESEILLKEVMDR  237



>ref|XP_009125021.1| PREDICTED: psbQ-like protein 2, chloroplastic [Brassica rapa]
 emb|CDY28675.1| BnaCnng05610D [Brassica napus]
Length=219

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 134/174 (77%), Gaps = 3/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLA-SIAVFGS-SGIGKSLAEDN-GFWLTGPLPIPTVTSDIRNKETGTRSF  330
            ++ +R + +G A SIA+ G+  G   SLA+DN GFW+ GPLP P + ++I N++TGTRSF
Sbjct  44   QLPRRMMTLGFAVSIALSGTFGGDNVSLAQDNNGFWIDGPLPTPPIYNNIVNEQTGTRSF  103

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K  +Y+A+IGTKG  YR+ K AFDL+A+ DLIG D  +YV +YLR+K+TF+++DFD +I
Sbjct  104  LKKGVYVADIGTKGRTYRVKKYAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLI  163

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S A + +KQPLTDLANRLFDN E+LEDA K +NL+ TES Y+ T  LLQEVM++
Sbjct  164  SAAASQDKQPLTDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTR  217



>gb|KHN27980.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Glycine 
soja]
Length=232

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 150/229 (66%), Gaps = 13/229 (6%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARR---KRAAAIHF----ADKKAPEIQENQPLPEVT  168
            MA + NL+  +    +    H   A +   KR   I F    A K+A E Q      + T
Sbjct  1    MAPVTNLHGAVSKTLIPITCHLPNAHKSITKRGQVIGFLGSKAQKEASECQ-----VQAT  55

Query  169  KRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTG-PLPIPTVTSDIRNKETGTRSFVKNQM  345
            +R  A+GLA++ +        SLA+DNGFW    PLP PTVT++I N++TGTRSF+K  +
Sbjct  56   RRAAALGLATVVLTWQFNDKVSLAKDNGFWYEDHPLPGPTVTNNIANEKTGTRSFLKRGL  115

Query  346  YIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEA  525
            YIANIG KGS++R+ K AFDL+A+ DLI  D  +YV +YLR+K+TFMY+DFDKVIS    
Sbjct  116  YIANIGVKGSVFRIKKYAFDLLAMADLIAEDTLNYVRKYLRLKSTFMYYDFDKVISAIPV  175

Query  526  NEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++KQ LTD+AN+LFDN E LE+A +K++L  T+S Y+ T V+L+EVM K
Sbjct  176  DDKQQLTDMANKLFDNFERLEEASRKKSLPETKSCYQETEVMLKEVMDK  224



>ref|XP_003540422.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Glycine max]
Length=250

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 150/229 (66%), Gaps = 13/229 (6%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARR---KRAAAIHF----ADKKAPEIQENQPLPEVT  168
            MA + NL+  +    +    H   A +   KR   I F    A K+A E Q      + T
Sbjct  19   MAPVTNLHGAVSKTLIPITCHLPNAHKSITKRGQVIGFLGSKAQKEASECQ-----VQAT  73

Query  169  KRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTG-PLPIPTVTSDIRNKETGTRSFVKNQM  345
            +R  A+GLA++ +        SLA+DNGFW    PLP PTVT++I N++TGTRSF+K  +
Sbjct  74   RRAAALGLATVVLTWQFNDKVSLAKDNGFWYEDHPLPGPTVTNNIANEKTGTRSFLKRGL  133

Query  346  YIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEA  525
            YIANIG KGS++R+ K AFDL+A+ DLI  D  +YV +YLR+K+TFMY+DFDKVIS    
Sbjct  134  YIANIGVKGSVFRIKKYAFDLLAMADLIAEDTLNYVRKYLRLKSTFMYYDFDKVISAIPV  193

Query  526  NEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++KQ LTD+AN+LFDN E LE+A +K++L  T+S Y+ T V+L+EVM K
Sbjct  194  DDKQQLTDMANKLFDNFERLEEASRKKSLPETKSCYQETEVMLKEVMDK  242



>gb|AFK39659.1| unknown [Medicago truncatula]
Length=216

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 141/213 (66%), Gaps = 3/213 (1%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTAR--RKRAAAIHFADKKAPEIQENQPLPEVTKRRLA  183
            MA + NL+ + + L+    L     R  +     + F   K  +I E + +   T+R  A
Sbjct  1    MAPLTNLHGVSKTLTPITCLVPNAQRTFKTGQVVVGFLGSKTKKISECESV-NTTRRAAA  59

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            + L S+ + G      SLA+DNGFW+ GP+P PTVT++I N++TGTRSF+K ++Y+ANIG
Sbjct  60   ISLVSLVLTGQFSEKISLAKDNGFWIDGPIPEPTVTNNIANEKTGTRSFIKKKLYMANIG  119

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
             KGS+ R+ K AFDL+A+ DLI  D  +YV RYLR+K+TFMYFDFDKVIS     +KQ L
Sbjct  120  AKGSVLRIKKYAFDLLAMADLIAQDTLNYVRRYLRLKSTFMYFDFDKVISAVPVEDKQQL  179

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGT  642
            TD+ANRLFDN E+LE+A + +NL  T++ Y+ T
Sbjct  180  TDVANRLFDNFEKLEEASRNKNLLETQACYKET  212



>gb|KHN36736.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Glycine 
soja]
Length=233

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 146/225 (65%), Gaps = 4/225 (2%)
 Frame = +1

Query  10   MAAIPNLNLILEALSLNPKLHGGTARR---KRAAAIHFADKKAPEIQENQPLPEVTKRRL  180
            MA + NL+  +    +    H   A +   KR   I F   K  +   ++   + T+R  
Sbjct  1    MAPLTNLHGAVSKTLIPITCHLPNAHKSITKRGQVIGFLGSKTHQKDASECAVQATRRAA  60

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTG-PLPIPTVTSDIRNKETGTRSFVKNQMYIAN  357
            A+GLA++ +        SLA+DNGFW    PLP PTVT++I N +TGTRSF+K  +YIAN
Sbjct  61   ALGLATVVLTWKFNDKISLAKDNGFWYEDHPLPGPTVTNNIANAKTGTRSFLKRGIYIAN  120

Query  358  IGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            IG KGS++R+ K AFDL+A+ DLI  D  +YV +YLR+K+TFMY+DFDK+I     ++KQ
Sbjct  121  IGVKGSVFRIKKYAFDLLAMADLIAEDTLNYVRKYLRLKSTFMYYDFDKIIPAIPVDDKQ  180

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             LTD+AN+LFDN E LE+A +K++L  T+S Y+ T V+L+EVM +
Sbjct  181  QLTDMANKLFDNFERLEEASRKKSLPETKSCYQETEVMLKEVMDR  225



>ref|XP_006837007.1| hypothetical protein AMTR_s00098p00154060 [Amborella trichopoda]
 gb|ERM99860.1| hypothetical protein AMTR_s00098p00154060 [Amborella trichopoda]
Length=221

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = +1

Query  154  LPEVTKRRLAV-GLASIAVFGSSGIGKSLA-EDNGFWLTGPLPIPTVTSDIRNKETGTRS  327
            LP +T RR A+    ++ + G     KS A E N  WL GP  +P V++ I N+ETGTRS
Sbjct  44   LPPITSRRAALLSFTTLTLSGQLLTAKSQADEGNQLWLPGPFSLPPVSNKIANEETGTRS  103

Query  328  FVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKV  507
            F+K  +Y+ANIG KGS YRL K AFDL+++ DLI  DAWSYV ++LR+K+TFMY+DFDKV
Sbjct  104  FLKQGIYMANIGPKGSAYRLGKSAFDLLSMRDLIEQDAWSYVRQFLRLKSTFMYYDFDKV  163

Query  508  ISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            I+ A  ++K+PLT+LAN+LFD++E+LEDAVK R+L   ++ +E +  LLQEV+ +
Sbjct  164  ITAAPVDQKEPLTNLANKLFDSVEKLEDAVKSRSLPHAKASFEDSSALLQEVLDR  218



>ref|XP_010931504.1| PREDICTED: psbQ-like protein 2, chloroplastic [Elaeis guineensis]
Length=232

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  172  RRLAVGLASIAVFGSSGIGKSLAED--NGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQM  345
            RR +VGLA++ +F   G G S AE+  NG WLTGP+P P +TSDI NKETGTRSF++  +
Sbjct  62   RRASVGLATVTLFHLLGAGISHAEEENNGLWLTGPIPAPIITSDIANKETGTRSFLRKGI  121

Query  346  YIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEA  525
            YIA +G +   YRL   AFDL+ALGDL+G DAW+YV +YL +K+T MY+DFDK+IS A  
Sbjct  122  YIAKLGPQIIPYRLKHYAFDLLALGDLLGQDAWNYVRKYLCLKSTVMYYDFDKLISAAPV  181

Query  526  NEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             +KQPLTDLANRLFD++E+LE+AVKK++ SLTES Y  T V+L+EVM
Sbjct  182  EQKQPLTDLANRLFDSVEKLEEAVKKKSDSLTESCYADTEVILKEVM  228



>ref|XP_008793744.1| PREDICTED: LOW QUALITY PROTEIN: psbQ-like protein 2, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008778671.1| PREDICTED: LOW QUALITY PROTEIN: psbQ-like protein 2, chloroplastic 
[Phoenix dactylifera]
Length=232

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 143/196 (73%), Gaps = 9/196 (5%)
 Frame = +1

Query  112  FADKKAPEIQENQ-------PLPEVTKRRLAVGLASIAVFG--SSGIGKSLAEDNGFWLT  264
            FA+K     QE+Q        +     RR +VGLA++ +F   S+GI ++ AE+NG WLT
Sbjct  35   FANKSIDVFQESQLQFHSSSGISLQVSRRASVGLAAVTLFHLLSTGISRAEAENNGLWLT  94

Query  265  GPLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAW  444
            GP+P P VTS I NKETGTRSF++  +Y+A +G +   YRL   AFDL+ALGDL+G +AW
Sbjct  95   GPIPSPIVTSRIANKETGTRSFLRKGIYMAKLGPQIIPYRLKHYAFDLLALGDLLGXEAW  154

Query  445  SYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTE  624
            +YV +YL +K+T MY+DFDK+IS A   +KQPLTDLANRLFD++E+LE+AVKK++ SLT+
Sbjct  155  NYVRKYLCLKSTVMYYDFDKLISAAPEEQKQPLTDLANRLFDSVEKLEEAVKKKSDSLTQ  214

Query  625  SRYEGTLVLLQEVMSK  672
            S Y  T V+L+EVM++
Sbjct  215  SCYGDTEVILKEVMAR  230



>ref|XP_007149690.1| hypothetical protein PHAVU_005G090800g [Phaseolus vulgaris]
 gb|ESW21684.1| hypothetical protein PHAVU_005G090800g [Phaseolus vulgaris]
Length=248

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 140/218 (64%), Gaps = 17/218 (8%)
 Frame = +1

Query  67   LHGGTARR--------------KRAAAIHFADKKAPEIQENQPLPEVTKRRLAVGLASIA  204
            LHGG ++               KR   + F   K  E     P+ + T+R  A+GLA++ 
Sbjct  24   LHGGVSKTLIPLTCLPNAHNSIKRGQVVGFLGSKTQEEPSECPV-QATRRAAAIGLATLV  82

Query  205  VFGSSGIGKSLAEDNGFWLTG-PLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMY  381
            +        SLA+DNGFW+   PLP  TVT++I N++TGTRSF+K  +++ NIG KGS+ 
Sbjct  83   LTWPFNDKISLAKDNGFWVEDHPLPRLTVTNNIANEKTGTRSFLKRGLFMPNIGLKGSVQ  142

Query  382  RLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS-TAEANEKQPLTDLAN  558
            R+   +FDL+A+ DL+ +D  +YV +YLR+K+T +Y+DFDK+IS T   +EKQ LTD+AN
Sbjct  143  RIKHYSFDLLAMADLVHADTLNYVRKYLRLKSTIIYYDFDKLISATPVDDEKQQLTDMAN  202

Query  559  RLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +LFDN E LE+A + ++L  T+S Y+ T VLL+EVM +
Sbjct  203  KLFDNFERLEEASRNKSLPETQSCYQETEVLLREVMDR  240



>ref|XP_010445018.1| PREDICTED: psbQ-like protein 2, chloroplastic [Camelina sativa]
Length=137

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  289  TSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLR  468
             +DI N++TGTR+F+K  +YIA+IGTKG MYR+ K AFDL+A+ DLIG D  +YV +YLR
Sbjct  8    CTDIVNEQTGTRTFIKKGVYIADIGTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLR  67

Query  469  IKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLV  648
            +K+TF+++DFD +IS A + +KQPLTDLANRLFDN E+LEDA K +NL+ TES Y  T +
Sbjct  68   LKSTFLFYDFDNLISAAASEDKQPLTDLANRLFDNFEKLEDAAKAKNLTKTESCYIDTKI  127

Query  649  LLQEVMSK  672
            LLQEVM++
Sbjct  128  LLQEVMTR  135



>ref|XP_006452142.1| hypothetical protein CICLE_v10009429mg [Citrus clementina]
 gb|ESR65382.1| hypothetical protein CICLE_v10009429mg [Citrus clementina]
Length=182

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  292  SDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRI  471
            SDI +++TGTRSF+K  +YIANIGTKG ++RL + AFDL+A+ DLIG D  +YV +YLR+
Sbjct  54   SDIASEKTGTRSFLKKAIYIANIGTKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRL  113

Query  472  KATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVL  651
            K+TFMY+DFD VIS A  ++KQPLTDLANRLFD+ E+LE AV  +N   T+S Y  T V+
Sbjct  114  KSTFMYYDFDNVISAAAPSDKQPLTDLANRLFDSFEKLEVAVSTKNFPQTQSTYADTAVI  173

Query  652  LQEVMSK  672
            L EVM +
Sbjct  174  LHEVMDR  180



>ref|XP_003557699.1| PREDICTED: psbQ-like protein 2, chloroplastic [Brachypodium distachyon]
Length=233

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 121/187 (65%), Gaps = 16/187 (9%)
 Frame = +1

Query  160  EVTKRR-----LAVGLASIAVFGSSGIGKSLAED-------NGFWLTG-PLPIPTV-TSD  297
            E + RR     + +GLA+ AV  +S    +   D       NG+WLT  PLP+P +   +
Sbjct  45   EQSSRRSACLSIGLGLATAAVLHTSPAHAADNTDEDPEPANNGWWLTEFPLPVPKIRNKE  104

Query  298  IRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRI  471
            I N ETGTRSFVKN +Y+A+IG       YRL   AFDL+AL DL+G DA +YV +YLR+
Sbjct  105  INNDETGTRSFVKNGIYMADIGPSFAAHAYRLRSNAFDLLALEDLLGKDASNYVNKYLRL  164

Query  472  KATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVL  651
            K+TFMY+DFDK+I+ A+A+ K PL DLANRLFD+ E L+ AV  +      SRY  T V+
Sbjct  165  KSTFMYYDFDKLITAADADSKPPLIDLANRLFDSFERLQSAVTSKEDDAIGSRYADTKVI  224

Query  652  LQEVMSK  672
            LQE+M++
Sbjct  225  LQELMTR  231



>gb|ACG26647.1| oxygen evolving enhancer protein 3 containing protein [Zea mays]
Length=235

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  244  DNGFWLTG-PLPIP-TVTSDIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLM  411
            +NG+WLT  PLP+P  V  +I N ETGTRSF+KN +Y+A+IG       YRL   AFDL+
Sbjct  89   NNGWWLTEFPLPVPKIVNKEINNAETGTRSFLKNGIYMADIGPSFAAHAYRLRSTAFDLL  148

Query  412  ALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELED  591
            AL DL+G DA +YV +YLR+K+TFMY+DFDK+IS AE  +K P  DLANRLFD+ E L++
Sbjct  149  ALEDLLGKDASNYVNKYLRLKSTFMYYDFDKLISAAE--DKPPFVDLANRLFDSFETLQE  206

Query  592  AVKKRNLSLTESRYEGTLVLLQEVMSK  672
            AV  ++ +    RY  T ++LQE+M+K
Sbjct  207  AVTAKDDARIGDRYAETKLILQELMAK  233



>ref|NP_001141040.1| oxygen evolving enhancer protein 3 containing protein [Zea mays]
 gb|ACF85262.1| unknown [Zea mays]
 gb|ACG48907.1| oxygen evolving enhancer protein 3 containing protein [Zea mays]
 tpg|DAA59343.1| TPA: oxygen evolving enhancer protein 3 containing protein [Zea 
mays]
Length=231

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +1

Query  244  DNGFWLTG-PLPIP-TVTSDIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLM  411
            +NG+WLT  PLP+P  V  +I N ETGTRSF+KN +Y+A+IG       YRL   AFDL+
Sbjct  85   NNGWWLTEFPLPVPKIVNKEINNAETGTRSFLKNGIYMADIGPSFAAHAYRLRSTAFDLL  144

Query  412  ALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELED  591
            AL DL+G DA +YV +YLR+K+TFMY+DFDK+IS AE  +K P  DLANRLFD+ E L++
Sbjct  145  ALEDLLGKDASNYVNKYLRLKSTFMYYDFDKLISAAE--DKPPFVDLANRLFDSFETLQE  202

Query  592  AVKKRNLSLTESRYEGTLVLLQEVMSK  672
            AV  ++ +    RY  T ++LQE+M+K
Sbjct  203  AVTAKDDARIGDRYAETKLILQELMAK  229



>ref|XP_002459208.1| hypothetical protein SORBIDRAFT_02g000550 [Sorghum bicolor]
 gb|EER95729.1| hypothetical protein SORBIDRAFT_02g000550 [Sorghum bicolor]
Length=237

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 6/168 (4%)
 Frame = +1

Query  181  AVGLASIAVFGSSGIGKSLAEDNGFWLTG-PLPIP-TVTSDIRNKETGTRSFVKNQMYIA  354
            AV L   AV  ++  G     +NG+WLT  PLP P  V  +I N ETGTRSF+KN +Y+A
Sbjct  70   AVLLRPRAVAAATDGGDEEPANNGWWLTEFPLPTPKIVNKEINNAETGTRSFIKNGIYMA  129

Query  355  NIGTK--GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEAN  528
            +IG       YRL   AFDL+AL DL+G DA +YV +YLR+K+TFMY+DFDK+IS A+  
Sbjct  130  DIGPSFAAHAYRLRSTAFDLLALEDLLGKDASNYVNKYLRLKSTFMYYDFDKLISAAD--  187

Query  529  EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +K    DLANRLFD+ E L++AV  ++      RY  T V+LQE+M+K
Sbjct  188  DKPTFVDLANRLFDSFETLQEAVTAKDDDRISGRYAETKVILQELMAK  235



>ref|XP_004987261.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Setaria italica]
Length=221

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 104/147 (71%), Gaps = 6/147 (4%)
 Frame = +1

Query  244  DNGFWLTG-PLPIPTV-TSDIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLM  411
            +NG+WLT  PLP+P +   +I N ETGTRSF+KN +++A+IG       YRL   AFDL+
Sbjct  75   NNGWWLTEFPLPVPKILNKEINNPETGTRSFLKNGIFMADIGPSFAAHAYRLRSNAFDLL  134

Query  412  ALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELED  591
            AL DL+G DA +YV +YLR+K+TFMY+DFDK+I+ A+  +K P  DLANRLFD+ E L+ 
Sbjct  135  ALEDLLGKDASNYVNKYLRLKSTFMYYDFDKLITAAD--DKGPYVDLANRLFDSFEALQQ  192

Query  592  AVKKRNLSLTESRYEGTLVLLQEVMSK  672
            AV  ++      RY  T V+LQE+M+K
Sbjct  193  AVTAKDDPKISDRYAETKVILQELMAK  219



>ref|NP_001058698.1| Os07g0105600 [Oryza sativa Japonica Group]
 dbj|BAC10375.1| PsbQ domain protein family, putative-like protein [Oryza sativa 
Japonica Group]
 dbj|BAD31937.1| PsbQ domain protein family, putative-like protein [Oryza sativa 
Japonica Group]
 dbj|BAD31119.1| PsbQ domain protein family, putative-like protein [Oryza sativa 
Japonica Group]
 dbj|BAF20612.1| Os07g0105600 [Oryza sativa Japonica Group]
 gb|EAZ02486.1| hypothetical protein OsI_24591 [Oryza sativa Indica Group]
 dbj|BAG90884.1| unnamed protein product [Oryza sativa Japonica Group]
Length=222

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 113/176 (64%), Gaps = 11/176 (6%)
 Frame = +1

Query  178  LAVGLASIAVFGSSGIGKSLAED-----NGFWLTG-PLPIP-TVTSDIRNKETGTRSFVK  336
            L+VGLA+ A           A D     NG+WLT  PLP+P  V  ++ N ETG+R+FV+
Sbjct  45   LSVGLAAAAATIFQHHPACAATDDEPANNGWWLTEFPLPVPKIVNKELNNGETGSRTFVR  104

Query  337  NQMYIANIGTK--GSMYRLNKCAFDLMALGDLIG--SDAWSYVLRYLRIKATFMYFDFDK  504
            N +YIA+IG       YRL   AFDL+AL DL+G  +D  +YV +YLR+K+TFMYFDFDK
Sbjct  105  NGIYIADIGPSYAAHAYRLRSTAFDLLALEDLLGNNADRANYVTKYLRLKSTFMYFDFDK  164

Query  505  VISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +IS A  +++ PL DLA RLFD+ E L+ A   ++ +   S Y  T ++LQEVM+K
Sbjct  165  LISAASDDQRPPLLDLATRLFDSFERLQKACGTKDDTQIGSSYADTKIILQEVMAK  220



>gb|EMT10187.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Aegilops 
tauschii]
Length=221

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 105/147 (71%), Gaps = 4/147 (3%)
 Frame = +1

Query  244  DNGFWLTG-PLPIPTV-TSDIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLM  411
            +NG+WLT  PLP+P +   +I N ETGTRSFVKN +Y+A+IG       YR+   AFDL+
Sbjct  73   NNGWWLTEFPLPVPKIRNKEINNGETGTRSFVKNGIYMADIGPSFAAHAYRVRSSAFDLL  132

Query  412  ALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELED  591
            AL DL+G +A +YV +YLR+KATF+Y+DFDK+I+  + + K PL DLANRLF + E+L+ 
Sbjct  133  ALEDLLGKEASNYVNKYLRLKATFIYYDFDKLITATDPDAKPPLLDLANRLFHSFEKLQA  192

Query  592  AVKKRNLSLTESRYEGTLVLLQEVMSK  672
            AV  ++ +   S Y  + ++LQEVM++
Sbjct  193  AVTTKDDADIGSCYADSKLILQEVMTR  219



>ref|XP_006658201.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Oryza brachyantha]
Length=222

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 109/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  178  LAVGLASIAVFGSSGIGKSLAED---NGFWLTG-PLPIP-TVTSDIRNKETGTRSFVKNQ  342
            L +GLA+  V        +  E+   NG+WLT  PLP+   V  ++ N ETG+R+FV+N 
Sbjct  47   LGLGLAATLVQQQQNAALAADEEPANNGWWLTEFPLPVKKIVNKELNNAETGSRTFVRNG  106

Query  343  MYIANIGTK--GSMYRLNKCAFDLMALGDLIG--SDAWSYVLRYLRIKATFMYFDFDKVI  510
            +YIA+IG       YRL   AFDL+AL DL+G  +D  +YV +YLR+K+TFMY+DFD ++
Sbjct  107  IYIADIGESYAAHAYRLRSTAFDLLALEDLLGNHADRANYVTKYLRLKSTFMYYDFDSLL  166

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S A A+ + PL DLA RLFD+ E L+ A   ++ +   + Y  T  +L EVM+K
Sbjct  167  SAAAADLRPPLLDLATRLFDSFETLQRATATKDDAQIAASYAHTKTILHEVMAK  220



>gb|EMS67145.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Triticum 
urartu]
Length=231

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  295  DIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLR  468
            +I N ETGTRSFVKN +Y+A+IG       YR+   AFDL+AL DL+G +A +YV +YLR
Sbjct  102  EINNGETGTRSFVKNGIYMADIGPSFAAHAYRVRSSAFDLLALEDLLGKEASNYVNKYLR  161

Query  469  IKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLV  648
            +KATF+Y+DFDK+I+TA+ + K PL  LANRLFD+ E+L+ AV  ++ +   S Y  T +
Sbjct  162  LKATFIYYDFDKLITTADLDAKPPLLGLANRLFDSFEKLQAAVTTKDDADIGSCYADTKL  221

Query  649  LLQEVMSK  672
            +LQEVM++
Sbjct  222  ILQEVMTR  229



>gb|EMS66651.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Triticum 
urartu]
Length=139

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +1

Query  295  DIRNKETGTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLR  468
            +I N E+GTRSFVKN +Y+A+IG       YR+    FDL+AL DL+G +A +YV +YLR
Sbjct  10   EINNGESGTRSFVKNGIYMADIGPSFAAHAYRIRSSTFDLLALEDLLGKEASNYVNKYLR  69

Query  469  IKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLV  648
            +KATF+Y+DFDK+I+ A+ + + PL  LANRLFD+ E L+ AV  ++ +   S Y  T +
Sbjct  70   LKATFIYYDFDKLITAADPDARPPLLGLANRLFDSFERLQAAVTTKDDADIGSCYADTKL  129

Query  649  LLQEVMSK  672
            +LQEVM++
Sbjct  130  ILQEVMTR  137



>gb|EAZ38418.1| hypothetical protein OsJ_22796 [Oryza sativa Japonica Group]
Length=129

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTK--GSMYRLNKCAFDLMALGDLIG--SDAWSYVLRYLRIKATF  483
            G+R+FV+N +YIA+IG       YRL   AFDL+AL DL+G  +D  +YV +YLR+K+TF
Sbjct  5    GSRTFVRNGIYIADIGPSYAAHAYRLRSTAFDLLALEDLLGNNADRANYVTKYLRLKSTF  64

Query  484  MYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEV  663
            MYFDFDK+IS A  +++ PL DLA RLFD+ E L+ A   ++ +   S Y  T ++LQEV
Sbjct  65   MYFDFDKLISAASDDQRPPLLDLATRLFDSFERLQKACGTKDDTQIGSSYADTKIILQEV  124

Query  664  MSK  672
            M+K
Sbjct  125  MAK  127



>ref|XP_006304628.1| hypothetical protein CARUB_v10011728mg, partial [Capsella rubella]
 gb|EOA37526.1| hypothetical protein CARUB_v10011728mg, partial [Capsella rubella]
Length=120

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 77/129 (60%), Gaps = 28/129 (22%)
 Frame = +1

Query  277  IPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL  456
            IP + ++I N +TGTR+F+K  +Y+A+IGTKG MYR+ K AFDL+A+ DLIG D  +YV 
Sbjct  6    IPPIYNNIVNGKTGTRTFIKKGVYVADIGTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVK  65

Query  457  RYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYE  636
            +                            TDLANRLFDN E LED+ K + L+ TES Y+
Sbjct  66   K----------------------------TDLANRLFDNFENLEDSAKTKILAETESCYK  97

Query  637  GTLVLLQEV  663
             T  LLQEV
Sbjct  98   DTQFLLQEV  106



>ref|XP_008340487.1| PREDICTED: psbQ-like protein 2, chloroplastic [Malus domestica]
Length=112

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLIGSD-AWSYVLRYLRIKATFMYFDFDKVISTAE  522
            + ++  KGS  R+ KCAFDL+++G DL   D +W  + R LR+K+TF+Y D +++IS + 
Sbjct  1    MVDMQLKGSACRIKKCAFDLLSIGNDLTNDDHSWELMGRDLRLKSTFLYCDLNQMISRSP  60

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
             ++K+ LT+LAN+LF +IEEL+ AVK R+L+LT+ RY    V+LQEVM+  P
Sbjct  61   RDQKRALTELANKLFCSIEELDQAVKIRSLALTQDRYNEAAVILQEVMALAP  112



>ref|XP_009351673.1| PREDICTED: psbQ-like protein 2, chloroplastic [Pyrus x bretschneideri]
 ref|XP_009341057.1| PREDICTED: psbQ-like protein 2, chloroplastic [Pyrus x bretschneideri]
Length=127

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLIGSD-AWSYVLRYLRIKATFMYFDFDKVISTAE  522
            + ++  KGS  R+ KCAFDL+++G DL   D +W  + R LR+K+TF+Y D +++IS + 
Sbjct  16   MVDMQLKGSACRIKKCAFDLLSIGNDLTNDDRSWELMGRDLRLKSTFLYCDLNQMISRSP  75

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
             ++K+ LT+LAN+LF +IEEL+ AVK R+L+LT+ RY    V+LQEVM+  P
Sbjct  76   RDQKRALTELANKLFCSIEELDHAVKIRSLALTQDRYNEAAVILQEVMALAP  127



>ref|XP_008389111.1| PREDICTED: psbQ-like protein 2, chloroplastic [Malus domestica]
Length=127

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 80/112 (71%), Gaps = 2/112 (2%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLIGSD-AWSYVLRYLRIKATFMYFDFDKVISTAE  522
            + ++  KGS  R+ KCAFDL+++G DL   D +W  + R LR+K+TF+Y D +++IS + 
Sbjct  16   MVDMQLKGSACRIKKCAFDLLSIGNDLTNDDHSWELMGRDLRLKSTFLYCDLNQMISRSP  75

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
             ++K+ LT+LAN+LF +IEEL+ AVK ++L LT+ RY    V+LQEVM+  P
Sbjct  76   RDQKRALTELANKLFCSIEELDHAVKIQSLPLTQDRYNEAAVILQEVMALAP  127



>ref|XP_008221012.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Prunus 
mume]
Length=113

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            + ++  KGS  R+ KCAF+L+++G DL+  G  +W  + R LR+K+TF+Y D +++IS A
Sbjct  1    MVDVQLKGSACRIKKCAFELLSIGSDLMNDGQSSWDLLGRDLRLKSTFLYCDLNQMISCA  60

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
              ++K+ LT+LAN+LF +IEEL+ A+K R++ LT+ RY    V+LQEV++  P
Sbjct  61   PRDQKRALTELANKLFCSIEELDHAMKIRSVPLTQDRYNQAAVVLQEVLALAP  113



>ref|XP_008221011.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X1 [Prunus 
mume]
Length=128

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            + ++  KGS  R+ KCAF+L+++G DL+  G  +W  + R LR+K+TF+Y D +++IS A
Sbjct  16   MVDVQLKGSACRIKKCAFELLSIGSDLMNDGQSSWDLLGRDLRLKSTFLYCDLNQMISCA  75

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
              ++K+ LT+LAN+LF +IEEL+ A+K R++ LT+ RY    V+LQEV++  P
Sbjct  76   PRDQKRALTELANKLFCSIEELDHAMKIRSVPLTQDRYNQAAVVLQEVLALAP  128



>ref|XP_007227647.1| hypothetical protein PRUPE_ppa017854mg, partial [Prunus persica]
 gb|EMJ28846.1| hypothetical protein PRUPE_ppa017854mg, partial [Prunus persica]
Length=116

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            + ++  KGS  R+ KCA +L+++G DL+  G  +W  + R LR+K+TF+Y D +++IS A
Sbjct  4    MVDVQLKGSACRIKKCALELLSIGSDLMNEGQSSWELLGRDLRLKSTFLYCDLNQMISCA  63

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
               +K+ LT+LAN+LF +IEEL+ A+K R++ LT+ RY    V+LQEVM+  P
Sbjct  64   PREQKRALTELANKLFCSIEELDHAMKIRSVPLTQDRYNQAAVVLQEVMALAP  116



>ref|XP_006847942.1| hypothetical protein AMTR_s00029p00134930 [Amborella trichopoda]
 gb|ERN09523.1| hypothetical protein AMTR_s00029p00134930 [Amborella trichopoda]
Length=109

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD--AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQP  540
            KGS  R+ KCA+DL+++ DLI  D  +W  V+R LR+++TF+Y DF+K+IS++  ++KQ 
Sbjct  4    KGSAIRIKKCAYDLLSIWDLIEEDQESWELVVRDLRLRSTFLYCDFNKLISSSSPDQKQA  63

Query  541  LTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            LTDLAN+LF  IE+L  A++ R++  T++ Y  T+ +L+EV++
Sbjct  64   LTDLANKLFSYIEQLAGALRTRSVDQTQNLYNDTVHVLEEVVA  106



>ref|XP_010940303.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
 ref|XP_010940304.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
 ref|XP_010940305.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=113

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            + ++  KGS+ R+ KCA DL++L  D++    D+W  + R LR+K+TF+Y D + VIS+A
Sbjct  1    MEDMDYKGSVLRIKKCACDLLSLEEDMVDDSEDSWELMGRDLRLKSTFLYCDLNHVISSA  60

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
                K+ LTDLAN+LFD +EEL+ AVK R++ LT+ RY    + LQEV+
Sbjct  61   RDEHKKTLTDLANKLFDFMEELDQAVKSRSIPLTQVRYNDAALALQEVV  109



>ref|XP_010940302.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=178

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTA  519
            + ++  KGS+ R+ KCA DL++L  D++    D+W  + R LR+K+TF+Y D + VIS+A
Sbjct  66   MEDMDYKGSVLRIKKCACDLLSLEEDMVDDSEDSWELMGRDLRLKSTFLYCDLNHVISSA  125

Query  520  EANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
                K+ LTDLAN+LFD +EEL+ AVK R++ LT+ RY    + LQEV+
Sbjct  126  RDEHKKTLTDLANKLFDFMEELDQAVKSRSIPLTQVRYNDAALALQEVV  174



>ref|XP_009389206.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389207.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389208.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389209.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389210.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KG +YR+ KC FDL+++ + +  D    W  +   LR+K+TF+Y D ++VIS A+   K+
Sbjct  7    KGCVYRIRKCVFDLLSMEEDLIDDDEDTWELMGSSLRLKSTFLYCDLNQVISRAKDERKK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
             LTDLAN+LF  +E+L+ AVK R++SLT+ RY  T  +LQEVM+
Sbjct  67   FLTDLANKLFCYMEQLDHAVKSRSISLTQIRYNDTAHVLQEVMA  110



>ref|XP_010907837.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=116

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KG + R+ KC  DL+++ + +  D   +W  + R LR+K+TF+Y D ++VIS A    ++
Sbjct  7    KGCVCRIKKCVLDLLSMEEDLIDDDEDSWELMGRDLRLKSTFLYCDLNQVISNATDEHRK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
             LTDLAN+LF N+EEL  AVK R++SL +  Y  T ++LQEVM+
Sbjct  67   ALTDLANKLFCNMEELGHAVKSRSISLMQVHYNDTALVLQEVMA  110



>ref|XP_008810530.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
Length=116

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KG + R+ KC  DL+++ + +  D   +W  + R LR+K+TF+Y D ++VIS A    K+
Sbjct  7    KGCVCRIKKCVLDLLSMEEDLIDDDEDSWELMGRDLRLKSTFLYCDLNQVISNATDEHKK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
             LTDLAN+LF N+EEL  AVK R++S  +  Y  T  +LQEVM+
Sbjct  67   ALTDLANKLFCNMEELGHAVKSRSISSMQVCYNDTAHVLQEVMA  110



>ref|XP_008803881.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
 ref|XP_008803889.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
 ref|XP_008803898.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
 ref|XP_008803905.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
Length=113

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KGS+ R+ KCAFDL++L + +  D   +W  + R LR+K+TF+Y D + VIS A    K+
Sbjct  7    KGSILRIKKCAFDLLSLEEDLVDDDEDSWELMGRDLRLKSTFLYCDLNHVISNARDEHKK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             LTDL N+LF  +EEL+ AVK R++SL + RY     +LQEV+
Sbjct  67   TLTDLGNKLFYFMEELDQAVKSRSISLIQIRYNDAAHVLQEVI  109



>ref|XP_009383037.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 71/113 (63%), Gaps = 20/113 (18%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALG------------DLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            KGS++R+ KC  DL+++             +L+GSD        LR+K+TF+Y D ++VI
Sbjct  7    KGSVHRIRKCVVDLLSMEDDLVDDDDEDAWELMGSD--------LRLKSTFLYCDLNQVI  58

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            S A    K+ LTDLAN+LF  +E+L+ AV+ R++SLT+  Y  T  +LQEVM+
Sbjct  59   SHAREERKKVLTDLANKLFYYMEQLDHAVRIRSMSLTQVCYNDTANVLQEVMA  111



>ref|XP_004297769.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_004297770.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=128

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL--RYLRIKATFMYFDFDKVISTAE  522
            + ++ +KG   R+ KCA +L++LG  +  DA+S+ L  R +R+K+ F+Y D  ++IS   
Sbjct  17   MVDMQSKGVGCRIKKCACELLSLGSDLMDDAYSWDLMGRDIRLKSMFLYCDLSQLISNVP  76

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
             ++K+ LT++ N+LF +IEEL+ AVK  ++ LT  RY    V+LQE++   P
Sbjct  77   KDQKKALTEVGNKLFSSIEELDHAVKIHSIPLTRDRYNEAGVILQELLVLMP  128



>ref|XP_004297771.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=112

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +1

Query  349  IANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL--RYLRIKATFMYFDFDKVISTAE  522
            + ++ +KG   R+ KCA +L++LG  +  DA+S+ L  R +R+K+ F+Y D  ++IS   
Sbjct  1    MVDMQSKGVGCRIKKCACELLSLGSDLMDDAYSWDLMGRDIRLKSMFLYCDLSQLISNVP  60

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSKWP  678
             ++K+ LT++ N+LF +IEEL+ AVK  ++ LT  RY    V+LQE++   P
Sbjct  61   KDQKKALTEVGNKLFSSIEELDHAVKIHSIPLTRDRYNEAGVILQELLVLMP  112



>ref|NP_193860.1| oxygen evolving complex of photosystem II subunit PsbQ [Arabidopsis 
thaliana]
 emb|CAA17547.1| photosystem II oxygen-evolving complex protein 3-like [Arabidopsis 
thaliana]
 emb|CAA20194.1| photosystem II oxygen-evolving complex protein 3-like [Arabidopsis 
thaliana]
 emb|CAB79128.1| photosystem II oxygen-evolving complex protein 3-like [Arabidopsis 
thaliana]
 gb|AAK91345.1| AT4g21280/F7J7_220 [Arabidopsis thaliana]
 gb|AAM16204.1| AT4g21280/F7J7_220 [Arabidopsis thaliana]
 gb|AAM65869.1| photosystem II oxygen-evolving complex protein 3-like [Arabidopsis 
thaliana]
 gb|AEE84435.1| oxygen evolving complex of photosystem II subunit PsbQ [Arabidopsis 
thaliana]
Length=223

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 90/174 (52%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +GL +  + G S +   LA+     + GP P P+      +     R F   
Sbjct  49   EETSRRSVIGLVAAGLAGGSFVQAVLADAISIKV-GPPPAPSGGLPGTDNSDQARDFALA  107

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  108  LKDRFYLQPLPPTEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTII  167

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+ L DL  +LFD I+ L+ A KK++ S  E  Y  T+  L EV++K
Sbjct  168  SSKPKDEKKSLKDLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAK  221



>ref|XP_008813765.1| PREDICTED: psbQ-like protein 2, chloroplastic [Phoenix dactylifera]
Length=114

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 74/105 (70%), Gaps = 4/105 (4%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTA-EANEK  534
            KGS+ R+ KCA DL++L + +  D   +W  + R LR+K+TF+Y D + VIS+A + ++K
Sbjct  7    KGSVLRIKKCASDLLSLEEDMIDDDEDSWELMGRDLRLKSTFLYCDLNHVISSARDEHKK  66

Query  535  QPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            + LTDLAN+LF  +EEL+ AVK R++ LT+  Y  T + LQEV++
Sbjct  67   KTLTDLANKLFYFMEELDQAVKSRSIPLTQILYSDTALALQEVIT  111



>ref|XP_010449093.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic 
[Camelina sativa]
Length=216

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +GL +  + G S +   LA+ N   +  P P+        N +   R F   
Sbjct  42   EETSRRSVIGLVAAGLAGGSFVQAVLADANPIKVGPPPPLSGGLPGTDNSDQA-RDFSLA  100

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  101  LKNRFYLQPLPPTEAAARAKESAQDIINVKSLIEKKAWPYVQNDLRSKASYLRYDLNTII  160

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+PL +L  +LFD I+ L+ A KK++ S  E  Y  T+  L EV++K
Sbjct  161  SSKPKDEKKPLKELTQKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAK  214



>ref|XP_006284392.1| hypothetical protein CARUB_v10005561mg, partial [Capsella rubella]
 gb|EOA17290.1| hypothetical protein CARUB_v10005561mg, partial [Capsella rubella]
Length=254

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +GL +  + G S +   LA+ N   +  P P         N +   R F   
Sbjct  80   EETSRRSVIGLVAAGLVGGSFVQAVLADANPIKVGPPPPPSGGLPGTDNSDQA-RDFSLA  138

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  139  LKNRFYLQPLPPTEAAARAKESAKDIINVKSLIEKKAWPYVQNDLRSKASYLRYDLNTII  198

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+PL DL  +LFD I+ L+ A KK++    E  Y  T+  L EV++K
Sbjct  199  SSKPKDEKKPLKDLTTKLFDTIDNLDYAAKKKSSPQAEKYYAETVSALNEVLAK  252



>ref|NP_001031687.1| oxygen evolving complex of photosystem II subunit PsbQ [Arabidopsis 
thaliana]
 sp|Q9XFT3.3|PSBQ1_ARATH RecName: Full=Oxygen-evolving enhancer protein 3-1, chloroplastic; 
Short=OEE3; AltName: Full=16 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=OEC 16 kDa subunit; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE84436.1| oxygen evolving complex of photosystem II subunit PsbQ [Arabidopsis 
thaliana]
Length=224

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 93/176 (53%), Gaps = 7/176 (4%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT--VTSDIRNKETGTRSF-  330
            E T RR  +GL +  + G S +   LA+     + GP P P+  + +   N +   R F 
Sbjct  49   EETSRRSVIGLVAAGLAGGSFVQAVLADAISIKV-GPPPAPSGGLPAGTDNSDQ-ARDFA  106

Query  331  --VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDK  504
              +K++ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + 
Sbjct  107  LALKDRFYLQPLPPTEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNT  166

Query  505  VISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +IS+   +EK+ L DL  +LFD I+ L+ A KK++ S  E  Y  T+  L EV++K
Sbjct  167  IISSKPKDEKKSLKDLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAK  222



>ref|XP_010935465.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
 ref|XP_010935466.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=113

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KGS+ R+ KCAFD ++L + +  D   +W  + R LR+K+TF+Y D + VIS +    K+
Sbjct  7    KGSVLRIKKCAFDFLSLEEDLIDDDDDSWELMGRDLRLKSTFLYCDLNHVISNSHDEHKK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             LTDL N+LF  +EEL+ AVK R++SL +  Y     +LQEV+
Sbjct  67   TLTDLGNKLFYFMEELDQAVKSRSISLIQIHYNDAAHVLQEVI  109



>ref|XP_010935464.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=139

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KGS+ R+ KCAFD ++L + +  D   +W  + R LR+K+TF+Y D + VIS +    K+
Sbjct  33   KGSVLRIKKCAFDFLSLEEDLIDDDDDSWELMGRDLRLKSTFLYCDLNHVISNSHDEHKK  92

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             LTDL N+LF  +EEL+ AVK R++SL +  Y     +LQEV+
Sbjct  93   TLTDLGNKLFYFMEELDQAVKSRSISLIQIHYNDAAHVLQEVI  135



>ref|XP_002317563.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
 gb|EEE98175.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
Length=103

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 8/83 (10%)
 Frame = +1

Query  430  GSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRN  609
            G D  ++V +YLRIK+TFMY+D DK+IS    N+KQPLTD  NRL   ++      +++N
Sbjct  13   GPDTLNHVRKYLRIKSTFMYYDLDKIISAVPVNDKQPLTD--NRLLTILK------RRKN  64

Query  610  LSLTESRYEGTLVLLQEVMSKWP  678
            LS TES Y  T VLLQ+VM + P
Sbjct  65   LSDTESSYRDTKVLLQDVMQQNP  87



>ref|NP_001053342.1| Os04g0522800 [Oryza sativa Japonica Group]
 dbj|BAF15256.1| Os04g0522800 [Oryza sativa Japonica Group]
 dbj|BAG90863.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61360.1| hypothetical protein OsJ_15503 [Oryza sativa Japonica Group]
Length=118

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 69/110 (63%), Gaps = 4/110 (4%)
 Frame = +1

Query  352  ANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTAE  522
              I  KG + R+N CA +L ++  DL+    D+W  + R LR+KATF+Y D  +VI + E
Sbjct  3    CGIELKGCICRINNCAVELFSMEEDLVIDDEDSWDLLARDLRLKATFLYIDLGRVICSCE  62

Query  523  ANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
             +E K+ LT LAN+ F  ++EL +AV  R++ L +  Y  T +LL+EV+S
Sbjct  63   IDEHKKMLTGLANKFFYFMDELTNAVSSRSIPLMQVCYSDTTLLLREVLS  112



>gb|ABQ23675.1| photosynthetic oxygen-evolving protein 16 kDa subunit [Salicornia 
veneta]
Length=233

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 108/230 (47%), Gaps = 10/230 (4%)
 Frame = +1

Query  7    AMAAIPNL----NLILE-ALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTK  171
            AMA++  L      +LE +L +N +L+G T  R     +    K      E    PE T 
Sbjct  4    AMASMAGLRGASQAVLEGSLQMN-RLNGPTTTRSGVPKLGLTVKAQQLSPETTSAPE-TS  61

Query  172  RRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKET---GTRSFVKNQ  342
            RR  +GL +  +   S +   LAE     +  P P         N +    GT  + K++
Sbjct  62   RRAILGLVAAGLTSGSFVKAVLAEAKSIPVGPPPPPSGGLPGTLNSDQARDGTLPYTKDR  121

Query  343  MYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAE  522
             Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D   VIS+  
Sbjct  122  FYLQPLPPTEAAARAKESAKDIINVKPLIDKKAWPYVQNDLRSKASYLRYDLKTVISSKP  181

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              EK+ L DL N+LFDNI  L+ A K ++ S  E  Y  T+  L +V++K
Sbjct  182  KGEKKSLEDLTNKLFDNINNLDYAAKMKSSSEAEKYYAETVTSLNDVITK  231



>ref|XP_010434201.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Camelina sativa]
Length=224

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 90/174 (52%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +G+ +  + G S +   LA+ N   +  P P+        N +   R F   
Sbjct  50   EETSRRSVIGIVAAGLAGGSFVQAVLADANPIKVGPPPPLSGGLPGTDNSDQA-RDFSLA  108

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  109  LKNRFYLQPLPPTEAAARAKESAQDIINVKSLIEKKAWPYVQNDLRSKASYLRYDLNTII  168

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+PL +L  +LFD I+ L+ A KK++    E  Y  T+  L EV++K
Sbjct  169  SSKPKDEKKPLKELTKKLFDTIDNLDYAAKKKSSPQAEKYYAETVSALNEVLAK  222



>ref|XP_006288420.1| hypothetical protein CARUB_v10001680mg, partial [Capsella rubella]
 gb|EOA21318.1| hypothetical protein CARUB_v10001680mg, partial [Capsella rubella]
Length=275

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q    +PE + RR  +GL +  + G S +  + AE     + GP P+P+      +    
Sbjct  94   QNESSVPESSSRRSVIGLVAAGLAGGSFVKNAFAEALAIKVGGP-PLPSGGLPGTDNSDQ  152

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  153  ARDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  212

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A K ++    E  Y  T+  L  V++
Sbjct  213  YDINTVISAKPKGEKQNLKELTGKLFQTIDNLDHAAKSKSSPDAEKYYSETVSSLNNVLA  272

Query  670  K  672
            K
Sbjct  273  K  273



>dbj|BAG70023.1| 16 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=233

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 107/230 (47%), Gaps = 10/230 (4%)
 Frame = +1

Query  7    AMAAIPNL----NLILE-ALSLNPKLHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTK  171
            AMA++  L      +LE +L +N +L+G T  R     +    K      E    PE T 
Sbjct  4    AMASMAGLRGASQAVLEGSLQMN-RLNGPTTTRSGVPKLGLTVKAQQLSPETTSAPE-TS  61

Query  172  RRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKET---GTRSFVKNQ  342
            RR  +GL +  +   S +    AE     +  P P         N +    GT  + K++
Sbjct  62   RRAILGLVAAGLTSGSFVKAVFAEAKSIPVGPPPPPSGGLPGTLNSDQARDGTLPYTKDR  121

Query  343  MYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAE  522
             Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D   VIS+  
Sbjct  122  FYLQPLPPTEAAARAKESAKDIINVKPLIDKKAWPYVQNDLRSKASYLRYDLKTVISSKP  181

Query  523  ANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              EK+ L DL N+LFDNI  L+ A K ++ S  E  Y  T+  L +V++K
Sbjct  182  KGEKKSLEDLTNKLFDNINNLDYAAKMKSSSEAEKYYAETVTSLNDVITK  231



>ref|XP_002869896.1| PSBQ/PSBQ-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46155.1| PSBQ/PSBQ-1 [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 88/174 (51%), Gaps = 3/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +GL +  + G S +   LA+ N   +  P P         +     R F   
Sbjct  49   EETSRRSVIGLVAAGLAGGSFVQAVLADANPIKVGPPPPPSGGLPAGTDNSDQARDFALA  108

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  109  LKDRFYLQPLPPTEAAARAKESAKDIINVKPLIEKKAWPYVQNDLRSKASYLRYDLNTII  168

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+ L +L  +LFD I+ L+ A KK++ S  E  Y  T+  L EV++K
Sbjct  169  SSKPKDEKKSLKELTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAK  222



>ref|XP_010439496.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Camelina sativa]
Length=224

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 90/174 (52%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +G+ +  + G S +   LA+ N   +  P P+        N +   R F   
Sbjct  50   EETSRRSVIGIVAAGLAGGSFVQAVLADANPIKVGPPPPLSGGLPGTDNSDQA-RDFSLA  108

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  109  LKSRFYLQPLPPTEAAARAKESAQDIINVKSLIEKKAWPYVQNDLRSKASYLRYDLNTII  168

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+PL +L  +LFD I+ L+ A KK++    E  Y  T+  L EV++K
Sbjct  169  SSKPKDEKKPLKELTKKLFDTIDNLDYAAKKKSSPQAEKYYAETVSALNEVLAK  222



>gb|AID21623.1| At4g21280p-like protein [Arabidopsis lyrata]
Length=223

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 4/174 (2%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E T RR  +GL +  + G S +   LA+ N   +  P P         N +   R F   
Sbjct  49   EETSRRSVIGLVAAGLAGGSFVQAVLADANPIKVGPPPPPSGGLPGTDNSDQA-RDFALA  107

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ Y+  +    +  R  + A D++ +  LI   AW YV   LR KA+++ +D + +I
Sbjct  108  LKDRFYLQPLPPTEAAARAKESAKDIINVKPLIEKKAWPYVQNDLRSKASYLRYDLNTII  167

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+ L +L  +LFD I+ L+ A KK++ S  E  Y  T+  L EV++K
Sbjct  168  SSKPKDEKKSLKELTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAK  221



>ref|XP_006413799.1| hypothetical protein EUTSA_v10026172mg [Eutrema salsugineum]
 gb|ESQ55252.1| hypothetical protein EUTSA_v10026172mg [Eutrema salsugineum]
Length=226

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 92/181 (51%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+++  PE T RR  +GL +  + G S +   LA+     +  P P         N +  
Sbjct  46   QQSESAPETT-RRSVIGLVAAGLAGGSFVQAVLADAAPIKIGPPPPPSGGLPGTENSDQA  104

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K + Y+  +    ++ R  + A D++ +  LI   AW YV   LR KA+++ 
Sbjct  105  -RDFSLALKKRFYLQPLPPAEAVARAKESAKDIINVKSLIDKKAWPYVQNDLRSKASYLR  163

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + +IS+   +EK+ L DL  +LFD+I  L+ A KK++    E  Y  T+  L +V++
Sbjct  164  YDLNTIISSKPKDEKKSLKDLTGKLFDSINSLDYAAKKKSTPDAEKYYSETVSTLNDVLA  223

Query  670  K  672
            K
Sbjct  224  K  224



>ref|XP_010422414.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Camelina sativa]
Length=230

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + G S +    AE     + GP P+P+      +    
Sbjct  50   QQNESVPE-SSRRSVIGLVAAGLAGGSFVKAVFAEAIPIKVGGP-PLPSGGLPGTDNSDQ  107

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  108  ARDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKGEKQGLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>ref|XP_010431656.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Camelina sativa]
Length=230

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + G S +    AE     + GP P+P+      +    
Sbjct  50   QQNESVPE-SSRRSVIGLVAAGLAGGSFVKAVFAEAIPIKVGGP-PLPSGGLPGTDNSDQ  107

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  108  ARDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKGEKQGLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>ref|XP_010455854.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Camelina sativa]
Length=230

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + G S +    AE     + GP P+P+      +    
Sbjct  50   QQNESVPE-SSRRSVIGLVAAGLAGGSFVKAVFAEAIPIKVGGP-PLPSGGLPGTDNSDQ  107

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  108  ARDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKGEKQGLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>ref|XP_010240150.1| PREDICTED: psbQ-like protein 2, chloroplastic [Brachypodium distachyon]
 ref|XP_010240151.1| PREDICTED: psbQ-like protein 2, chloroplastic [Brachypodium distachyon]
Length=118

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +1

Query  352  ANIGTKGSMYRLNKCAFDLMALG-DLIGSD--AWSYVLRYLRIKATFMYFDFDKVISTAE  522
              I  KG + R+  CA +L ++  DL+  D  +W+ V R LR+KATF+Y D  +VIS+  
Sbjct  3    CGIELKGCVCRIKNCATELFSMEEDLMIDDEESWNLVGRDLRLKATFLYIDLSRVISSCG  62

Query  523  ANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            ++E K+ LT LAN+    ++ELEDAVK R++ L +  Y  T  +L+EV++
Sbjct  63   SDECKKTLTRLANKFLYFMDELEDAVKSRSVPLMQMCYSDTTHVLREVVA  112



>gb|KFK32219.1| hypothetical protein AALP_AA6G213300 [Arabis alpina]
Length=227

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 89/181 (49%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+ + +PE + RR  +GL +  +   S    + A +      GP P P+           
Sbjct  46   QQTESVPE-SSRRSVIGLVAAGLVSGSFAKAAFANEAIAIKVGPPPAPSGGLPGTENSDQ  104

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +KN+ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  105  ARDFSLDLKNRFYLQPLSPIEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  164

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS+    EKQ L +L  +LF+ I+ L+ A + ++ S  E  Y  T+  L  V++
Sbjct  165  YDLNTVISSKPKEEKQSLKELTGKLFETIDNLDYAARSKSSSDAEKYYSETVSSLNNVLA  224

Query  670  K  672
            K
Sbjct  225  K  225



>dbj|BAJ99369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = +1

Query  355  NIGT--KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTA  519
            + GT  KG + R+N CA +L ++ + +  +   +W  V R LR+KATF+Y D  +VIS+ 
Sbjct  2    DFGTELKGCVCRINNCAIELFSMEEDLEIEDEDSWDLVGRDLRLKATFLYIDLSRVISSC  61

Query  520  EANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            E++E K+ LTDLAN+ F  ++EL +AVK R+  L +  Y  T   L+EV++
Sbjct  62   ESDEYKKMLTDLANKFFYFMDELGNAVKDRSAPLVQVCYSDTTHALREVVA  112



>ref|NP_192427.1| photosystem II subunit Q-2 [Arabidopsis thaliana]
 sp|Q41932.2|PSBQ2_ARATH RecName: Full=Oxygen-evolving enhancer protein 3-2, chloroplastic; 
Short=OEE3; AltName: Full=16 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=OEC 16 kDa subunit; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK49613.1|AF372897_1 AT4g05180/C17L7_100 [Arabidopsis thaliana]
 emb|CAB81060.1| Oxygen-evolving enhancer protein 3 precursor-like protein [Arabidopsis 
thaliana]
 gb|AAM65554.1| Oxygen-evolving enhancer protein 3 precursor-like protein [Arabidopsis 
thaliana]
 gb|AAN18214.1| At4g05180/C17L7_100 [Arabidopsis thaliana]
 gb|AEE82488.1| photosystem II subunit Q-2 [Arabidopsis thaliana]
Length=230

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 88/181 (49%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N  +PE + RR  +GL +  + G S +    AE     + GP P+P+      +    
Sbjct  50   QQNVSVPE-SSRRSVIGLVAAGLAGGSFVKAVFAEAIPIKVGGP-PLPSGGLPGTDNSDQ  107

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ YI  +    +  R    A +++ +   I   AW YV   LR++A+++ 
Sbjct  108  ARDFSLALKDRFYIQPLSPTEAAARAKDSAKEIINVKSFIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L DL  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKEEKQSLKDLTAKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>ref|XP_002446802.1| hypothetical protein SORBIDRAFT_06g022890 [Sorghum bicolor]
 gb|EES11130.1| hypothetical protein SORBIDRAFT_06g022890 [Sorghum bicolor]
Length=129

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 5/106 (5%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMA----LGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-  531
            KG + R+  CA +L +      ++   D+W  V R LR+KATF+Y D  +VI+  E  E 
Sbjct  8    KGCLCRIKNCAIELFSAMEEDLEVDDEDSWDLVGRDLRLKATFLYIDLSRVITFCEGEEH  67

Query  532  KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            K+ LT LAN+ F +++EL DAV+ R+L LT+ RY  T   L+EV++
Sbjct  68   KKALTVLANKFFYSMDELSDAVESRSLPLTQVRYSDTADALREVVA  113



>ref|XP_006396622.1| hypothetical protein EUTSA_v10028939mg [Eutrema salsugineum]
 gb|ESQ38075.1| hypothetical protein EUTSA_v10028939mg [Eutrema salsugineum]
Length=227

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 90/181 (50%), Gaps = 8/181 (4%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
             +N+ +PE + RR  +GL +  + G S +    AE     +  P   P ++  + N +  
Sbjct  50   HQNESVPE-SSRRSVIGLVAAGLAGGSFVKSVFAEALSIKVGPP---PPLSGGLHNSDQA  105

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  106  -RDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  164

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  165  YDLNTVISAKPKEEKQSLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  224

Query  670  K  672
            K
Sbjct  225  K  225



>ref|XP_004976265.1| PREDICTED: psbQ-like protein 2, chloroplastic-like isoform X1 
[Setaria italica]
 ref|XP_004976266.1| PREDICTED: psbQ-like protein 2, chloroplastic-like isoform X2 
[Setaria italica]
 ref|XP_004976267.1| PREDICTED: psbQ-like protein 2, chloroplastic-like isoform X3 
[Setaria italica]
 ref|XP_004976268.1| PREDICTED: psbQ-like protein 2, chloroplastic-like isoform X4 
[Setaria italica]
Length=129

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 64/106 (60%), Gaps = 5/106 (5%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMA----LGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-  531
            KG   R+  CA +L +      ++   D+W  V R +R+KATF+Y D  +VI+  E  E 
Sbjct  8    KGCFRRIKSCAVELFSTMEEDLEIDDEDSWDLVGRDIRLKATFLYIDLSRVIACCEGEEH  67

Query  532  KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            K+ L  LANR F +++EL DAV+ R+L LT+ RY  T   L+EV++
Sbjct  68   KKALNVLANRFFYSMDELGDAVESRSLPLTQVRYSDTADALREVVA  113



>gb|KJB57693.1| hypothetical protein B456_009G175700 [Gossypium raimondii]
Length=231

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 64/113 (57%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            KN+ Y+  +  + +  R  + A D++ +  LI   AW YV   LR+KA ++ +D + VIS
Sbjct  117  KNRFYLQPLTPEQAAQRAKESAKDILGVKSLIDKKAWPYVQNDLRLKAEYLRYDLNTVIS  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +   +EK+ L +L  +LFD I+EL+ A K ++    E  Y  T   L +V+SK
Sbjct  177  SKPKDEKKSLKELTKKLFDIIDELDHAAKIKSTPEAEKYYAETASTLNDVISK  229



>ref|XP_003575415.2| PREDICTED: uncharacterized protein LOC100845214 isoform X1 [Brachypodium 
distachyon]
Length=165

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = +1

Query  310  ETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALG-DLI---GSDAWSYVLRYLRIKA  477
            + G R+  ++ M    I  KG + R+  CA  L+++  DL+     D+W  V R LR+KA
Sbjct  36   QVGVRNCTESSMD-QGIEMKGCVCRIKNCAGQLLSMEEDLVTDLDDDSWDLVWRDLRLKA  94

Query  478  TFMYFDFDKVISTAEANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLL  654
            TF+Y D  +VIS +E +E ++ LT LAN+ F + +EL DAV  R++ L    +  T   L
Sbjct  95   TFLYIDLSRVISRSENDERRKALTLLANKFFYSTDELGDAVTSRSVPLVRMCFNDTAQAL  154

Query  655  QEVMS  669
            +EV++
Sbjct  155  REVVA  159



>emb|CDX82819.1| BnaC01g12690D [Brassica napus]
Length=227

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/186 (27%), Positives = 92/186 (49%), Gaps = 15/186 (8%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVT--------S  294
            Q+++  PE T RR  +GL +  + G S +   LA+        P+ I            +
Sbjct  47   QQSEAAPETT-RRSVIGLVAAGLAGGSFVQAVLAD------AVPIKIGPPPPPSGGLPGT  99

Query  295  DIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIK  474
            D  ++    R  +K + Y+  +    ++ R  + A +++ +  LI   AW YV   LR++
Sbjct  100  DNSDQARDLRLALKERFYLQPLPPTEAVARAKESAKEIVNVKSLIDKKAWPYVQNDLRLR  159

Query  475  ATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLL  654
            A+++ +D + +IS    +EK+ L +L  +LFD I  L+ A KK++    E  Y  T+  L
Sbjct  160  ASYLRYDLNTIISAKSKDEKKSLKELTGKLFDTINNLDYAAKKKSTPDAEKYYSETVSTL  219

Query  655  QEVMSK  672
             +V++K
Sbjct  220  NDVLAK  225



>ref|XP_010247010.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Nelumbo nucifera]
Length=235

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 67/114 (59%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++++ +LI   AW YV   LR+KA ++ FD + VI
Sbjct  120  LKNRFYLQPLTPSEAAQRAKESAKDIVSVKELIDKKAWPYVQNDLRLKAEYLRFDLNIVI  179

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++K+PL +L ++LF  I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  180  SSKPKDQKKPLKELTSKLFQTIDNLDHAAKIKSTPEAEKYYAETVSTLNDVLAK  233



>ref|XP_010235737.1| PREDICTED: uncharacterized protein LOC100845214 isoform X2 [Brachypodium 
distachyon]
Length=119

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (61%), Gaps = 5/109 (5%)
 Frame = +1

Query  358  IGTKGSMYRLNKCAFDLMALG-DLI---GSDAWSYVLRYLRIKATFMYFDFDKVISTAEA  525
            I  KG + R+  CA  L+++  DL+     D+W  V R LR+KATF+Y D  +VIS +E 
Sbjct  5    IEMKGCVCRIKNCAGQLLSMEEDLVTDLDDDSWDLVWRDLRLKATFLYIDLSRVISRSEN  64

Query  526  NE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +E ++ LT LAN+ F + +EL DAV  R++ L    +  T   L+EV++
Sbjct  65   DERRKALTLLANKFFYSTDELGDAVTSRSVPLVRMCFNDTAQALREVVA  113



>ref|XP_002518571.1| Oxygen-evolving enhancer protein 3, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43958.1| Oxygen-evolving enhancer protein 3, chloroplast precursor, putative 
[Ricinus communis]
Length=233

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+       ++ R  + A +++ +   I   AW YV+  LR++A ++ +D   +I
Sbjct  118  LKERFYLQPQDPSAAVARTKESAKEIVGVKQFIDKKAWPYVINDLRLRAEYLRYDLKTII  177

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    ++KQPL +L+ +LFDNI EL+ A K ++    E  Y  T+  L ++++K
Sbjct  178  SAKPKDQKQPLKELSGKLFDNISELDHAAKIKSTPEAEKYYAQTVSTLNDILAK  231



>dbj|BAA96362.1| oxygen evolving enhancer protein 3 [Bruguiera gymnorhiza]
Length=129

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            ++N+ YI  +    +  R  + A D++A+  LI   AW YV   LR+KA ++ +D + VI
Sbjct  19   LRNRFYIQPLTPAEAAARAKESAKDIVAVKTLIEKKAWPYVQNDLRLKAEYLRYDLNTVI  78

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEV  663
            S     EK+ L +L  +LFD I EL+ A K ++    E  Y  T+  L +V
Sbjct  79   SAKPKEEKKVLKELTGKLFDTISELDHAAKTKSTPEAEKYYAKTVSTLDDV  129



>emb|CDO99700.1| unnamed protein product [Coffea canephora]
Length=231

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 87/175 (50%), Gaps = 10/175 (6%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP-----TVTSDI-RNKETGTRS  327
            T RR  +GL +  +   S +  +LAE     + GP P       T+ SDI R+ +     
Sbjct  59   TSRRAMLGLVAAGIASGSFVQAALAEARAIKVGGPPPPSGGLPGTLNSDIPRDLDLP---  115

Query  328  FVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKV  507
             +K++ +I  +   G+  R    A D++ +  LI   AW YV   LR+KA  + +D + V
Sbjct  116  -LKDRFFIQALPPAGAAARAKDSAKDIINVKGLIDKKAWPYVQNDLRLKAELLRYDLNTV  174

Query  508  ISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            IS    +EK+ L DL  +LF  I +L+ A K ++    E  Y  T+  L +V+SK
Sbjct  175  ISAKPKDEKKQLKDLTGKLFQTISDLDHAAKIKSTPEAEKYYAATVSALNDVLSK  229



>ref|XP_007025914.1| Photosystem II subunit Q-2 [Theobroma cacao]
 gb|EOY28536.1| Photosystem II subunit Q-2 [Theobroma cacao]
Length=231

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            KN+ YI  +    ++ R  + A D++ +  LI   AW YV   LR+ A+++ +D + VIS
Sbjct  117  KNRFYIQPLSPAQAVARAKESAKDIVGVKSLIDKKAWPYVQNDLRLTASYLRYDLNTVIS  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                 EK+ L +L  +LFD I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  AKSKAEKKSLQELTGKLFDTISNLDHAAKIKSTPEAEKYYAQTVSTLNDVLAK  229



>ref|XP_006837010.1| hypothetical protein AMTR_s00098p00157610 [Amborella trichopoda]
 gb|ERM99863.1| hypothetical protein AMTR_s00098p00157610 [Amborella trichopoda]
Length=240

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 12/178 (7%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP------TVTSD-IRNKETG  318
            E   RR  +   +  V  +S +  +LA      + GP P P      T+ SD  R+ E  
Sbjct  66   EAVGRRAMLSFLAAGVASASFVKSALAAVKPIKV-GPAPPPSGGLPGTLNSDEPRDLE--  122

Query  319  TRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDF  498
                +K + YI  +    +  R    A D++ +  LI   AW+YV   LR+KA ++ +D 
Sbjct  123  --QPLKTRFYIQPLAPAEAAARAKDSAKDIIGVKQLIDKKAWTYVQMDLRLKAGYLRYDL  180

Query  499  DKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            + VI+    +EK+PL +L  +LF  I++L+ A K ++    E  Y  T+  L +V+SK
Sbjct  181  NTVIAAKPKDEKKPLKELTGKLFSQIDKLDHAAKIKSTPEAEKYYAETVSALNDVLSK  238



>gb|KHG15487.1| Oxygen-evolving enhancer 3, chloroplastic [Gossypium arboreum]
Length=231

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            +N+ Y+  +  + +  R  + A D++ +  LI   AW YV   LR+KA ++ +D + VIS
Sbjct  117  ENRFYLQPLTPEQAAQRAKESAKDILGVKSLIDKKAWPYVQNDLRLKAEYLRYDLNTVIS  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    EK+ L  L  +LFD I+EL+ A K ++    E  Y  T   L +V+SK
Sbjct  177  SKPKEEKKSLKVLTKKLFDTIDELDHAAKIKSTPEAEKYYAETASTLNDVISK  229



>ref|NP_001144977.1| hypothetical protein [Zea mays]
 ref|XP_008661780.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG44149.1| hypothetical protein [Zea mays]
Length=121

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANE-K  534
            KG + R+  CA +L+++ + + +D   +W  V R LR+KATF+  D  ++I+  +  E K
Sbjct  11   KGCLCRIKNCAIELLSMEEDLETDDEESWDLVGRDLRLKATFLCIDLSRLIAFCQGEEHK  70

Query  535  QPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            + LT +AN+ F +++EL DAV+ R+L LT+ RY  T   L+EV++
Sbjct  71   KALTVVANKFFYSMDELGDAVESRSLPLTQVRYGDTADALREVVA  115



>ref|XP_002874836.1| photosystem II subunit Q-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51095.1| photosystem II subunit Q-2 [Arabidopsis lyrata subsp. lyrata]
Length=230

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 89/181 (49%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + GSS +    AE     +  P           N +  
Sbjct  50   QQNESVPE-SSRRSVIGLVAAGLAGSSFVKAVFAEAIPIKVGPPPLPSGGLPGTDNSDQA  108

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ YI  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  109  -RDFSLALKDRFYIQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EK+ L +L  +LF+ I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKEEKKNLKELTGKLFETIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>gb|ABK26810.1| unknown [Picea sitchensis]
Length=219

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + YI  +  + +  R  + A +++ +  LI   AW YV   LR KA+++ +D + VI
Sbjct  104  LKERFYIQPLSVEQAAARAKESAKEILEVKKLIDKKAWPYVQNDLRSKASYLRYDLNTVI  163

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++K+PL  L ++LFD ++ L+ A + ++    E  Y  T+  L +V+SK
Sbjct  164  SSKPKDQKKPLKTLTSKLFDTLDNLDYAARSKDAPKAEKYYAETVSALNDVISK  217



>emb|CDY39157.1| BnaC09g21870D [Brassica napus]
Length=226

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 91/181 (50%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + G S +  ++A +      GP P P+      +    
Sbjct  45   QQNESVPE-SSRRSVIGLVAAGLVGGSFVKSAVAAEALAIKVGPPPPPSGGLPGTDNSDQ  103

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ YI  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  104  ARDFSLKLKDRFYIQPLSPTEAAARAKESAKEIINVKTLIDKKAWPYVQNDLRLRASYLR  163

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  164  YDLNTVISAKPKEEKQSLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  223

Query  670  K  672
            K
Sbjct  224  K  224



>gb|EEC77663.1| hypothetical protein OsI_16689 [Oryza sativa Indica Group]
Length=131

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query  352  ANIGTKGSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTAE  522
              I  KG + R+N CA +L ++  DL+    D+W  + R LR+KATF+Y D  +VI + E
Sbjct  3    CGIELKGCICRINNCAVELFSMEEDLVIDDEDSWDLLARDLRLKATFLYIDLGRVICSCE  62

Query  523  ANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTE  624
             +E K+ LT LAN+ F  ++EL +AV  R++ L +
Sbjct  63   IDEHKKMLTGLANKFFYFMDELTNAVSSRSIPLMQ  97



>gb|ABK26835.1| unknown [Picea sitchensis]
 gb|ABK26839.1| unknown [Picea sitchensis]
 gb|ABR17744.1| unknown [Picea sitchensis]
 gb|ACN40191.1| unknown [Picea sitchensis]
 gb|ACN40432.1| unknown [Picea sitchensis]
 gb|ACN40578.1| unknown [Picea sitchensis]
Length=243

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + YI  +  + +  R  + A +++ +  LI   AW YV   LR KA+++ +D + VI
Sbjct  128  LKERFYIQPLSVEQAAARAKESAKEILEVKKLIDKKAWPYVQNDLRSKASYLRYDLNTVI  187

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++K+PL  L ++LFD ++ L+ A + ++    E  Y  T+  L +V+SK
Sbjct  188  SSKPKDQKKPLKTLTSKLFDTLDNLDYAARSKDAPKAEKYYAETVSALNDVISK  241



>emb|CBI23524.3| unnamed protein product [Vitis vinifera]
Length=227

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 84/180 (47%), Gaps = 4/180 (2%)
 Frame = +1

Query  142  ENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGT  321
            +  P+   T RR  +GL +  +   S +   LAE     +  P P         N +   
Sbjct  47   QQAPVEPETSRRAVLGLVAAGLASGSFVQAVLAEAKSIKVGPPPPPSGGLPGTLNSDEA-  105

Query  322  RSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYF  492
            R     +K++ +I  +    +  R  + A D++ +  LI   AW YV   LR+KA ++ +
Sbjct  106  RDLDLPLKDRFFIQPLPPAAAAVRAKESAKDIVGVKTLIDKKAWPYVQMDLRLKAEYLRY  165

Query  493  DFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            D + VIS    +EK+ L +L  +LF  I +L+ A K ++    E  Y  T+  L +V+SK
Sbjct  166  DLNTVISAKPKDEKKSLKELTGKLFSTISDLDHAAKIKSSPDAEKYYAATVSTLNDVLSK  225



>gb|ABK23819.1| unknown [Picea sitchensis]
 gb|ACN39776.1| unknown [Picea sitchensis]
 gb|ACN40059.1| unknown [Picea sitchensis]
 gb|ACN40271.1| unknown [Picea sitchensis]
Length=243

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + YI  +  + +  R  + A +++ +  LI   AW YV   LR KA+++ +D + VI
Sbjct  128  LKERFYIQPLSVEQAAARAKESAKEILEVKKLIDKKAWPYVQNDLRSKASYLRYDLNTVI  187

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++K+PL  L ++LFD ++ L+ A + ++    E  Y  T+  L +V+SK
Sbjct  188  SSKPKDQKKPLKTLTSKLFDTLDNLDYAARSKDAPKAEKYYAETVSALNDVISK  241



>ref|XP_002275624.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic 
[Vitis vinifera]
Length=231

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 84/180 (47%), Gaps = 4/180 (2%)
 Frame = +1

Query  142  ENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGT  321
            +  P+   T RR  +GL +  +   S +   LAE     +  P P         N +   
Sbjct  51   QQAPVEPETSRRAVLGLVAAGLASGSFVQAVLAEAKSIKVGPPPPPSGGLPGTLNSDEA-  109

Query  322  RSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYF  492
            R     +K++ +I  +    +  R  + A D++ +  LI   AW YV   LR+KA ++ +
Sbjct  110  RDLDLPLKDRFFIQPLPPAAAAVRAKESAKDIVGVKTLIDKKAWPYVQMDLRLKAEYLRY  169

Query  493  DFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            D + VIS    +EK+ L +L  +LF  I +L+ A K ++    E  Y  T+  L +V+SK
Sbjct  170  DLNTVISAKPKDEKKSLKELTGKLFSTISDLDHAAKIKSSPDAEKYYAATVSTLNDVLSK  229



>gb|AAP43511.1| oxygen-evolving enhancer protein 3 precursor [Pisum sativum]
Length=234

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 86/174 (49%), Gaps = 8/174 (5%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP-----TVTSDIRNKETGTRSF  330
            + RR  +GL +  +  SS +   LAE     + GP P+      T+ SD   +    +  
Sbjct  62   SSRRAVIGLVATGLVSSSFVQAVLAEAIPIKVGGPPPLSGGLPGTLNSD---EARDLKLP  118

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + +I  +    +  R  + A +++A    I   AW ++   LR++A ++ +D   +I
Sbjct  119  LKERFFIQPLAPTEAAARTKESAKEIVAAKKFIDQKAWPFLQNDLRLRAGYLRYDLKTII  178

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++KQ L +L ++LF +I  L+ A K ++ S  E  Y   +  L +V+SK
Sbjct  179  SSKPKDQKQSLKELTDKLFQDISNLDHAAKIKSPSEAEKYYAIAVSTLNDVLSK  232



>ref|XP_010538115.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010538124.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=218

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ +D + VIS
Sbjct  104  KDRFFLQPLSATEAASRAKESAKEIVNVKTLIDKKAWPYVQNDLRLRAEYLRYDLNTVIS  163

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +   +EKQ L DL  +LF NI  L+ A KK++ S  E  Y  T+  L +V++K
Sbjct  164  SKPKDEKQNLKDLTGKLFQNITNLDYAAKKKSTSDAEKYYAETVSSLNDVLAK  216



>ref|XP_009114497.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Brassica rapa]
Length=226

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 91/181 (50%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+N+ +PE + RR  +GL +  + G S +  ++A +      GP P P+      +    
Sbjct  45   QQNESVPE-SSRRSVIGLVAAGLVGGSFVKSAVAAEALAIKVGPPPPPSGGLPGTDNSDQ  103

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  104  ARDFSLKLKDRFYLQPLSPTEAAARAKESAKEIINVKTLIDKKAWPYVQNDLRLRASYLR  163

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  164  YDLNTVISAKPKEEKQSLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  223

Query  670  K  672
            K
Sbjct  224  K  224



>gb|EMS61967.1| hypothetical protein TRIUR3_14009 [Triticum urartu]
Length=182

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 64/98 (65%), Gaps = 6/98 (6%)
 Frame = +1

Query  355  NIGT--KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTA  519
            + GT  KG + R+N CA +L ++ + +  +   +W  V R LR+KATF+Y D  +VIS+ 
Sbjct  2    DFGTELKGCVCRINNCAIELFSMEEDLEIEDEDSWDLVGRDLRLKATFLYIDLSRVISSC  61

Query  520  EANE-KQPLTDLANRLFDNIEELEDAVKKRNLSLTESR  630
            E++E K+ LT LAN+ F  ++EL +AVK R+ SL + +
Sbjct  62   ESDERKKTLTGLANKFFYFMDELGNAVKDRSASLVQGQ  99



>gb|AAW80967.1| chloroplast oxygen-evolving protein 16 kDa subunit [Nicotiana 
tabacum]
Length=228

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 79/172 (46%), Gaps = 5/172 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---VK  336
            T RR  +GL +  + GS       A  +      P P   +   + + E   R F   +K
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEA--RDFGLPLK  114

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VIS 
Sbjct  115  KRFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVISA  174

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                EK  L DL  +LF  I +L+ A K +N    E  Y  T+  L EV++K
Sbjct  175  KPKEEKGKLQDLTGKLFKTISDLDHAAKTKNSPEAEKYYAETVSTLNEVLAK  226



>ref|XP_010907836.1| PREDICTED: psbQ-like protein 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=127

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTAEANEKQ  537
            KG + R+ KC  DL+++ + +  D   +W  + R LR+K+TF+Y D ++VIS A    ++
Sbjct  7    KGCVCRIKKCVLDLLSMEEDLIDDDEDSWELMGRDLRLKSTFLYCDLNQVISNATDEHRK  66

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             LTDLAN+LF N+EEL       ++ LT++ Y G L   Q V+
Sbjct  67   ALTDLANKLFCNMEELVIG-WTVSIFLTDNVYPGILHQSQSVV  108



>gb|AFK41829.1| unknown [Lotus japonicus]
Length=234

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 92/186 (49%), Gaps = 11/186 (6%)
 Frame = +1

Query  136  IQENQ-PLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP-----TVTSD  297
            ++ NQ P    + RR  +GL +  +   S +   LAE     + GP P+      T+ SD
Sbjct  51   VRANQVPSEPQSSRRAVMGLVAAGLATGSFVQAVLAEAKSIKVGGPPPLSGGLPGTLNSD  110

Query  298  -IRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIK  474
              R+ E      ++ + ++  +    +  R  + A +++A+   I   AW YV   LR++
Sbjct  111  EARDLELP----LEERFFLQPLSPTEAAQRAKESAKEIVAVKKFIDQKAWPYVQNDLRLR  166

Query  475  ATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLL  654
            A+++ +D + VIS+   ++KQ L +L+ +LF +I  L+ A K ++    E  Y   +  L
Sbjct  167  ASYLRYDLNTVISSKPTDQKQSLKELSAKLFQDISNLDYAAKVKSSPQAEKYYAEAVSTL  226

Query  655  QEVMSK  672
             +V+ K
Sbjct  227  NDVLGK  232



>ref|XP_006396623.1| hypothetical protein EUTSA_v10028939mg [Eutrema salsugineum]
 gb|ESQ38076.1| hypothetical protein EUTSA_v10028939mg [Eutrema salsugineum]
Length=230

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 88/181 (49%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
             +N+ +PE + RR  +GL +  + G S +    AE     +  P P+        N +  
Sbjct  50   HQNESVPE-SSRRSVIGLVAAGLAGGSFVKSVFAEALSIKVGPPPPLSGGLPGTDNSDQA  108

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ 
Sbjct  109  -RDFSLALKDRFYLQPLSPTEAAARAKESAKEIINVKSLIDKKAWPYVQNDLRLRASYLR  167

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++
Sbjct  168  YDLNTVISAKPKEEKQSLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLA  227

Query  670  K  672
            K
Sbjct  228  K  228



>ref|XP_007211975.1| hypothetical protein PRUPE_ppa010884mg [Prunus persica]
 gb|EMJ13174.1| hypothetical protein PRUPE_ppa010884mg [Prunus persica]
Length=232

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + +I  +    +  R  + A +++A+ + I   AW YV   LR++A+++ +D   VI
Sbjct  117  LKERFFIQPLTPAQAAQRAKESAKEIVAVKEYIDKKAWPYVQNDLRLRASYLRYDLKTVI  176

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL +L  +LF +I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  SAKSKTEKEPLKELTGKLFKDIDNLDHAAKIKSTPEAEKYYAATVSSLNDVIAK  230



>gb|EPS69028.1| hypothetical protein M569_05739 [Genlisea aurea]
Length=235

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 87/181 (48%), Gaps = 5/181 (3%)
 Frame = +1

Query  142  ENQPLPEV-TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            + Q  PE  T RR  +GL +  +   S +   LA+     +  P P        +N +  
Sbjct  54   QQQISPECETGRRAMLGLVASGIASGSFVRAVLADAKSISVGPPPPPSGGLPGTKNSDEA  113

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R     +KN+ Y+  +    +  R  + A +++ +   I   AW YV   LR++A+++ 
Sbjct  114  -RDLELPLKNRFYLQPLPPALAAARAKESAQEIIKVKQQIDKKAWPYVQNDLRLRASYLR  172

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            FD + VIS     EKQPL DL ++LF  I+ L+ A K ++    E  Y  T+  L +V++
Sbjct  173  FDLNTVISAKPKEEKQPLKDLTDKLFATIDSLDHAAKIKSSPEAEKYYAETVTKLNDVLA  232

Query  670  K  672
            K
Sbjct  233  K  233



>ref|XP_002305643.1| Oxygen-evolving enhancer protein 3-1 [Populus trichocarpa]
 gb|ABK95216.1| unknown [Populus trichocarpa]
 gb|EEE86154.1| Oxygen-evolving enhancer protein 3-1 [Populus trichocarpa]
Length=234

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + ++  +    +  R  + A D++ +  LI   AW YV   LR+KA ++ FD + VI
Sbjct  119  LKQRFFLQPLPPAEAAVRAKESAKDILGVKSLIDQKAWPYVQNDLRLKAGYLRFDLNTVI  178

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    +EK+ L +L  +LFD I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  179  SAKSKDEKKSLKELTGKLFDTISNLDHAAKIKSTPEAEKYYAQTVSSLNDVLAK  232



>gb|KJB69352.1| hypothetical protein B456_011G018700 [Gossypium raimondii]
Length=231

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A D++ +  LI   AW YV+  LR+KA ++ FD   VIS
Sbjct  117  KDRFFLQPLTPAQAAQRAKESAKDILGVKTLIDKKAWPYVMNDLRLKAEYLRFDLKTVIS  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +   +EK+ L +L  +LF+ I+ L+ A K ++    E  Y  T   L EV++K
Sbjct  177  SRPKDEKKSLDELTKKLFNTIDGLDHAAKIKSTPEAEKYYAETASALNEVITK  229



>gb|KHG03565.1| Oxygen-evolving enhancer 3, chloroplastic [Gossypium arboreum]
Length=231

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A D++ +  LI   AW YV+  LR+KA ++ FD   VIS
Sbjct  117  KDRFFLQPLTPAQAAQRAKESAKDILGVKTLIDKKAWPYVMNDLRLKAEYLRFDLKTVIS  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +   +EK+ L +L  +LF+ I+ L+ A K ++    E  Y  T   L EV++K
Sbjct  177  SKPKDEKKSLDELTKKLFNTIDGLDHAAKIKSTPEAEKYYAETASALNEVIAK  229



>ref|XP_006449139.1| hypothetical protein CICLE_v10016525mg [Citrus clementina]
 gb|ESR62379.1| hypothetical protein CICLE_v10016525mg [Citrus clementina]
Length=233

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + +I  +    +  R    A D++ + +LI   AW YV   LR++A+++ +D + +I
Sbjct  118  LKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTII  177

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    +EKQ L +L  +LF  I  L+ A K ++    E  Y  T+  L +V+SK
Sbjct  178  SAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSK  231



>gb|AFH58005.1| chloroplast PsbQ1 precursor [Nicotiana benthamiana]
Length=228

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 79/172 (46%), Gaps = 5/172 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---VK  336
            T RR  +GL +  + GS       A  +      P P   +   + + E   R F   +K
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEA--RDFGLPLK  114

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VIS 
Sbjct  115  KRFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVISA  174

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                EK  L DL  +LF  I +L+ A K +N    E  Y  T+  L +V++K
Sbjct  175  KPKEEKGKLQDLTGKLFKTISDLDHAAKTKNSPEAEKYYAETVSTLNDVLAK  226



>gb|AAW80966.1| chloroplast oxygen-evolving protein 16 kDa subunit [Nicotiana 
benthamiana]
Length=228

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 79/172 (46%), Gaps = 5/172 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---VK  336
            T RR  +GL +  + GS       A  +      P P   +   + + E   R F   +K
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEA--RDFGLPLK  114

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VIS 
Sbjct  115  KRFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVISA  174

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                EK  L DL  +LF  I +L+ A K +N    E  Y  T+  L +V++K
Sbjct  175  KPKEEKGKLQDLTGKLFKTISDLDHAAKTKNSPEAEKYYAETVSTLNDVLAK  226



>gb|KDO75611.1| hypothetical protein CISIN_1g026780mg [Citrus sinensis]
Length=233

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + +I  +    +  R    A D++ + +LI   AW YV   LR++A+++ +D + +I
Sbjct  118  LKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTII  177

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    +EKQ L +L  +LF  I  L+ A K ++    E  Y  T+  L +V+SK
Sbjct  178  SAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSK  231



>ref|XP_009791746.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Nicotiana sylvestris]
 gb|AFH58006.1| chloroplast PsbQ2 precursor [Nicotiana benthamiana]
Length=228

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 79/172 (46%), Gaps = 5/172 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---VK  336
            T RR  +GL +  + GS       A  +      P P   +   + + E   R F   +K
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEA--RDFGLPLK  114

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VIS 
Sbjct  115  KRFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVISA  174

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                EK  L DL  +LF  I +L+ A K +N    E  Y  T+  L +V++K
Sbjct  175  KPKEEKGKLQDLTGKLFKTISDLDHAAKTKNSPEAEKYYAETVSTLNDVLAK  226



>ref|XP_006467954.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
[Citrus sinensis]
Length=233

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + +I  +    +  R    A D++ + +LI   AW YV   LR++A+++ +D + +I
Sbjct  118  LKERFFIQPLSPAQAAERAKASAKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTII  177

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    +EKQ L +L  +LF  I  L+ A K ++    E  Y  T+  L +V+SK
Sbjct  178  SAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSK  231



>gb|ABK95035.1| unknown [Populus trichocarpa]
Length=234

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 88/177 (50%), Gaps = 9/177 (5%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT--VTSDIRNKETGTRSF  330
            PE T RR  +GL +  +   S +   LA      + GP P P+  +T  + + E   R  
Sbjct  60   PE-TSRRGMLGLVAAGLASGSFVQAVLAAALPIKV-GPPPAPSGGLTGTLNSDEA--RDL  115

Query  331  V---KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFD  501
            V   K + ++  +    +  R  + A +++ +  LI   AW YV   LR+KA+++ +D +
Sbjct  116  VLPLKERFFLQPLPPAAAAARAKESAKEIIGVKGLIDKKAWPYVQNDLRLKASYLRYDLN  175

Query  502  KVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             VIS    +EK+ L +L  +LFD I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  176  TVISAKSKDEKKSLKELTGKLFDTIGNLDHAAKIKSTPEAEKYYAQTVSALNDVLAK  232



>ref|XP_004515373.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
[Cicer arietinum]
Length=236

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 88/183 (48%), Gaps = 8/183 (4%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP-----TVTSDIR  303
            Q+ Q     + RR  +G+ +  +  +S +   LAE     + GP P+      T+ SD  
Sbjct  55   QQQQVFEGQSSRRAMIGVVATGLVSASFVQAVLAEAIPIKVGGPPPLSGGLPGTLNSD--  112

Query  304  NKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATF  483
             +    +  +K + Y+  +    +  R  + A +++ +   I   AW Y+   LR++A++
Sbjct  113  -EARDLKLPLKERFYLQPLTPSEAAQRAKESAKEIVGVKKFIDQKAWPYLQNDLRLRASY  171

Query  484  MYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEV  663
            + +D + VIS    ++K+ L +L  +LF +I  L+ A K ++    E  Y   +  L +V
Sbjct  172  LRYDLNTVISAKPKDQKKSLKELTGKLFQDITNLDHAAKVKSAPEAEKYYAIAVSTLNDV  231

Query  664  MSK  672
            +SK
Sbjct  232  LSK  234



>gb|ABK26098.1| unknown [Picea sitchensis]
Length=243

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + YI  +  + +  R  + A +++ +  LI   AW YV   LR KA+++ +D + VI
Sbjct  128  LKERFYIQPLSVEQAAARAKESAKEILEVKKLIDKKAWPYVQNDLRSKASYLRYDLNTVI  187

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   ++K+PL  L ++LF  ++ L+ A + ++    E  Y  T+  L +V+SK
Sbjct  188  SSKPKDQKKPLKTLTSKLFGTLDNLDYAARSKDAPKAEKYYAETVSALNDVISK  241



>ref|XP_008224877.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic 
[Prunus mume]
Length=232

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R    A +++A+ + I   AW YV   LR++A+++ +D   VI
Sbjct  117  LKDRFFLQPLTPAQAAQRAKDSAKEIVAVKEYIDKKAWPYVQNDLRLRASYLRYDLKTVI  176

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL +L  +LF +I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  SAKPKTEKEPLKELTGKLFKDIDNLDHAAKIKSTPEAEKYYAATVSSLNDVIAK  230



>gb|ACA58355.1| chloroplast oxygen-evolving protein [Arachis diogoi]
Length=131

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ +D + V+
Sbjct  16   LKDRFFLQPLSPSEAAQRAKESAKEIVNVKQLIDKKAWPYVQNDLRLRAEYLRYDLNTVV  75

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    ++K+PL DL  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  76   SAKPKDQKKPLKDLIGKLFQDISNLDHAAKVKSTPEAEKYYAETVSSLNDVLAK  129



>ref|XP_002317273.1| Oxygen-evolving enhancer protein 3-1 [Populus trichocarpa]
 gb|EEE97885.1| Oxygen-evolving enhancer protein 3-1 [Populus trichocarpa]
Length=234

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 88/177 (50%), Gaps = 9/177 (5%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT--VTSDIRNKETGTRSF  330
            PE T RR  +GL +  +   S +   LA      + GP P P+  +T  + + E   R  
Sbjct  60   PE-TSRRGMLGLVAAGLASGSFVQAVLAAALPIKV-GPPPAPSGGLTGTLNSDEA--RDL  115

Query  331  V---KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFD  501
            V   K + ++  +    +  R  + A +++ +  LI   AW YV   LR+K++++ +D +
Sbjct  116  VLPLKERFFLQPLPPAAAAARAKESAKEIIGVKGLIDKKAWPYVQNDLRLKSSYLRYDLN  175

Query  502  KVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             VIS    +EK+ L +L  +LFD I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  176  TVISAKSKDEKKSLKELTGKLFDTISNLDHAAKIKSTPEAEKYYAQTVSALNDVLAK  232



>ref|XP_009366538.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Pyrus x bretschneideri]
Length=232

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 88/178 (49%), Gaps = 11/178 (6%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWL------TGPLPIPTVTSDIRNKETG  318
            PE T RR  +GL ++ +   S +   LAE     +      +G L     + + R+ +  
Sbjct  58   PE-TSRRAVLGLVAVGLASGSFVQAVLAEAKPIKVGPPPPPSGGLAGTLNSDEARDLDLP  116

Query  319  TRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDF  498
                +K + +I  +    +  R  + A +++A+ + I   AW YV   LR++A+++ +D 
Sbjct  117  ----LKERFFIQPLTPAQAAARAKESAKEILAVKEYIDKKAWPYVQNDLRLRASYLRYDL  172

Query  499  DKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              VIS     EK+PL +L  +LF +I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  173  KTVISAKSKAEKEPLKELTGKLFKDIDGLDYAAKIKSTPEAEKYYAATVSSLNDVLAK  230



>ref|XP_011096124.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic 
[Sesamum indicum]
Length=230

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  382  RLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANR  561
            R+ + A ++  +  LI   AW YV   LR++A ++ +D   VIS     EKQPL DL  +
Sbjct  132  RVKESAKEIKGVKSLIDKKAWPYVQNDLRLRAEYLRYDLKTVISAKPKEEKQPLQDLTGK  191

Query  562  LFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            L  +I  L+ A K ++    E  Y  T+  L +V+SK
Sbjct  192  LLQDISNLDHAAKIKSTPEAEKYYAETVATLDDVLSK  228



>gb|AFK43187.1| unknown [Medicago truncatula]
 gb|KEH17773.1| oxygen-evolving enhancer protein [Medicago truncatula]
Length=232

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 99/208 (48%), Gaps = 19/208 (9%)
 Frame = +1

Query  67   LHGGTARRKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAED  246
            LHG  + +   +++     +A + QE       + RR  +GL +  +  SS +   LAE 
Sbjct  36   LHGSNSNKVTRSSVTVV--RAQQQQE-------SSRRAVIGLVATGLVSSSFVQAVLAEA  86

Query  247  NGFWLTGPLPIP------TVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDL  408
                + GP P P      T+ SD   +    +  +K + Y+  +    +  R  + A ++
Sbjct  87   IPIKVGGP-PAPSGGLPGTLNSD---EARDLKLPLKERFYLQPLTPTEAAARAKESAKEI  142

Query  409  MALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELE  588
            +A    I   AW Y+   LR++A ++ +D + +IS    ++K+ L +L  +LF +I+ L+
Sbjct  143  VAAKKFIDQKAWPYLQNDLRLRAGYLRYDLNTIISAKPKDQKKSLKELTGKLFQDIDNLD  202

Query  589  DAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             A K ++ S  E  Y   +  L +V+SK
Sbjct  203  YAAKVKSPSDAEKYYAIAVSTLNDVLSK  230



>ref|XP_008371207.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Malus domestica]
 ref|XP_008345853.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Malus domestica]
Length=232

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 88/178 (49%), Gaps = 11/178 (6%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWL------TGPLPIPTVTSDIRNKETG  318
            PE T RR  +GL ++ +   S +   LAE     +      +G L     + + R+ +  
Sbjct  58   PE-TSRRAVLGLVAVGLASGSFVQAVLAEAKPIKVGPPPPPSGGLAGTLNSDEARDLDLP  116

Query  319  TRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDF  498
                +K + +I  +    +  R  + A +++A+ + I   AW YV   LR++A+++ +D 
Sbjct  117  ----LKERFFIQPLTPAQAAARAKESAKEILAVKEYIDKKAWPYVQNDLRLRASYLRYDL  172

Query  499  DKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
              VIS     EK+PL +L  +LF +I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  173  KTVISAKSKAEKEPLKELTGKLFKDIDGLDYAAKIKSTPEAEKYYTATVSSLNDVLAK  230



>gb|AFK40956.1| unknown [Lotus japonicus]
Length=167

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 84/169 (50%), Gaps = 10/169 (6%)
 Frame = +1

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIP-----TVTSD-IRNKETGTRSFVKNQM  345
            +GL +  +   S +   LAE     + GP P+      T+ SD  R+ E      +K + 
Sbjct  1    MGLVAAGLATGSFVQAVLAEAKSIKVGGPPPLSGGLPGTLNSDEARDLELP----LKERF  56

Query  346  YIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEA  525
            ++  +    +  R  + A +++A+   I   AW YV   LR++A+++ +D + VIS+   
Sbjct  57   FLQPLSPTEAAQRAKESAKEIVAVKKFIDQKAWPYVQNDLRLRASYLRYDLNTVISSKPK  116

Query  526  NEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++KQ L +L+ +LF +I  L+ A K ++    E  Y   +  L +V+ K
Sbjct  117  DQKQSLKELSAKLFQDISNLDYAAKVKSSPQAEKYYAEAVSTLNDVLGK  165



>ref|XP_010088099.1| Oxygen-evolving enhancer protein 3-2 [Morus notabilis]
 gb|EXB31418.1| Oxygen-evolving enhancer protein 3-2 [Morus notabilis]
Length=232

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 83/181 (46%), Gaps = 4/181 (2%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+    PE T RR  +GL +  +   S     LAE     +  P P         N +  
Sbjct  51   QQGSTEPETTGRRAMLGLVAAGLAAGSFAQVVLAEAKSIKVGPPPPPSGGLPGTLNSDE-  109

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R     +K + ++  +    +  R  + A D++ + +LI   AW YV   LR+KA ++ 
Sbjct  110  PRDLNLPLKERFFLQPLTPAEAAQRAKESAKDIVGVKELIDKKAWPYVQNDLRLKAEYLR  169

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + VIS+   +EK+ L +L  +LF +I  L+ A K ++    E  Y   +  L  V+S
Sbjct  170  YDLNTVISSKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAEAVSTLNSVLS  229

Query  670  K  672
            K
Sbjct  230  K  230



>ref|NP_001234528.1| photosystem II oxygen-evolving complex protein 3 [Solanum lycopersicum]
 gb|AAU03361.1| photosystem II oxygen-evolving complex protein 3 [Solanum lycopersicum]
Length=230

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 81/171 (47%), Gaps = 5/171 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---VK  336
            T RR  +GL +  + GS     + AE     +  P P         N +   R F   +K
Sbjct  59   TSRRAMIGLVAAGLAGSVAKA-AFAEARSIKVGPPPPPSGGLPGTLNSDEA-RDFSLPLK  116

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
            N+ Y+  +    +  R+   A +++++ D I   AW YV   LR++A ++ +D   VIS 
Sbjct  117  NRFYLQPLTPAEAAQRVKDSAKEIVSVKDFIDKKAWPYVQNDLRLRAEYLRYDLKTVISA  176

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                +K  L DL+ +LF  I +L+ A K +N +  +  Y  T+  L +V++
Sbjct  177  MPKEQKGKLQDLSGKLFKTISDLDHAAKTKNSAEAQKYYAETVTTLNDVLA  227



>ref|XP_009418767.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009418768.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=233

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + Y+  +    +  R  + A D++ +  LI    W YV+  LR+KA ++ FD + +IS 
Sbjct  120  QRFYLQPLPPSEAAARAKESAKDILNVKQLIDKKEWPYVMNDLRLKAGYLRFDLNTIISA  179

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                EK+ L +L  +LF  I+EL+ A K ++    E  Y  T  LL +V++K
Sbjct  180  KPKEEKKTLKELTGKLFAAIDELDHAAKIKSTPQAEKYYATTKSLLDDVLAK  231



>gb|AAV74404.1| chloroplast oxygen-evolving enhancer protein [Manihot esculenta]
Length=227

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R  + A D++ +  LI   AW YV   LR++A ++ +D + VI
Sbjct  112  LKKRFYLQPLDPAQAAVRAKESAKDIVGVKPLIDKKAWPYVQNDLRLRAEYLRYDLNTVI  171

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +     EKQ L +L  +LF +I +L+ A K ++    E  Y  T+  L +V++K
Sbjct  172  AAKPKEEKQTLKELTGKLFQSISDLDHAAKIKSTPEAEKYYAQTVSNLNDVLAK  225



>ref|XP_009398847.1| PREDICTED: psbQ-like protein 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +1

Query  358  IGTKGSMYRLNKCAFDLMALG---DLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEAN  528
            + +KG  +R+  C  +L+ L      +  + W  +   LR+K+TF+Y D +++IS  +  
Sbjct  1    MESKGCAHRIRNCGSELLTLEVHLTNVNENKWKLMENSLRLKSTFLYCDLNRLISNEKDE  60

Query  529  EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEV  663
             K+ LTDL NRL   + +L+ AVK R++ L    Y    ++L+E+
Sbjct  61   RKELLTDLTNRLSRYLAKLDRAVKTRSVPLARIHYNDVAIVLREI  105



>ref|NP_001142803.1| uncharacterized protein LOC100275181 [Zea mays]
 ref|XP_008667629.1| PREDICTED: uncharacterized protein LOC100275181 isoform X1 [Zea 
mays]
 ref|XP_008667630.1| PREDICTED: uncharacterized protein LOC100275181 isoform X1 [Zea 
mays]
 ref|XP_008667631.1| PREDICTED: uncharacterized protein LOC100275181 isoform X1 [Zea 
mays]
 ref|XP_008667632.1| PREDICTED: uncharacterized protein LOC100275181 isoform X1 [Zea 
mays]
 gb|ACG26875.1| hypothetical protein [Zea mays]
Length=152

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +1

Query  439  AWSYVLRYLRIKATFMYFDFDKVISTAEANE-KQPLTDLANRLFDNIEELEDAVKKRNLS  615
            +W  V R +R+KA F+  D  +VI+     E K+ LT LAN+LF +++EL DAV+ R+L 
Sbjct  12   SWDLVGRDIRLKAAFLCIDLGRVIALCGGEERKKALTALANKLFYSMDELGDAVESRSLP  71

Query  616  LTESRYEGTLVLLQEVMS  669
            LT++RY  T   L+EV++
Sbjct  72   LTQARYSDTADALREVVA  89



>ref|XP_004957939.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Setaria italica]
Length=211

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R    A D++ L  LI   AW YV+  LR++A+++ +D + VI
Sbjct  96   LKERFYLQPLPPAEAAARAKSSAQDILNLKPLIDKKAWPYVMNDLRLRASYLRYDLNTVI  155

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++   +EK+ L +L  +LF  I++L+ A K ++    E  +  T   L +V +K
Sbjct  156  ASKPKDEKKSLKELTGKLFSTIDDLDHAAKIKSTPEAEKSFAATKSALDDVFAK  209



>ref|XP_010999549.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
isoform X2 [Populus euphratica]
 ref|XP_011012473.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Populus euphratica]
Length=234

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 87/177 (49%), Gaps = 9/177 (5%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT--VTSDIRNKETGTRSF  330
            PE T RR  +GL +  +   S +   LA      + GP P P+  +   + + E   R  
Sbjct  60   PE-TSRRGMLGLVAAGLASGSFVQAVLAASLPIKV-GPPPAPSGGLPGTLNSDEA--RDL  115

Query  331  V---KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFD  501
            V   K + ++  +    +  R  + A +++ +  LI   AW YV   LR+K++++ +D +
Sbjct  116  VLPLKERFFLQPLPPAAAAARAKESAKEIIGVKGLIDKKAWPYVQNDLRLKSSYLRYDLN  175

Query  502  KVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
             VIS    +EK+ L +L  +LFD I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  176  TVISAKSKDEKKSLKELTGKLFDTISNLDHAAKIKSTPEAEKYYAQTVSALNDVLAK  232



>ref|XP_006658664.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
[Oryza brachyantha]
Length=168

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R  + A D++ L  LI    W YV   LR+KA+++ +D   +I
Sbjct  53   LKERFYLQPLPPAEAAARAKESAKDIINLKPLIDKKQWPYVRDDLRLKASYLRYDLKTII  112

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+   +EK+ L DL  +LF  I+ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  113  SSKPKDEKKDLKDLTGKLFATIDGLDHAAKIKSPAEAEKYYTETKSVLGDVLAK  166



>ref|NP_001288549.1| oxygen-evolving enhancer protein 3-1, chloroplastic-like [Zea 
mays]
 gb|ACG27417.1| oxygen-evolving enhancer protein 3-1 [Zea mays]
Length=212

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    ++ R+   A D++ L  LI   AW YV   LR++A+++ +D   VI
Sbjct  97   LKERFYLQPLPPAEAVARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVI  156

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++    EKQ L +L  +LF  I++L+ A K ++    E  +  T   L +V++K
Sbjct  157  ASKPKEEKQSLKELTGKLFSTIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAK  210



>ref|XP_009587329.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=235

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ Y+  +    +  R  + A D++ +   I   AW YV   LR+KA ++ +D   VI
Sbjct  120  LKDRFYLQPLTPDQAAQRAKESAKDIINVKQFIDKKAWPYVQNDLRLKAEYLRYDLKTVI  179

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S    +EK+ L +L+ +LF  I +L+ A K +N +  +  Y  T+  L +V++K
Sbjct  180  SAKPKDEKKQLQELSGKLFKAISDLDYAAKTKNSAQAKKCYAETVSTLNDVLAK  233



>gb|KDP20229.1| hypothetical protein JCGZ_09861 [Jatropha curcas]
Length=230

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 87/182 (48%), Gaps = 5/182 (3%)
 Frame = +1

Query  136  IQENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKET  315
            + + Q  PE T RR A+GL +  +   S +   LA+     +  P P         N + 
Sbjct  49   VSQQQAEPE-TSRRAALGLVAAGLASGSFVQAVLADAIPIKVGPPPPPSGGLPGTLNSDE  107

Query  316  GTRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFM  486
              R     +K++ ++       +  R  + A +++ +   I   AW YV+  LR++A ++
Sbjct  108  A-RDLDLPLKDRFFLQPRTPAEAAARAKESAKEIVGVKQYIDKKAWPYVINDLRLRAEYL  166

Query  487  YFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
             +D   VI+     EK+ L +L+ +LF NI EL+ A K +N S  E  Y  T+  L +V+
Sbjct  167  RYDLKTVIAGKPKEEKKSLQELSGKLFANISELDHAAKIKNSSEAEKYYAETVSTLNDVI  226

Query  667  SK  672
            +K
Sbjct  227  AK  228



>emb|CAE05707.2| OSJNBb0065J09.3 [Oryza sativa Japonica Group]
Length=1015

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = +1

Query  370  GSMYRLNKCAFDLMALG-DLI--GSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-KQ  537
            G + R+N CA +L ++  DL+    D+W  + R LR+KATF+Y D  +VI + E +E K+
Sbjct  893  GCICRINNCAVELFSMEEDLVIDDEDSWDLLARDLRLKATFLYIDLGRVICSCEIDEHKK  952

Query  538  PLTDLANRLFDNIEELEDAVKKRNLSLTE  624
             LT LAN+ F  ++EL +AV  R++ L +
Sbjct  953  MLTGLANKFFYFMDELTNAVSSRSIPLMQ  981



>ref|XP_003562967.2| PREDICTED: beta-amylase [Brachypodium distachyon]
Length=811

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 84/175 (48%), Gaps = 5/175 (3%)
 Frame = +1

Query  160  EVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF---  330
            E   RR  +GL +  V G +     LA  N   +  P           N +   R F   
Sbjct  636  ETAGRRAVLGLMASGVAGGAFAQAVLAAVNPIKVGPPPLPSGGLPGTENSDE-ARDFALP  694

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  695  LKNRFYLQPLPPAAAAARAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  754

Query  511  ST-AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+ A   EK+ L DL  +LFD ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  755  SSKATKEEKKDLKDLTGKLFDTLDGLDHAAKIKSPAEAEKYYGETKTVLSDVLAK  809



>gb|EYU27845.1| hypothetical protein MIMGU_mgv1a013205mg [Erythranthe guttata]
Length=228

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  382  RLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANR  561
            R  + A +++ +  LI   AW YV   LR KA+++ +D + VI+     EKQ L DL ++
Sbjct  130  RAKESAKEIVGVKTLIEQKAWPYVQNDLRSKASYLRYDLNTVIAAKPKAEKQSLKDLTSK  189

Query  562  LFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            L  NI +L+ A K ++ +  E  Y  T+  L EV++K
Sbjct  190  LLKNISDLDHAAKIKSSAEAEKYYAETVSTLNEVLAK  226



>tpg|DAA41058.1| TPA: oxygen-evolving enhancer protein 3-1 [Zea mays]
Length=216

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    ++ R+   A D++ L  LI   AW YV   LR++A+++ +D   VI
Sbjct  101  LKERFYLQPLPPAEAVARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVI  160

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++    EKQ L +L  +LF  I++L+ A K ++    E  +  T   L +V++K
Sbjct  161  ASKPKEEKQSLKELTGKLFSTIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAK  214



>ref|XP_002315041.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
 gb|EEF01212.1| oxygen evolving enhancer 3 family protein [Populus trichocarpa]
Length=202

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 89/188 (47%), Gaps = 16/188 (9%)
 Frame = +1

Query  109  HFADKKAPEIQEN-QPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT  285
            H   + AP I+ +  PL  VT RR  V   S ++        +L + +G   T P   P 
Sbjct  25   HQPKRSAPIIKASISPLESVTNRRKIVAFLSTSL--------ALGQLHGTTTTAP---PA  73

Query  286  VTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYL  465
              ++    + GTRS +    +  ++  + ++ R+ + A  L ++ D++ S AW YV+ Y+
Sbjct  74   ALAE----KWGTRSLLWEHFFQPDLSPEDAVARITQTAEGLHSMRDMLESMAWRYVMFYI  129

Query  466  RIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
            R K  ++  D     ST   + ++     AN L DN++E +  V+   +  +   YE TL
Sbjct  130  RQKQAYLSKDLKNAFSTLPPSRREDYVKKANELVDNMDEFDSYVRTPRVYESYLYYEKTL  189

Query  646  VLLQEVMS  669
              + ++++
Sbjct  190  KSIDDIVA  197



>dbj|BAD97359.1| PsbQ [Nicotiana tabacum]
Length=228

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 80/174 (46%), Gaps = 9/174 (5%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIG-----KSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF  330
            T RR  +GL +  + GS         KS+        +G LP    + + R+ +      
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEARDLDL----P  112

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VI
Sbjct  113  LKERFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVI  172

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK  L DL  +L   I +L+ A K +N    E  Y  T+  L +V++K
Sbjct  173  SAKPKEEKGKLQDLTGKLLKTISDLDHAAKTKNSPEAEKYYADTVSTLNDVLAK  226



>ref|XP_006365879.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=230

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    ++ R+   A +++++ + I   AW YV   LR++A ++ +D   VI
Sbjct  115  LKNRFYLQPLTPAEAVQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVI  174

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            S     +K  L DL+ +LF  I +L+ A K +N    +  Y  T+  L +V++
Sbjct  175  SAKPKEQKGKLQDLSGKLFKTISDLDHAAKTKNSDEAQKYYAETVTTLNDVLA  227



>gb|AFK38240.1| unknown [Lotus japonicus]
Length=204

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 64/118 (54%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K   +   +  + ++ R+ + A  L ++ D++ S +W YV+ Y+R+K +++  D
Sbjct  84   GTRSFLKEHFFEPGLSPEDAVERIKQTAEGLHSMRDMLESMSWRYVMFYIRLKQSYLDQD  143

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                I+T   N K+     AN L DN+ EL+  V+   +  +   YE  L  + E+++
Sbjct  144  LKNAITTLPENRKKEYVKTANDLVDNMAELDRHVRSPKVYESYLYYERLLKSIDELVA  201



>emb|CDY46373.1| BnaA09g19870D [Brassica napus]
Length=218

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 87/176 (49%), Gaps = 4/176 (2%)
 Frame = +1

Query  154  LPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF-  330
            +PE + RR  +GL +  + G S +  ++A +      GP P P+      +     R F 
Sbjct  42   VPE-SSRRSVIGLVAAGLVGGSFVKSAVAAEALAIKVGPPPPPSGGLPGTDNSDQARDFS  100

Query  331  --VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDK  504
              +K++ Y+  +    +  R  + A +++ +  LI   AW YV   LR++A+++ +D + 
Sbjct  101  LKLKDRFYLQPLSPTEAAARAKESAKEIINVKTLIDKKAWPYVQNDLRLRASYLRYDLNT  160

Query  505  VISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            VIS     EKQ L +L  +LF  I+ L+ A + ++    E  Y  T+  L  V++K
Sbjct  161  VISAKPKEEKQSLKELTGKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLAK  216



>ref|XP_003613863.1| Oxygen-evolving enhancer protein 3-2 [Medicago truncatula]
 gb|AES96821.1| oxygen-evolving enhancer protein [Medicago truncatula]
Length=261

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K   ++  +  + ++ R+ + A  L  L +++ + +W YV+ Y+R+K  ++  D
Sbjct  141  GTRSFMKEHFFMPGLSPEDAVLRIKQTAEGLHNLREMLETLSWRYVMFYIRLKQNYLEQD  200

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                I+T   N ++     AN L DN+ E++  V+   +  +   YE TL  + E++++
Sbjct  201  LRNAITTLPENRRKEYVKTANELVDNLTEMDRYVRTPKVYESYLYYEKTLKSIDELVAQ  259



>ref|XP_010686934.1| PREDICTED: oxygen-evolving enhancer protein 3, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=233

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 5/173 (3%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFV----  333
            T RR  +GL +  +   S +   LAE     +  P P         N +   R F     
Sbjct  60   TSRRAVLGLVAAGLASGSFVKAVLAEAKSIPVGPPPPPSGGLPGTLNSDQA-RDFNLPYN  118

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ Y+  +    +  R    A +++ +  LI   AW YV   LR++A ++ +D   VIS
Sbjct  119  KDRFYLQPLSPTEAAQRAKVSAKEIINVKQLIDKKAWPYVQNDLRLRAEYLRYDLKTVIS  178

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                +EK+ L DL  +LFD+I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  179  AKPKDEKKSLQDLTGKLFDSINNLDHAAKIKSSPEAEKYYGQTVSNLNDVLAK  231



>gb|ACJ86175.1| unknown [Medicago truncatula]
 gb|AFK46391.1| unknown [Medicago truncatula]
Length=193

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K   ++  +  + ++ R+ + A  L  L +++ + +W YV+ Y+R+K  ++  D
Sbjct  73   GTRSFMKEHFFMPGLSPEDAVLRIKQTAEGLHNLREMLETLSWRYVMFYIRLKQNYLEQD  132

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                I+T   N ++     AN L DN+ E++  V+   +  +   YE TL  + E++++
Sbjct  133  LRNAITTLPENRRKEYVKTANELVDNLTEMDRYVRTPKVYESYLYYEKTLKSIDELVAQ  191



>ref|XP_004490109.1| PREDICTED: LOW QUALITY PROTEIN: psbQ-like protein 1, chloroplastic-like 
[Cicer arietinum]
Length=260

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K   +   +  + ++ R+ + A  L ++ +++ + +W YV+ Y+R+K  ++  D
Sbjct  140  GTRSFLKEHFFEPGLSPEDAVARIKQTAEGLHSIREMLETMSWRYVMFYIRLKQNYLGQD  199

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                +ST   N ++    +AN L DN+ E++  V+   +  +   YE TL  + E+++
Sbjct  200  LKNALSTMPENRRKEYVKIANELVDNLTEMDRYVRSPKVYESYVYYEKTLKSIDELVA  257



>ref|XP_008441634.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Cucumis melo]
Length=231

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++     + ++ R  + A D++ +   I   AW +V   LR+KA ++ +D   +I
Sbjct  116  LKDRFFLQPQSPEMAVARAKESAKDIINVKGQIEKKAWPFVRDDLRLKAEYLRYDLKTII  175

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+    EKQ L DL  +LF +I  L+ A K ++ S  E  Y  T+  L +V+SK
Sbjct  176  SSKPKEEKQALKDLTGKLFQDINNLDYAAKIKSSSEAEKYYAQTVSTLNDVLSK  229



>ref|XP_010937194.1| PREDICTED: psbQ-like protein 1, chloroplastic [Elaeis guineensis]
Length=193

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/171 (25%), Positives = 79/171 (46%), Gaps = 18/171 (11%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVK  336
            P +T RR A+    +AV   SG+        G W   P          + +  GT SFVK
Sbjct  38   PRMTTRRWAL---LVAVLAGSGMP-------GLWRPPP--------PAQAQSWGTHSFVK  79

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
             + +   +  + +  R+ + A  +  +  ++ + +W +VL Y+R+K  ++  D    ++T
Sbjct  80   EKYFQPGLTPEEAAARIRQTAEGMREIRHMLDTMSWRFVLFYVRLKGAYLDSDLKNAMAT  139

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                 ++    +AN L DN+ EL+  V+   +  +   YE TL  L E+++
Sbjct  140  VPEARRKSYVKIANELVDNMAELDRYVRSPKVYESYLYYEKTLKSLDELIA  190



>gb|KFK28701.1| hypothetical protein AALP_AA7G035500 [Arabis alpina]
Length=226

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 92/181 (51%), Gaps = 5/181 (3%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETG  318
            Q+++  PE T RR  +GL +  + G S +   LA+     +  P P         N +  
Sbjct  46   QQSEATPETT-RRSVIGLVAAGLAGGSFVQAVLADAVPIKIGPPPPPSGGLPGTENSDQA  104

Query  319  TRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMY  489
             R F   +K++ Y+  +    +  R    A D++ +  LI   AW YV   LR KA+++ 
Sbjct  105  -RDFSLALKDRFYLQPLPPTEAAARAKDSAKDIINVKSLIDKKAWPYVQNDLRSKASYLR  163

Query  490  FDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +D + +IS+   +EK+ L +L+ +LF+ I  L+ A KK++ +  E  Y  T+  L ++++
Sbjct  164  YDLNTIISSKSKDEKKSLKELSTKLFETINNLDYAAKKKSTADAEKYYSETVSTLTDLLA  223

Query  670  K  672
            K
Sbjct  224  K  224



>ref|NP_001236143.1| uncharacterized protein LOC100499794 [Glycine max]
 gb|ACU13672.1| unknown [Glycine max]
Length=232

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ FD + VI
Sbjct  117  LKDRFFLQPLSPTDAAQRAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  176

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  AAKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAK  230



>ref|XP_009588901.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic 
[Nicotiana tomentosiformis]
Length=228

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 79/173 (46%), Gaps = 9/173 (5%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIG-----KSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSF  330
            T RR  +GL +  + GS         KS+        +G LP    + + R+ +      
Sbjct  57   TSRRAVIGLVAAGLAGSFAQAAFAAAKSIKIGGAPPPSGGLPGTLNSDEARDLDL----P  112

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R+   A +++++ + I   AW YV   LR++A ++ +D   VI
Sbjct  113  LKERFYLQPLTPAEAAQRVKDSAKEIVSVKNFIDKKAWPYVQNDLRLRAEYLRYDLKTVI  172

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            S     EK  L DL  +L   I +L+ A K +N    E  Y  T+  L +V++
Sbjct  173  SAKPKEEKGKLQDLTGKLLKTISDLDHAAKTKNSPEAEKYYADTVSTLNDVLA  225



>pdb|1NZE|A Chain A, Crystal Structure Of Psbq Polypeptide Of Photosystem 
Ii From Higher Plants
 pdb|1VYK|A Chain A, Crystal Structure Of Psbq Protein Of Photosystem Ii 
From Higher Plants
Length=149

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 64/119 (54%), Gaps = 0/119 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GT  + K++ Y+  +    +  R    A +++ +   I   AW  +   LR++A+++ +D
Sbjct  29   GTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYD  88

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
               VIS    +EK+ L +L ++LF +I+ L+ A K ++ +  E  Y  T+  + EV++K
Sbjct  89   LKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAK  147



>dbj|BAJ88044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  101  LKNRFYLQPLPPAQAAVRAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  160

Query  511  STAEAN-EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+     EK+ L DL  +LF  ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  161  SSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEAEKYYGETKTVLGDVLAK  215



>gb|EMT11196.1| Oxygen-evolving enhancer protein 3-1, chloroplastic [Aegilops 
tauschii]
Length=166

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  50   LKNRFYLQPLPPAEAAVRAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  109

Query  511  STAEAN-EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+     EK+ L DL  +LF  ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  110  SSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEAEKYYGETKTVLGDVLAK  164



>dbj|BAJ89010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=231

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  115  LKNRFYLQPLPPAQAAVRAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  174

Query  511  STAEAN-EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+     EK+ L DL  +LF  ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  175  SSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEAEKYYGETKTVLGDVLAK  229



>ref|XP_004145092.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004153319.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004158022.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64579.1| hypothetical protein Csa_1G066480 [Cucumis sativus]
Length=231

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++       ++ R  + A D++ +   I   AW +V   LR+KA ++ +D   +I
Sbjct  116  LKDRFFLQPQSPAMAVARAKESAKDIINVKGQIEKKAWPFVRDDLRLKAEYLRYDLKTII  175

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EKQ L DL  +LF +I  L+ A K ++ S  E  Y  T+  L +V+SK
Sbjct  176  SAKPKEEKQALKDLTGKLFQDINNLDYAAKIKSSSEAEKYYAQTVSTLNDVLSK  229



>dbj|BAJ88009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=231

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  115  LKNRFYLQPLPPAQAAVRAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  174

Query  511  STAEAN-EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+     EK+ L DL  +LF  ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  175  SSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEAEKYYGETKTVLGDVLAK  229



>ref|XP_011003398.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Populus euphratica]
Length=232

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 0/105 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + ++  +    +  R  + A D++ +  LI   AW YV   LR+KA ++ FD + VI
Sbjct  119  LKQRFFLQPLPPSEAAVRAKESAKDILGVKTLIDQKAWPYVQNDLRLKAGYLRFDLNTVI  178

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
            S    +EK+ L +L  +LFD I  L+ A K ++    E  Y  T+
Sbjct  179  SAKSKDEKKSLKELTGKLFDTISNLDYAAKIKSTPEAEKYYAQTV  223



>ref|NP_001288977.1| oxygen-evolving enhancer protein 3-1, chloroplastic [Brassica 
rapa]
 dbj|BAF81515.1| oxygen-evolving enhancer protein 3-2 [Brassica rapa]
 emb|CDX79052.1| BnaA01g11190D [Brassica napus]
Length=227

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 93/186 (50%), Gaps = 15/186 (8%)
 Frame = +1

Query  139  QENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVT--------S  294
            Q+++  PE T RR  +GL +  + G S +   LA+        P+ I            +
Sbjct  47   QQSEAAPETT-RRSVIGLVAAGLAGGSFVQAVLAD------AVPIKIGPPPPPSGGLPGT  99

Query  295  DIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIK  474
            D  ++    +  +K + Y+  +    ++ R  + A +++ +  LI   AW YV   LR++
Sbjct  100  DNSDQARDLKLALKERFYLQPLPPTEAVARAKESAKEIVNVKSLIDKKAWPYVQNDLRLR  159

Query  475  ATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLL  654
            A+++ +D + +IS+   +EK+ L +L  +LFD I  L+ A KK++    E  Y  T+  L
Sbjct  160  ASYLRYDLNTIISSKSKDEKKSLKELTGKLFDTINNLDYAAKKKSTPDAEKYYSETVSTL  219

Query  655  QEVMSK  672
             +V++K
Sbjct  220  NDVLAK  225



>gb|EMS52833.1| Beta-amylase [Triticum urartu]
Length=568

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 72/137 (53%), Gaps = 5/137 (4%)
 Frame = +1

Query  274  PIPTVTSDIRNKETGTRSF---VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAW  444
            P P +++   N +   R F   +KN+ Y+  +    +  R  + A D++ L  LI    W
Sbjct  431  PPPPLSAGTDNSDEA-RDFDLPLKNRFYLQPLPPAEAAVRAKESAQDILNLKPLIDKKQW  489

Query  445  SYVLRYLRIKATFMYFDFDKVIST-AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLT  621
             YV+  LR++A+++ +D   VIS+     EK+ L DL  +LF  ++ L+ A K ++ +  
Sbjct  490  PYVMNDLRLRASYLRYDLKTVISSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEA  549

Query  622  ESRYEGTLVLLQEVMSK  672
            E  Y  T  +L +V++K
Sbjct  550  EKYYGETKTVLSDVLAK  566



>dbj|BAJ90882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=244

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 1/115 (1%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L  LI    W YV+  LR++A+++ +D   VI
Sbjct  128  LKNRFYLQPLPPAQAAVRAKESAQDILNLKPLIDKKQWPYVMNDLRLRASYLRYDLKTVI  187

Query  511  STAEAN-EKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S+     EK+ L DL  +LF  ++ L+ A K ++ +  E  Y  T  +L +V++K
Sbjct  188  SSKTTKEEKKDLKDLTGKLFATLDGLDHAAKIKSPTEAEKYYGETKTVLGDVLAK  242



>gb|EYU22404.1| hypothetical protein MIMGU_mgv1a014459mg [Erythranthe guttata]
Length=189

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 57/110 (52%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF++ + +   +  + S+ R+ + A  L AL  ++ S +W YV+ Y+R+K  ++  D
Sbjct  70   GTRSFIRERFFEPGLSPEDSVARIRQSAEGLHALRGMLESMSWRYVIFYIRLKQAYLSQD  129

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                ++    N++      AN L DN+ E +  V+   +  +   YE TL
Sbjct  130  MKTALTMVPENQRDSYVQAANALVDNMAEFDHYVRSPKVYESYLYYEKTL  179



>ref|XP_010923989.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Elaeis guineensis]
Length=235

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            VK++ Y+  +    +  RL + A D+M + +LI    W YV   LR++A+++ +D + VI
Sbjct  120  VKDRFYLQPLPPAEAAARLKESAKDIMNIKELIDKKQWPYVQNDLRLRASYLRYDLNTVI  179

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL +LA +LF  I+EL+ A K ++ +  E  Y  T   L +V++K
Sbjct  180  SAKPKEEKKPLKELAGKLFATIDELDHAAKIKSTTDAEKYYAETRSALADVLAK  233



>dbj|BAJ93485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=92

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +1

Query  355  NIGT--KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTA  519
            + GT  KG + R+N CA +L ++ + +  +   +W  V R LR+KATF+Y D  +VIS+ 
Sbjct  2    DFGTELKGCVCRINNCAIELFSMEEDLEIEDEDSWDLVGRDLRLKATFLYIDLSRVISSC  61

Query  520  EANE-KQPLTDLANRLFDNIEEL  585
            E++E K+ LTDLAN+ F  ++E+
Sbjct  62   ESDEYKKMLTDLANKFFYFMDEV  84



>sp|P12301.1|PSBQ_SPIOL RecName: Full=Oxygen-evolving enhancer protein 3, chloroplastic; 
Short=OEE3; AltName: Full=16 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=OEC 16 kDa subunit; 
Flags: Precursor [Spinacia oleracea]
 emb|CAA29056.1| 16 kDa protein of the photosynthetic oxygen-evolving protein 
(OEC) [Spinacia oleracea]
 prf||1307179B luminal protein 16kD
Length=232

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 82/172 (48%), Gaps = 3/172 (2%)
 Frame = +1

Query  166  TKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKET---GTRSFVK  336
            T RR  +G  +  +   S +   LAE     +  P P+        N +    GT  + K
Sbjct  59   TSRRAMLGFVAAGLASGSFVKAVLAEARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTK  118

Query  337  NQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIST  516
            ++ Y+  +    +  R    A +++ +   I   AW  +   LR++A+++ +D   VIS 
Sbjct  119  DRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISA  178

Query  517  AEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
               +EK+ L +L ++LF +I+ L+ A K ++ +  E  Y  T+  + EV++K
Sbjct  179  KPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAK  230



>gb|EMT14797.1| hypothetical protein F775_22951 [Aegilops tauschii]
Length=138

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 6/87 (7%)
 Frame = +1

Query  355  NIGT--KGSMYRLNKCAFDLMALGDLIGSD---AWSYVLRYLRIKATFMYFDFDKVISTA  519
            + GT  KG + R+N CA +L ++ + +  +   +W  V R LR+KATFMY D  +VIS+ 
Sbjct  2    DFGTELKGCVCRINNCAIELFSMEEDLEIEDEDSWDLVGRDLRLKATFMYIDLSRVISSC  61

Query  520  EANE-KQPLTDLANRLFDNIEELEDAV  597
            E++E K+ LT LAN+ F  ++E+  +V
Sbjct  62   ESDERKKTLTGLANKFFYFMDEVMISV  88



>ref|NP_001236541.1| uncharacterized protein LOC100306034 [Glycine max]
 gb|ACU14016.1| unknown [Glycine max]
Length=234

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ FD + VI
Sbjct  119  LKDRFFLQPLSPTEAAQRAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  178

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  179  AGKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAK  232



>ref|XP_010539217.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like, 
partial [Tarenaya hassleriana]
Length=149

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A +++ +   I   AW YV   LR++A ++ +D + VIS
Sbjct  35   KDRFFLQPLSPTEAAARAKESAKEIVNVKAFIDKKAWPYVQNDLRLRAEYLRYDLNTVIS  94

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +   +EKQ L +L  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  95   SKPKDEKQNLKELTGKLFQSISGLDHAAKIKSTPEAEKYYAETVSSLNDVLAK  147



>gb|ACJ61487.1| oxygen-evolving enhancer protein 3 [Glycine max]
Length=236

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ FD + VI
Sbjct  121  LKDRFFLQPLSPTEAAQRAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  180

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  181  AGKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAK  234



>gb|KHN34510.1| Oxygen-evolving enhancer protein 3-2, chloroplastic [Glycine 
soja]
Length=230

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K++ ++  +    +  R  + A +++ +  LI   AW YV   LR++A ++ FD + VI
Sbjct  115  LKDRFFLQPLSPTEAAQRAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  174

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  175  AGKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAK  228



>ref|XP_009398204.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=236

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + ++  +G   +  R  + A D++ + + I   AW YV+  LR+KA ++ +D + VI
Sbjct  121  LKERFFLQPLGPAEAAARAKESAKDIIGVKEFIDQKAWPYVMNNLRLKAEYLRYDLNTVI  180

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL +L+ +LF  I EL+ A K ++ S     Y  T  +L +V++K
Sbjct  181  SAKPKEEKKPLKELSGKLFATISELDHAAKIKSSSEAAKYYAATKSILDDVIAK  234



>gb|KHN44565.1| Oxygen-evolving enhancer protein 3-2, chloroplastic [Glycine 
soja]
Length=215

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +1

Query  382  RLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANR  561
            R  + A +++ +  LI   AW YV   LR++A ++ FD + VI+    +EK+ L +L  +
Sbjct  117  RAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVIAAKPKDEKKSLKELTGK  176

Query  562  LFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            LF +I  L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  LFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAK  213



>ref|XP_010267815.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
[Nelumbo nucifera]
Length=235

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A  ++ + +LI   AW YV   LR+KA ++ +D + VI
Sbjct  120  LKNRFYLQPLTPTEAAQRAKQSAKGIVGVKELIDKKAWPYVQNDLRLKAEYLRYDLNTVI  179

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL DL ++LF  I+ L+ A K ++    E  Y  T+  L +V++K
Sbjct  180  SAKPKEEKKPLKDLTSKLFQTIDSLDHAAKVKSTPEAEKYYAETVSTLNDVLAK  233



>gb|AHA84172.1| chloroplast oxygen-evolving enhancer protein [Phaseolus vulgaris]
Length=219

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + ++  +    +  R  + A +++A+  LI   AW YV   LR++A ++ FD + VI
Sbjct  104  LKERFFLQPLSPTEAAQRAKESAKEIVAVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  163

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y   +  L +V++K
Sbjct  164  AAKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAVAISTLNDVLAK  217



>ref|XP_007134497.1| hypothetical protein PHAVU_010G052300g [Phaseolus vulgaris]
 gb|ESW06491.1| hypothetical protein PHAVU_010G052300g [Phaseolus vulgaris]
Length=223

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + ++  +    +  R  + A +++A+  LI   AW YV   LR++A ++ FD + VI
Sbjct  108  LKERFFLQPLSPTEAAQRAKESAKEIVAVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVI  167

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            +    +EK+ L +L  +LF +I  L+ A K ++    E  Y   +  L +V++K
Sbjct  168  AAKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAVAISTLNDVLAK  221



>ref|XP_008793745.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Phoenix dactylifera]
Length=237

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +KN+ Y+  +    +  R  + A D++ L +LI    W YV   LR+KA+++ FD + VI
Sbjct  122  LKNRFYLQPLPPAEAAARAKESAKDIVNLKELIEKKQWPYVQNDLRLKASYLRFDLNTVI  181

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            S     EK+PL +L  +LF  I+EL+ A K +++   E  Y  T   + +V++K
Sbjct  182  SAKPKEEKKPLKELTGKLFATIDELDHAAKIKSVPEAEKYYAATKSAINDVLAK  235



>ref|NP_001047498.1| Os02g0631100 [Oryza sativa Japonica Group]
 dbj|BAD26475.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09412.1| Os02g0631100 [Oryza sativa Japonica Group]
 gb|EAY86788.1| hypothetical protein OsI_08168 [Oryza sativa Indica Group]
 gb|EAZ23895.1| hypothetical protein OsJ_07615 [Oryza sativa Japonica Group]
 dbj|BAG97103.1| unnamed protein product [Oryza sativa Japonica Group]
Length=119

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = +1

Query  370  GSMYRLNKCAFDLMALGD--LIGSDA------WSYVLRYLRIKATFMYFDFDKVISTAEA  525
            G + R+  CA +L+ + +  +IG D       WS     L++K TF+Y D  +VIS++E+
Sbjct  9    GCVCRIKNCAVELLEMEEDLVIGMDDDDRDLFWSE----LQLKTTFLYIDLSRVISSSES  64

Query  526  NEK-QPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
            +E+ + LT L N+LF  +EEL DAV   ++S T+  Y      L+EV++
Sbjct  65   DERREALTLLTNKLFYFLEELTDAVTSGSVSFTKLCYGDAAQALREVVA  113



>ref|XP_008783622.1| PREDICTED: psbQ-like protein 1, chloroplastic [Phoenix dactylifera]
Length=193

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/194 (23%), Positives = 88/194 (45%), Gaps = 28/194 (14%)
 Frame = +1

Query  88   RKRAAAIHFADKKAPEIQENQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTG  267
            R+   A+H  ++K          P +T RR A+  A++A       G ++    G W   
Sbjct  25   RRLQQAVHAPEEK----------PGMTTRRWALLFAALA-------GSAMP---GLWRPP  64

Query  268  PLPIPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWS  447
            P          + +  GT SF+K + +   +  + +  R+ + A  L  +  ++ + +W 
Sbjct  65   P--------PAQAQSWGTHSFIKEKYFQPGLTPEEAAARIRQTAEGLREIRHMLDTMSWR  116

Query  448  YVLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTES  627
            +VL Y+R+K  ++  D    ++T     ++    +AN L +N+ EL+  V+   +  +  
Sbjct  117  FVLYYIRLKQAYLDADLKNAVATVPEARRKSYVKIANELVENMAELDRYVRSPKVYESYL  176

Query  628  RYEGTLVLLQEVMS  669
             YE TL  L E+++
Sbjct  177  YYEKTLNSLDELIA  190



>ref|XP_010999548.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=241

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 81/163 (50%), Gaps = 9/163 (6%)
 Frame = +1

Query  157  PEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPT--VTSDIRNKETGTRSF  330
            PE T RR  +GL +  +   S +   LA      + GP P P+  +   + + E   R  
Sbjct  60   PE-TSRRGMLGLVAAGLASGSFVQAVLAASLPIKV-GPPPAPSGGLPGTLNSDEA--RDL  115

Query  331  V---KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFD  501
            V   K + ++  +    +  R  + A +++ +  LI   AW YV   LR+K++++ +D +
Sbjct  116  VLPLKERFFLQPLPPAAAAARAKESAKEIIGVKGLIDKKAWPYVQNDLRLKSSYLRYDLN  175

Query  502  KVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESR  630
             VIS    +EK+ L +L  +LFD I  L+ A K +++   E++
Sbjct  176  TVISAKSKDEKKSLKELTGKLFDTISNLDHAAKNKSIPEPEAQ  218



>gb|AAW28572.1| Putative oxygen evolving enhancer protein 3, identical [Solanum 
demissum]
Length=193

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 85/190 (45%), Gaps = 26/190 (14%)
 Frame = +1

Query  109  HFADKKAPEIQENQPLPE--VTKRR--LAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLP  276
            H   K  P+IQ N    E   T RR  +A  LA+    G      +LAE+   W      
Sbjct  22   HTQCKTLPKIQSNLSTNEENFTCRRKLIATFLATPLTLGLPFTPLALAEN---W------  72

Query  277  IPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL  456
                         G RSF++   +   +  + ++ R+ + A  L ++ +++ +++W YVL
Sbjct  73   -------------GVRSFLREHFFEPGLSPEDAVARIRQTADGLHSIKEMLETNSWRYVL  119

Query  457  RYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYE  636
             Y+R+K+ ++  D    +S    + K+     AN L DN+ E +  ++   +  +   YE
Sbjct  120  FYIRLKSAYLKQDMKNALSRVPESRKESYIKTANELTDNMAEFDYYIRTPKVYESRVFYE  179

Query  637  GTLVLLQEVM  666
             TL  + E++
Sbjct  180  KTLKSIDELV  189



>ref|XP_009401413.1| PREDICTED: psbQ-like protein 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=203

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K + +   +  + +  R+ + A  +  +  ++ + +W YV+ Y+R+K+ ++  D
Sbjct  83   GTRSFIKEKYFQPGLTPEEAAARIRQTAEGMRDMRHMLDTMSWRYVMFYVRLKSAYLDAD  142

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                ++      ++     AN L DN+ EL+  ++   +  +   YE TL  L E+++
Sbjct  143  LKNAVAAVPEPRRKAFVKTANELVDNMAELDRYIRSPKVYESYLYYEKTLKSLDELVA  200



>gb|EMT06871.1| hypothetical protein F775_26551 [Aegilops tauschii]
Length=105

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALG-DLI---GSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-  531
            KG + R+  CA  L+++  DL+     D+W  V R LR+KATF+Y D  +VIS +E +E 
Sbjct  8    KGCVCRIKSCAGQLLSMEEDLVTDLDDDSWDLVWRDLRLKATFLYIDLSRVISRSENDER  67

Query  532  KQPLTDLANRLFDNIEEL  585
            ++ LT LAN+ F   +E+
Sbjct  68   RKALTLLANKFFYCTDEI  85



>ref|XP_008339879.1| PREDICTED: psbQ-like protein 1, chloroplastic [Malus domestica]
Length=201

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            G RSF++ + +   +  + ++ R+ + A  L ++ D++ + AW YV+ Y+R+K+ ++  D
Sbjct  81   GVRSFIRERFFEPGLSPEDAVARIRQTAEGLHSMRDILEAMAWRYVIFYIRLKSAYLSQD  140

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
                ++      +      AN L DN+ EL+  V+   +  +   YE TL  L ++++
Sbjct  141  LKNAVTLVPEGRRNEYAKTANELVDNMAELDYYVRTPKVYESYLYYEKTLKSLDDLVA  198



>ref|XP_004133817.1| PREDICTED: psbQ-like protein 1, chloroplastic-like [Cucumis sativus]
 ref|XP_004155162.1| PREDICTED: psbQ-like protein 1, chloroplastic-like [Cucumis sativus]
 gb|KGN56433.1| hypothetical protein Csa_3G119660 [Cucumis sativus]
Length=187

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 58/110 (53%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GT SF+K + +   +  + ++ R+ + A  L ++ +++ + +W YV+ Y+R+K+ ++  D
Sbjct  67   GTHSFIKERYFEPGLSAEEAVARIKQTAEGLHSIREMLETTSWRYVIFYIRLKSAYLSQD  126

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                ++T     +      AN L DN+ EL+  V+   +  +   YE TL
Sbjct  127  LKTAMTTLPQARRNDFVKTANELVDNMAELDYYVRTPKVYESYLYYEKTL  176



>ref|XP_006355121.1| PREDICTED: psbQ-like protein 1, chloroplastic-like isoform X1 
[Solanum tuberosum]
 ref|XP_006355122.1| PREDICTED: psbQ-like protein 1, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=193

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/190 (23%), Positives = 84/190 (44%), Gaps = 26/190 (14%)
 Frame = +1

Query  109  HFADKKAPEIQENQPLPE----VTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLP  276
            H   K  P+IQ N    E      ++ +A  LA+    G      +LAE+   W      
Sbjct  22   HTQCKTLPKIQSNLSTNEENFSCRRKLIATFLATPLTLGLQFTPLALAEN---W------  72

Query  277  IPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL  456
                         G RSF++   +   +  + ++ R+ + A  L ++ +++ +++W YVL
Sbjct  73   -------------GVRSFLREHFFEPGLSPEDAVARIRQTADGLHSIKEMLETNSWRYVL  119

Query  457  RYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYE  636
             Y+R+K+ ++  D    +S    + K+     AN L DN+ E +  ++   +  +   YE
Sbjct  120  FYIRLKSAYLKQDMKNALSRVPESRKESYIKTANELTDNMAEFDYYIRTPKVYESRVFYE  179

Query  637  GTLVLLQEVM  666
             TL  + E++
Sbjct  180  KTLKSIDELV  189



>ref|XP_006827305.1| hypothetical protein AMTR_s00010p00265990 [Amborella trichopoda]
 gb|ERM94542.1| hypothetical protein AMTR_s00010p00265990 [Amborella trichopoda]
Length=193

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 69/133 (52%), Gaps = 4/133 (3%)
 Frame = +1

Query  271  LPIPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSY  450
            + IPT  ++    E G+RSF+  + ++ ++  + +  R+ + +  L  +  ++   AW Y
Sbjct  62   MKIPTALAE----EWGSRSFLLERYFMPSLSPENAAARIKQTSEGLHRMRSMLDRMAWRY  117

Query  451  VLRYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESR  630
            V+ Y+R K T++  D    ++T   N ++     AN L +N+ EL+  V+   +  +   
Sbjct  118  VIFYIRQKMTYLSSDLKSAMATLPENRRKSYVRSANELVENMAELDSYVRTPRVYESYLY  177

Query  631  YEGTLVLLQEVMS  669
            YE TL  L E+++
Sbjct  178  YEKTLKSLDELVA  190



>ref|XP_010258294.1| PREDICTED: psbQ-like protein 1, chloroplastic [Nelumbo nucifera]
Length=191

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (52%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K + +   + ++ ++ R+ + A  L ++  ++ + +W YVL Y+R+K  ++  D
Sbjct  71   GTRSFIKERFFEPGLSSEDAVARIRQTAEGLHSIRGMLETMSWRYVLFYIRLKTAYLSQD  130

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
               V++    N        AN L DN+ E +  V+   +  +   YE TL
Sbjct  131  LKNVLTIMPENRLDSYVKTANELVDNMAEFDYYVRTPKVYESYLYYEKTL  180



>ref|XP_008437911.1| PREDICTED: psbQ-like protein 1, chloroplastic [Cucumis melo]
Length=186

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/167 (23%), Positives = 76/167 (46%), Gaps = 9/167 (5%)
 Frame = +1

Query  145  NQPLPEVTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTR  324
            + P   + +R   +  AS+ +     I  +LA   G     PL +         +  GT 
Sbjct  18   STPHKSLHRRHFPIITASLPI-HRRHIATTLAVVIGLQAATPLALA--------QSWGTH  68

Query  325  SFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDK  504
            SF+K + +   +    ++ R+ + A  L ++ +++ + +W YV+ Y+R+K+ ++  D   
Sbjct  69   SFIKERYFEPGLSADEAVARIKQTAEGLHSIREMLETTSWRYVIFYIRLKSAYLSQDLKT  128

Query  505  VISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
             ++T     +      AN L DN+ EL+  V+   +  +   YE TL
Sbjct  129  AMTTLPQARQNDFVKTANELVDNMAELDYYVRTPKVYESYLYYEKTL  175



>dbj|BAJ92149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=97

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALG-DLI---GSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-  531
            KG + R+  CA  L+++  DL+     D+W  V R LR+KATF+Y D  +VIS +E +E 
Sbjct  8    KGCVCRIKSCAGQLLSMEEDLVTDLDDDSWDLVWRDLRLKATFLYIDLSRVISRSENDER  67

Query  532  KQPLTDLANRLFDNIEEL  585
            ++ LT LAN+ F   +EL
Sbjct  68   RKALTLLANKFFYCTDEL  85



>ref|NP_001059911.1| Os07g0544800 [Oryza sativa Japonica Group]
 sp|Q0D5P8.1|PSBQ_ORYSJ RecName: Full=Oxygen-evolving enhancer protein 3, chloroplastic; 
Short=OEE3; AltName: Full=LP02; Flags: Precursor [Oryza 
sativa Japonica Group]
 sp|P83646.2|PSBQ_ORYSI RecName: Full=Oxygen-evolving enhancer protein 3, chloroplastic; 
Short=OEE3; AltName: Full=LP02; Flags: Precursor [Oryza 
sativa Indica Group]
 dbj|BAF21825.1| Os07g0544800 [Oryza sativa Japonica Group]
 dbj|BAG91296.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93941.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            ++ + Y+  +    +  R  + A D++ L  LI    W +V   LR++A+++ +D   VI
Sbjct  102  LRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVI  161

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++   +EK+ L DL  +LF  I+ L+ A K ++    E  Y  T   L +V++K
Sbjct  162  NSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAK  215



>ref|XP_006647554.1| PREDICTED: psbQ-like protein 2, chloroplastic-like [Oryza brachyantha]
Length=120

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 6/106 (6%)
 Frame = +1

Query  370  GSMYRLNKCAFDLMALGD--LIGSDAWSYVLRY--LRIKATFMYFDFDKVISTAEANE-K  534
            G + R+  CA +L+A+ +  +IG D     L +  LR+K TF+Y D  +VIS+ E++E +
Sbjct  9    GCVCRIKNCAVELLAMKEDLVIGMDDDDRDLFWGDLRLKTTFLYIDLSRVISSGESDERR  68

Query  535  QPLTDLANRLFDNIEELEDAVKK-RNLSLTESRYEGTLVLLQEVMS  669
            + LT L N+LF  +EEL DA+    ++S T+  Y      L+EV++
Sbjct  69   EALTLLTNKLFYFLEELTDALTSGGSVSFTKLCYGDAAQALREVVA  114



>dbj|BAC83128.1| putative Oxygen-evolving enhancer protein 3-1, chloroplast precursor 
(OEE3) [Oryza sativa Japonica Group]
 gb|EAZ04233.1| hypothetical protein OsI_26377 [Oryza sativa Indica Group]
Length=213

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            ++ + Y+  +    +  R  + A D++ L  LI    W +V   LR++A+++ +D   VI
Sbjct  98   LRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVI  157

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++   +EK+ L DL  +LF  I+ L+ A K ++    E  Y  T   L +V++K
Sbjct  158  NSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAK  211



>gb|EAZ40187.1| hypothetical protein OsJ_24632 [Oryza sativa Japonica Group]
Length=213

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            ++ + Y+  +    +  R  + A D++ L  LI    W +V   LR++A+++ +D   VI
Sbjct  98   LRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVI  157

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
            ++   +EK+ L DL  +LF  I+ L+ A K ++    E  Y  T   L +V++K
Sbjct  158  NSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAK  211



>ref|XP_009760875.1| PREDICTED: psbQ-like protein 1, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=193

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 64/120 (53%), Gaps = 4/120 (3%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            G RSF++   +   +  + ++ R+ + A  L ++ +++ + +W YVL Y+R+K+ ++  D
Sbjct  73   GVRSFLREHFFEPGLSPEDAVARIRQTADGLHSIKEMLETMSWRYVLFYIRLKSAYLKQD  132

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESR--YEGTLVLLQEVMS  669
                +S    + K+     AN L DN+ E +  +  R   + ESR  YE TL  + E+++
Sbjct  133  MKNALSRVPESRKEAFVKTANELTDNMAEFDYYI--RTPKVYESRVFYEKTLKSIDELVA  190



>ref|XP_006483122.1| PREDICTED: psbQ-like protein 1, chloroplastic-like [Citrus sinensis]
 gb|KDO82983.1| hypothetical protein CISIN_1g029051mg [Citrus sinensis]
Length=200

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 73/162 (45%), Gaps = 22/162 (14%)
 Frame = +1

Query  184  VGLASIAVFGSSGIGKSLAEDNGFWLTGPLPIPTVTSDIRNKETGTRSFVKNQMYIANIG  363
            VGL    +  SSG   +LAE    W                   GTRSF+K + +   + 
Sbjct  58   VGLHGDGIGSSSGASVALAES---W-------------------GTRSFLKERFFEPGLS  95

Query  364  TKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVISTAEANEKQPL  543
             + ++ R+ + A  + +L +++   AW YV+ Y+R+K  ++  D     ST     ++  
Sbjct  96   PEDAVARIKQTAEGMHSLREMVDRMAWRYVIFYIRLKQAYLSQDLKTAFSTLPEVRRREY  155

Query  544  TDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMS  669
             + AN L DN+ E +  V+   +  +   YE  L  L ++++
Sbjct  156  VNTANDLIDNMAEFDYYVRTPKVYESYLYYEKALKNLDDIVA  197



>ref|XP_002272064.1| PREDICTED: psbQ-like protein 1, chloroplastic [Vitis vinifera]
 emb|CBI31938.3| unnamed protein product [Vitis vinifera]
Length=188

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K + +   +  + ++ R+ + A  L ++  ++ + +W YV+ Y+R+K+ ++  D
Sbjct  68   GTRSFLKERFFEPGLSPEDAVARIRQTAEGLHSIRHMLETMSWRYVIFYIRLKSAYLSQD  127

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                ++T   + ++   + AN L DN+ E +  V+   +  +   YE TL
Sbjct  128  LKNAMTTLPESRRRSYANKANELVDNMAEFDYYVRTPKVYESYLYYEKTL  177



>gb|AAU90312.1| Putative oxygen evolving enhancer protein, identical [Solanum 
demissum]
Length=193

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/190 (23%), Positives = 84/190 (44%), Gaps = 26/190 (14%)
 Frame = +1

Query  109  HFADKKAPEIQENQPLPE----VTKRRLAVGLASIAVFGSSGIGKSLAEDNGFWLTGPLP  276
            H   K  P+IQ N    E      ++ +A  LA+    G      +LAE+   W      
Sbjct  22   HTQCKTLPKIQSNLSTNEENFSCRRKLIATFLATPLTLGLQFTPLALAEN---W------  72

Query  277  IPTVTSDIRNKETGTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVL  456
                         G RSF++   +   +  + ++ R+ + A  L ++ +++ +++W YVL
Sbjct  73   -------------GVRSFLREHFFEPGLSPEDAVARIRQTADGLHSIKEMLETNSWRYVL  119

Query  457  RYLRIKATFMYFDFDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYE  636
             Y+R+K+ ++  D    +S    + K+     AN L DN+ E +  ++   +  +   YE
Sbjct  120  FYIRLKSAYLKQDVKNALSRVPESLKESYIKTANELTDNMAEFDYYIRTPKVYESRVFYE  179

Query  637  GTLVLLQEVM  666
             TL  + E++
Sbjct  180  KTLKSIDELV  189



>gb|KHG11453.1| Oxygen-evolving enhancer 3, chloroplastic [Gossypium arboreum]
Length=231

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 64/113 (57%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A D++ + +LI   AW YV+  LR+KA ++ +D + VI+
Sbjct  117  KDRFFLQPLTPAQAAQRAKESAKDILGVKNLIDKKAWPYVMNDLRLKAEYLRYDLNTVIA  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                +EK+ L DL  +LF  I++L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  AKSKDEKKTLKDLTKKLFSTIDDLDHAAKIKSTPEAEKSYAQTISSLNDVLAK  229



>ref|XP_008776116.1| PREDICTED: oxygen-evolving enhancer protein 3-1, chloroplastic-like 
[Phoenix dactylifera]
Length=235

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 0/114 (0%)
 Frame = +1

Query  331  VKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVI  510
            +K + Y+  +    +  R  + A D++ L +LI    W YV   LR+KA+++ +D + VI
Sbjct  120  LKKRFYLQPLPPAEAAARAKESAKDIVNLKELIDKKQWPYVQNDLRLKASYLRYDLNTVI  179

Query  511  STAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                  EK+PL +LA +LF  I+EL+ A K ++    E  Y  T   L +V++K
Sbjct  180  DAKPKEEKKPLKELAGKLFATIDELDHAAKIKSTPEAEKYYAATKSALDDVLAK  233



>gb|KJB66602.1| hypothetical protein B456_010G146500 [Gossypium raimondii]
Length=231

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 64/113 (57%), Gaps = 0/113 (0%)
 Frame = +1

Query  334  KNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFDFDKVIS  513
            K++ ++  +    +  R  + A D++ + +LI   AW YV+  LR+KA ++ +D + VI+
Sbjct  117  KDRFFLQPLTPAQAAQRAKESAKDILGVKNLIDKKAWPYVMNDLRLKAEYLRYDLNTVIA  176

Query  514  TAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVMSK  672
                +EK+ L DL  +LF  I++L+ A K ++    E  Y  T+  L +V++K
Sbjct  177  AKPKDEKKTLKDLTKKLFSTIDDLDHAAKIKSTPEAEKSYAQTVSSLNDVLAK  229



>ref|XP_004298419.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=195

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF++ + +   +  + ++ R+ + A  L ++ D++ + AW Y+L Y+R+K+ ++  D
Sbjct  75   GTRSFIRERFFEPGLSPEDAVLRIRQTAEGLHSIRDMLEAMAWRYLLFYVRLKSAYLSQD  134

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                ++      ++     AN L DN++EL+  ++   +  +   YE TL
Sbjct  135  LKNAMTLVPEVNRKDYAKTANELVDNMKELDYYIRTPKVYESYLYYEKTL  184



>ref|XP_008389447.1| PREDICTED: psbQ-like protein 1, chloroplastic [Malus domestica]
Length=202

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 57/110 (52%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            G RSF++ + +   +  + ++ R+ + A  L ++ D++ + AW YV+ Y+R+K+ ++  D
Sbjct  82   GVRSFIRERFFEPGLSPEDAVARIRQTAEGLHSMRDMLEAMAWRYVIFYIRLKSAYLSQD  141

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                ++      +      AN L DN+ EL+  V+   +  +   YE TL
Sbjct  142  LKNAVNLVPEARRSEYAKTANELVDNMAELDYYVRTPKVYESYLYYEKTL  191



>ref|XP_011070986.1| PREDICTED: psbQ-like protein 1, chloroplastic [Sesamum indicum]
Length=193

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (51%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF+K + +   +  + ++ R+ + A  L  L  ++ S +W YV+ Y+R+K  ++  D
Sbjct  73   GTRSFLKERFFEPGLSPEDAVARIRQTAEGLHDLRGMLESMSWRYVIFYIRLKQAYLSQD  132

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                +S    + ++     AN L DN+ E +  V+   +  +   YE TL
Sbjct  133  MKTAMSMVPESRRKSYVQTANELVDNMAEFDYYVRTPKVYESYVYYEKTL  182



>gb|EMS68689.1| hypothetical protein TRIUR3_30148 [Triticum urartu]
Length=148

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +1

Query  367  KGSMYRLNKCAFDLMALG-DLI---GSDAWSYVLRYLRIKATFMYFDFDKVISTAEANE-  531
            KG + R+  CA  L+++  DL+     D+W  V R LR+KATF+Y D  +VIS +E +E 
Sbjct  8    KGCVCRIKSCAGQLLSMEEDLVTDLDDDSWDLVWRDLRLKATFLYIDLSRVISRSENDER  67

Query  532  KQPLTDLANRLFDNIEE  582
            ++ LT LAN+ F   +E
Sbjct  68   RKALTLLANKFFYCTDE  84



>ref|XP_010320690.1| PREDICTED: psbQ-like protein 1, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=193

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            G RSF++   +   +  + ++ R+ + A  L ++ +++ +++W YVL Y+R+K+ ++  D
Sbjct  73   GVRSFLREHFFEPGLSPEDAVARIRQTADGLHSIKEMLETNSWRYVLFYIRLKSAYLKQD  132

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTLVLLQEVM  666
                +S    + K+      N L DN+ E +  ++   +  +   YE TL  + E++
Sbjct  133  VKNALSRVPESRKESYIKTVNELTDNMAEFDYYIRTPKVYESRVFYEKTLKSIDELV  189



>ref|XP_007046041.1| PsbQ-like 2 [Theobroma cacao]
 gb|EOY01873.1| PsbQ-like 2 [Theobroma cacao]
Length=201

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 57/110 (52%), Gaps = 0/110 (0%)
 Frame = +1

Query  316  GTRSFVKNQMYIANIGTKGSMYRLNKCAFDLMALGDLIGSDAWSYVLRYLRIKATFMYFD  495
            GTRSF++ + +   +  + +  R+ + A  L ++ +++ + +W YV+ Y+R+K  ++  D
Sbjct  81   GTRSFLRERFFEPGLSPEDAAARIKQTAEGLHSMREMLDNMSWRYVMFYIRLKQAYLSQD  140

Query  496  FDKVISTAEANEKQPLTDLANRLFDNIEELEDAVKKRNLSLTESRYEGTL  645
                +ST     K+     AN L DN+ E +  V+   +  +   YE TL
Sbjct  141  LKNAMSTLPQARKEEYVKTANELVDNMAEFDYYVRTPKVYESYLYYEKTL  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060