BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020D05

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097  80.5    7e-20   Solanum lycopersicum
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159  75.5    2e-18   Solanum tuberosum [potatoes]
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993  76.3    3e-18   Nicotiana sylvestris
ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732  70.9    1e-16   Nicotiana tomentosiformis
ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393  55.1    1e-10   Sesamum indicum [beniseed]
ref|XP_002523543.1|  zinc finger protein, putative                    60.1    2e-09   Ricinus communis
gb|KDP38622.1|  hypothetical protein JCGZ_03975                       59.7    5e-09   Jatropha curcas
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...  61.2    1e-07   Cucumis melo [Oriental melon]
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...  61.2    1e-07   Cucumis melo [Oriental melon]
gb|KGN65218.1|  hypothetical protein Csa_1G266150                     57.0    3e-06   Cucumis sativus [cucumbers]
ref|XP_004162452.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.0    3e-06   
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215133  57.0    3e-06   Cucumis sativus [cucumbers]
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 56.2    5e-06   Citrus sinensis [apfelsine]
emb|CDP10517.1|  unnamed protein product                              56.2    6e-06   Coffea canephora [robusta coffee]
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg           56.2    6e-06   Citrus clementina [clementine]
gb|KCW82688.1|  hypothetical protein EUGRSUZ_C04065                   54.7    2e-05   Eucalyptus grandis [rose gum]
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1          53.9    3e-05   
ref|XP_006381900.1|  hypothetical protein POPTR_0006s20380g           53.9    3e-05   
ref|XP_011017950.1|  PREDICTED: uncharacterized protein LOC105121122  52.8    1e-04   Populus euphratica
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955  52.0    2e-04   Populus euphratica
ref|XP_010687767.1|  PREDICTED: uncharacterized protein LOC104901840  51.6    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003549703.1|  PREDICTED: uncharacterized protein LOC100781443  43.5    4e-04   Glycine max [soybeans]
gb|KJB64581.1|  hypothetical protein B456_010G054900                  50.4    5e-04   Gossypium raimondii



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score = 80.5 bits (197),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +1

Query  367  KQTRGNAIAYMYPS-DGVQDGLASES--SGEVKDVKSVGMHPIVLLGSKESKIVAYIDEG  537
            K++RG+ I Y+YPS D V   + S++  SG VKDVK    HPI+L+ +KE++I+A++DEG
Sbjct  81   KKSRGSEIRYVYPSADSV---IRSDAVCSGGVKDVKLDSEHPILLVDTKETQIIAFVDEG  137

Query  538  SNKEPQNMEHVYDYSTTCALGERPDVEHQEMECVYDYSTGFSV  666
             NKEPQN   +YD +T  +L    + +  E++   DYS GFS+
Sbjct  138  PNKEPQNQGCIYDCTTPLSLDVGQNKDSNEVDYAGDYSAGFSL  180


 Score = 44.3 bits (103),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  AYSGRALFVEGGILSEWQRFDSTPDR  257
            +YSGR LFVEGG+LS+W  F+S P R
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSR  46



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score = 75.5 bits (184),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = +1

Query  376  RGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEPQ  555
            RG+ I Y+YPS        +  SG VKD K    HPI+L+ +KE++IVA++DEG NKEPQ
Sbjct  85   RGSEIRYVYPSANSVVRSDAVCSGGVKDDKLDWEHPILLVDTKETQIVAFVDEGQNKEPQ  144

Query  556  NMEHVYDYSTTCALGERPDVEHQEMECVYDYSTGFSV  666
            N   +YD +T  +L    + +  E++   DYS GFS+
Sbjct  145  NQGCIYDCTTPLSLDVGQNKDSHEVDYAGDYSAGFSL  181


 Score = 44.3 bits (103),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  AYSGRALFVEGGILSEWQRFDSTPDR  257
            +YSGR LFVEGG+LS+W  F+S P R
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSR  46



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score = 76.3 bits (186),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = +1

Query  376  RGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEP  552
            RGN I Y+YPS D V D + SE    VKD K     PI+L+ +KE++IVA+IDEG NKEP
Sbjct  83   RGNEIRYIYPSADSVIDAVHSEG---VKDDKLDREQPILLVDTKETQIVAFIDEGPNKEP  139

Query  553  QNMEHVYDYSTTCALGERPDVEHQEMECVYDYSTGFSV  666
            QN   +YD +T  +L      + +E++   DYS GFS+
Sbjct  140  QNEGCIYDCTTPLSLDVGQIKDSREVDYAGDYSAGFSM  177


 Score = 42.7 bits (99),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  AYSGRALFVEGGILSEWQRFDSTPDR  257
            +YSGR LFVEGG+LS+W  ++S P R
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSR  46



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score = 70.9 bits (172),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = +1

Query  376  RGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEP  552
            RGN I Y+YPS D V    A  S+G V+D K     PI+L+ +KE++IVA+IDE  NKEP
Sbjct  83   RGNEIRYVYPSADSVSCSDAVRSAG-VEDNKLDLEQPILLVDTKETQIVAFIDEDPNKEP  141

Query  553  QNMEHVYDYSTTCALGERPDVEHQEMECVYDYSTGFSV  666
            QN    YD +T  +L    + + +E++   DYS GFS+
Sbjct  142  QNEGCTYDCTTPLSLDVEQNKDSREVDYAGDYSAGFSM  179


 Score = 42.7 bits (99),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  AYSGRALFVEGGILSEWQRFDSTPDR  257
            +YSGR LFVEGG+LS+W  ++S P R
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSR  46



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score = 55.1 bits (131),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +1

Query  370  QTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKE  549
            ++RGNAI Y+YP +      A    GE  +   V   P+VL+ S+++ +VAYIDE    E
Sbjct  81   KSRGNAICYLYPQEN-----APIDEGENCENNLVVSEPVVLVDSEKTPMVAYIDEEPCNE  135

Query  550  PQNMEHVYDYSTTCALGE  603
             +N+E++YDY+T+  L E
Sbjct  136  SRNVEYIYDYTTSLMLDE  153


 Score = 38.1 bits (87),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  192  RALFVEGGILSEWQRFDSTPDR  257
            RALFVEGG+LS+W  F S P R
Sbjct  22   RALFVEGGLLSDWSAFSSPPSR  43



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score = 60.1 bits (144),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  540
            +++ GNA  Y YP+  +QDGL +E S  G  +D       PIVL+ SKE++IVAY+D  +
Sbjct  93   RKSNGNAFGYSYPTVEIQDGLHNELSVKGNGRDYDLDVSQPIVLVDSKETQIVAYLDNTT  152

Query  541  NKEPQNMEHVYDYSTTCAL  597
              +P N++  YDY ++  L
Sbjct  153  PLKPNNVDCTYDYDSSFVL  171


 Score = 29.3 bits (64),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +3

Query  195  ALFVEGGILSEWQRFDSTP  251
            +LFVEGG+LS+W    S P
Sbjct  46   SLFVEGGVLSDWNLSSSCP  64



>gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score = 59.7 bits (143),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  540
            +++ GNA  Y YPS  +Q+ L  ESS  G  +D     + PI L+ SK+++IVAY+DE  
Sbjct  96   RKSNGNAFGYNYPSLELQERLLKESSIGGNDQDNDLDALQPITLVDSKDTQIVAYLDETP  155

Query  541  NKEPQNMEHVYDYSTTCALGE  603
            + +  N +  YDY+++  LG+
Sbjct  156  SLKASNADFTYDYNSSFVLGD  176


 Score = 28.1 bits (61),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +3

Query  198  LFVEGGILSEWQRFDSTP  251
            LFVEGG+LS+W    S P
Sbjct  50   LFVEGGVLSDWPLSSSCP  67



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEGS  540
            KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE  
Sbjct  85   KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDENP  144

Query  541  NKEPQNMEHVYDYSTTCALGE  603
                 N+E  YDY T+  LG+
Sbjct  145  QLMADNLEFTYDYGTSFVLGD  165



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEGS  540
            KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE  
Sbjct  85   KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDENP  144

Query  541  NKEPQNMEHVYDYSTTCALGE  603
                 N+E  YDY T+  LG+
Sbjct  145  QLMADNLEFTYDYGTSFVLGD  165



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  540
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  73   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  132

Query  541  NKEPQNMEHVYDYSTTCALGE  603
                 N+E  YDY T+  LGE
Sbjct  133  PLMADNLEFTYDYGTSFVLGE  153



>ref|XP_004162452.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226078 
[Cucumis sativus]
Length=802

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  540
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  93   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  152

Query  541  NKEPQNMEHVYDYSTTCALGE  603
                 N+E  YDY T+  LGE
Sbjct  153  PLMADNLEFTYDYGTSFVLGE  173



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 [Cucumis sativus]
Length=793

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  540
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  83   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  142

Query  541  NKEPQNMEHVYDYSTTCALGE  603
                 N+E  YDY T+  LGE
Sbjct  143  PLMADNLEFTYDYGTSFVLGE  163



>gb|KDO59352.1| hypothetical protein CISIN_1g043289mg [Citrus sinensis]
Length=695

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  546
            K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S+IVAY+D+  + 
Sbjct  87   KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDSRIVAYVDQTPDL  143

Query  547  EPQNMEHVYDYSTTCALGE  603
            +PQN+ +  DY ++  LG+
Sbjct  144  KPQNLIYSCDYDSSFVLGD  162



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +1

Query  370  QTRGNAIAYMYPSDGVQDGLASESSG-EVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  546
            +TRG+AI Y+YPS   Q+G  S ++G E ++ K     PIVL+ S+++ IVAYIDEG +K
Sbjct  95   KTRGHAIGYVYPSLDAQEG--SFANGYEERESKLKNSCPIVLVDSEDTPIVAYIDEGPSK  152

Query  547  EPQNMEHVYDYSTTCALGE  603
              Q  E+ YDY+    L E
Sbjct  153  HIQCSEYNYDYTMGFTLDE  171



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  546
            K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S+IVAY+D+  + 
Sbjct  87   KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDSRIVAYVDQTPDL  143

Query  547  EPQNMEHVYDYSTTCALGE  603
            +PQN+ +  DY ++  LG+
Sbjct  144  KPQNLIYSCDYDSSFVLGD  162



>gb|KCW82688.1| hypothetical protein EUGRSUZ_C04065 [Eucalyptus grandis]
Length=588

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 15/87 (17%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLA-----SESSGEVKDVKSVGMHPIVLLGSKESKIVAYID  531
            + +R NA+ Y YPS  +QDGL       +++GE K   S    P +L GSK+S+IVAY+D
Sbjct  111  RNSRSNAVGYRYPSRDLQDGLHPVSTFRDTNGENKMDFS---QPFILCGSKDSQIVAYVD  167

Query  532  EGSNKEPQNMEHV---YDYSTTCALGE  603
            EG    P +++     YDY +   LG+
Sbjct  168  EG----PSSVDQANISYDYHSDFVLGD  190



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQD--GLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  540
            +++ G+AI Y YPS  +QD      E +G+ K  +S   H +VL  SKE++IVAY+D+ +
Sbjct  84   RKSGGSAIRYEYPSLNLQDPESGVHECNGDKKMDES---HTVVLFDSKETQIVAYMDQTT  140

Query  541  NKEPQNMEHVYDYSTTCALGE  603
              +P ++++ Y+Y + C LG+
Sbjct  141  PPKPHHVKYTYEYDSDCVLGD  161



>ref|XP_006381900.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
 gb|ERP59697.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
Length=461

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 12/88 (14%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  546
            ++  GNA  Y YP   +Q+G + +      DV      PIVL+ SKE+ IVAY+DE    
Sbjct  94   RKASGNAFVYNYPCFDLQEGTSRD-----MDVS----QPIVLVDSKETHIVAYLDETPTL  144

Query  547  EPQNMEHVYDYSTTCALGERPDVEHQEM  630
            +P N+   Y+YS+   LGE     H+E+
Sbjct  145  KPCNLNLTYEYSSDFLLGESS---HREL  169



>ref|XP_011017950.1| PREDICTED: uncharacterized protein LOC105121122 [Populus euphratica]
Length=737

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 15/77 (19%)
 Frame = +1

Query  382  NAIAYMYPSDGVQDGLASESSGEVKDVKSVGM---HPIVLLGSKESKIVAYIDEGSNKEP  552
            NA  Y YPS  +Q+G+              GM    PIV++ SKE++IVAY+DE    +P
Sbjct  99   NAFGYSYPSSELQEGVGR------------GMDESQPIVVVHSKETEIVAYLDETPTSKP  146

Query  553  QNMEHVYDYSTTCALGE  603
             N+   Y+YS+   LGE
Sbjct  147  YNLNSTYNYSSDFLLGE  163



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 12/83 (14%)
 Frame = +1

Query  382  NAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEPQNM  561
            NA  Y YP   VQ+G + +      DV      PIVL+ SKE+ IVAY+DE    +P N+
Sbjct  140  NAFGYNYPCFDVQEGTSRD-----MDVS----QPIVLVDSKETHIVAYLDETQTLKPCNL  190

Query  562  EHVYDYSTTCALGERPDVEHQEM  630
               Y+YS+   LGE     H+E+
Sbjct  191  NLTYEYSSDFLLGESS---HREL  210



>ref|XP_010687767.1| PREDICTED: uncharacterized protein LOC104901840 [Beta vulgaris 
subsp. vulgaris]
Length=801

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  367  KQTRGNAIAYMYPSDGVQD-GLASESSGEVKDVKS-VGMHPIVLLGSKESKIVAYIDEGS  540
            +++  ++  Y YPS   +D G + + + E  D  S +G+ P++LLG K+SKIVA+ D   
Sbjct  66   RKSSADSFRYNYPSVDFKDVGQSEQWTRERNDDGSLIGLQPVILLGPKDSKIVAFEDSAP  125

Query  541  NKEPQNMEHVYDYSTTCALGE  603
            +  P  +E+ Y+Y++   LGE
Sbjct  126  SALPSKVEYCYEYNSDFVLGE  146



>ref|XP_003549703.1| PREDICTED: uncharacterized protein LOC100781443 [Glycine max]
 gb|KHN18591.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=767

 Score = 43.5 bits (101),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +1

Query  379  GNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEPQN  558
            G  I Y YPS  VQ+   +      +D     + P+VL  SK+ +I+A+ID+    +P N
Sbjct  88   GATIRYSYPSLDVQEVACAGIGNNGEDSNLNQLQPLVLADSKQGQIIAHIDQTPPSKPSN  147

Query  559  MEHVYDYSTTCALGE  603
            +++ Y Y     LG+
Sbjct  148  VKYAYTYDADFILGD  162


 Score = 26.9 bits (58),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  195  ALFVEGGILSEWQRFDSTPDRE  260
            ALFVEGG LS+W     T + E
Sbjct  37   ALFVEGGFLSDWHLPSPTQNPE  58



>gb|KJB64581.1| hypothetical protein B456_010G054900 [Gossypium raimondii]
Length=786

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = +1

Query  379  GNAIAYMYPSDGVQDG----LASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  546
            G+AI Y YPS  +QD     LA E      D K   +HPI+LL SKES+IVAY+D+ +  
Sbjct  97   GSAIRYEYPSLDLQDPESDILAHEG-----DNKKDELHPIILL-SKESQIVAYMDQTTPS  150

Query  547  EPQNMEHVYDYSTTCALGER  606
            +P  + + Y Y +   LG++
Sbjct  151  KPSLVNYTYGYGSDFVLGDK  170



Lambda      K        H        a         alpha
   0.316    0.136    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960