BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020C05

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011098450.1|  PREDICTED: anthranilate phosphoribosyltransf...    197   5e-57   Sesamum indicum [beniseed]
ref|XP_011098449.1|  PREDICTED: anthranilate phosphoribosyltransf...    197   6e-57   Sesamum indicum [beniseed]
emb|CDP02090.1|  unnamed protein product                                194   3e-55   Coffea canephora [robusta coffee]
ref|XP_009768650.1|  PREDICTED: anthranilate phosphoribosyltransf...    191   1e-54   Nicotiana sylvestris
ref|XP_009768649.1|  PREDICTED: anthranilate phosphoribosyltransf...    191   2e-54   Nicotiana sylvestris
gb|EYU44770.1|  hypothetical protein MIMGU_mgv1a007476mg                190   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_004252211.1|  PREDICTED: anthranilate phosphoribosyltransf...    188   2e-53   Solanum lycopersicum
ref|XP_004173893.1|  PREDICTED: anthranilate phosphoribosyltransf...    182   3e-53   
ref|XP_008374423.1|  PREDICTED: anthranilate phosphoribosyltransf...    186   2e-52   Malus domestica [apple tree]
ref|XP_010940167.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   4e-52   Elaeis guineensis
ref|XP_010940166.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   4e-52   Elaeis guineensis
ref|XP_010248535.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   6e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010660887.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   7e-52   Vitis vinifera
ref|XP_008812170.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   7e-52   Phoenix dactylifera
ref|XP_002273812.1|  PREDICTED: anthranilate phosphoribosyltransf...    184   8e-52   Vitis vinifera
ref|XP_007036259.1|  Tryptophan biosynthesis 1                          184   9e-52   
ref|XP_011464025.1|  PREDICTED: anthranilate phosphoribosyltransf...    183   1e-51   Fragaria vesca subsp. vesca
ref|XP_008438562.1|  PREDICTED: anthranilate phosphoribosyltransf...    183   2e-51   Cucumis melo [Oriental melon]
ref|XP_011001516.1|  PREDICTED: anthranilate phosphoribosyltransf...    183   3e-51   Populus euphratica
ref|XP_004298957.1|  PREDICTED: anthranilate phosphoribosyltransf...    182   3e-51   Fragaria vesca subsp. vesca
ref|XP_011001513.1|  PREDICTED: anthranilate phosphoribosyltransf...    183   3e-51   Populus euphratica
ref|XP_011001514.1|  PREDICTED: anthranilate phosphoribosyltransf...    182   3e-51   Populus euphratica
gb|KHG01059.1|  Anthranilate phosphoribosyltransferase, chloropla...    182   5e-51   Gossypium arboreum [tree cotton]
ref|XP_008813581.1|  PREDICTED: anthranilate phosphoribosyltransf...    181   7e-51   
ref|XP_008813580.1|  PREDICTED: anthranilate phosphoribosyltransf...    181   8e-51   Phoenix dactylifera
ref|XP_006364000.1|  PREDICTED: anthranilate phosphoribosyltransf...    181   8e-51   Solanum tuberosum [potatoes]
ref|XP_004152482.1|  PREDICTED: anthranilate phosphoribosyltransf...    181   9e-51   Cucumis sativus [cucumbers]
gb|KDP31079.1|  hypothetical protein JCGZ_11455                         181   1e-50   Jatropha curcas
gb|KCW83359.1|  hypothetical protein EUGRSUZ_B00293                     177   1e-50   Eucalyptus grandis [rose gum]
gb|KJB53200.1|  hypothetical protein B456_008G296400                    180   2e-50   Gossypium raimondii
gb|KJB53199.1|  hypothetical protein B456_008G296400                    180   3e-50   Gossypium raimondii
ref|XP_010549687.1|  PREDICTED: anthranilate phosphoribosyltransf...    180   3e-50   Tarenaya hassleriana [spider flower]
gb|KJB53197.1|  hypothetical protein B456_008G296400                    179   4e-50   Gossypium raimondii
ref|XP_002282228.1|  PREDICTED: anthranilate phosphoribosyltransf...    179   6e-50   Vitis vinifera
ref|XP_008351797.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    179   6e-50   
ref|XP_010248534.1|  PREDICTED: anthranilate phosphoribosyltransf...    179   9e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010248533.1|  PREDICTED: anthranilate phosphoribosyltransf...    179   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_007138060.1|  hypothetical protein PHAVU_009G177200g             177   2e-49   Phaseolus vulgaris [French bean]
ref|XP_009762501.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   4e-49   Nicotiana sylvestris
ref|XP_009762500.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   4e-49   Nicotiana sylvestris
ref|XP_010027548.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   4e-49   Eucalyptus grandis [rose gum]
ref|XP_010420535.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010420534.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   7e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010492792.1|  PREDICTED: anthranilate phosphoribosyltransf...    177   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010492791.1|  PREDICTED: anthranilate phosphoribosyltransf...    176   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002511378.1|  anthranilate phosphoribosyltransferase, puta...    175   2e-48   Ricinus communis
ref|XP_009383611.1|  PREDICTED: anthranilate phosphoribosyltransf...    175   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110365.1|  Anthranilate phosphoribosyltransferase             174   3e-48   
ref|NP_197300.1|  anthranilate phosphoribosyltransferase                176   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454020.1|  PREDICTED: anthranilate phosphoribosyltransf...    175   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010454019.1|  PREDICTED: anthranilate phosphoribosyltransf...    174   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009597052.1|  PREDICTED: anthranilate phosphoribosyltransf...    173   8e-48   
ref|XP_010678793.1|  PREDICTED: anthranilate phosphoribosyltransf...    173   8e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22141.1|  hypothetical protein MIMGU_mgv1a007249mg                172   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_009597049.1|  PREDICTED: anthranilate phosphoribosyltransf...    174   2e-47   Nicotiana tomentosiformis
ref|XP_009597051.1|  PREDICTED: anthranilate phosphoribosyltransf...    173   2e-47   
ref|XP_011071889.1|  PREDICTED: anthranilate phosphoribosyltransf...    172   2e-47   Sesamum indicum [beniseed]
ref|XP_006840664.1|  hypothetical protein AMTR_s00096p00025660          172   3e-47   Amborella trichopoda
gb|ADZ24712.1|  anthranilate phosphoribosyltransferase                  171   4e-47   Solanum pennellii
ref|XP_009787827.1|  PREDICTED: anthranilate phosphoribosyltransf...    171   5e-47   Nicotiana sylvestris
ref|XP_004241508.1|  PREDICTED: anthranilate phosphoribosyltransf...    171   8e-47   Solanum lycopersicum
ref|XP_009787826.1|  PREDICTED: anthranilate phosphoribosyltransf...    171   8e-47   Nicotiana sylvestris
ref|XP_004241509.1|  PREDICTED: anthranilate phosphoribosyltransf...    170   9e-47   
emb|CAN74291.1|  hypothetical protein VITISV_015980                     171   2e-45   Vitis vinifera
emb|CDP16914.1|  unnamed protein product                                167   2e-45   Coffea canephora [robusta coffee]
ref|XP_002318059.2|  hypothetical protein POPTR_0012s08440g             165   1e-44   
ref|XP_009776444.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    162   2e-44   Nicotiana sylvestris
ref|XP_004501916.1|  PREDICTED: anthranilate phosphoribosyltransf...    164   5e-44   Cicer arietinum [garbanzo]
ref|XP_004501915.1|  PREDICTED: anthranilate phosphoribosyltransf...    164   5e-44   Cicer arietinum [garbanzo]
ref|XP_006400341.1|  hypothetical protein EUTSA_v10013530mg             159   9e-43   
ref|XP_009121033.1|  PREDICTED: anthranilate phosphoribosyltransf...    159   3e-42   Brassica rapa
emb|CDY38473.1|  BnaA10g16850D                                          159   3e-42   Brassica napus [oilseed rape]
ref|XP_006400342.1|  hypothetical protein EUTSA_v10013530mg             159   4e-42   Eutrema salsugineum [saltwater cress]
emb|CDY25471.1|  BnaC09g39860D                                          158   6e-42   Brassica napus [oilseed rape]
ref|XP_002871793.1|  hypothetical protein ARALYDRAFT_909800             158   8e-42   Arabidopsis lyrata subsp. lyrata
gb|AAB02913.1|  phosphoribosylanthranilate transferase                  158   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AFW89746.1|  hypothetical protein ZEAMMB73_227948                    154   3e-41   
ref|XP_010251181.1|  PREDICTED: anthranilate phosphoribosyltransf...    155   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003558920.1|  PREDICTED: anthranilate phosphoribosyltransf...    154   8e-41   Brachypodium distachyon [annual false brome]
ref|XP_008658036.1|  PREDICTED: blue fluorescent1 isoform X1            154   9e-41   
dbj|BAJ87749.1|  predicted protein                                      154   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK26024.1|  hypothetical protein AALP_AA8G193700                    154   1e-40   Arabis alpina [alpine rockcress]
ref|XP_006287763.1|  hypothetical protein CARUB_v10000975mg             155   1e-40   Capsella rubella
ref|XP_008245012.1|  PREDICTED: anthranilate phosphoribosyltransf...    153   3e-40   Prunus mume [ume]
emb|CDX85428.1|  BnaA02g03850D                                          152   1e-39   
ref|XP_007211039.1|  hypothetical protein PRUPE_ppa019367mg             151   2e-39   
ref|XP_010421683.1|  PREDICTED: anthranilate phosphoribosyltransf...    151   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002986483.1|  hypothetical protein SELMODRAFT_425447             149   4e-39   
ref|XP_009126226.1|  PREDICTED: anthranilate phosphoribosyltransf...    150   4e-39   Brassica rapa
ref|XP_010421681.1|  PREDICTED: anthranilate phosphoribosyltransf...    150   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_004985893.1|  PREDICTED: anthranilate phosphoribosyltransf...    149   7e-39   Setaria italica
ref|XP_009362988.1|  PREDICTED: anthranilate phosphoribosyltransf...    149   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_003523084.1|  PREDICTED: anthranilate phosphoribosyltransf...    149   9e-39   Glycine max [soybeans]
ref|XP_006439848.1|  hypothetical protein CICLE_v10020016mg             149   1e-38   
ref|XP_006439846.1|  hypothetical protein CICLE_v10020016mg             150   1e-38   
ref|XP_006439847.1|  hypothetical protein CICLE_v10020016mg             149   2e-38   
ref|XP_006439849.1|  hypothetical protein CICLE_v10020016mg             149   2e-38   
ref|XP_002465954.1|  hypothetical protein SORBIDRAFT_01g048790          148   3e-38   
ref|XP_006476804.1|  PREDICTED: anthranilate phosphoribosyltransf...    147   6e-38   Citrus sinensis [apfelsine]
ref|XP_006650997.1|  PREDICTED: anthranilate phosphoribosyltransf...    145   6e-38   Oryza brachyantha
ref|XP_006347447.1|  PREDICTED: anthranilate phosphoribosyltransf...    143   2e-36   Solanum tuberosum [potatoes]
ref|XP_006347448.1|  PREDICTED: anthranilate phosphoribosyltransf...    142   2e-36   
gb|AFK40049.1|  unknown                                                 141   6e-36   Lotus japonicus
ref|NP_001048822.1|  Os03g0126000                                       139   4e-35   
gb|AAM19104.1|AC104427_2  Putative phosphoribosylanthranilate tra...    139   5e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KIZ06379.1|  anthranilate phosphoribosyltransferase                  135   6e-35   Monoraphidium neglectum
gb|EAY88350.1|  hypothetical protein OsI_09808                          139   9e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_002964901.1|  hypothetical protein SELMODRAFT_230552             137   2e-34   
ref|XP_002880727.1|  hypothetical protein ARALYDRAFT_901281             134   3e-34   
ref|XP_002878960.1|  hypothetical protein ARALYDRAFT_901396             134   1e-33   
ref|XP_002883816.1|  predicted protein                                  129   4e-33   
emb|CDY02664.1|  BnaC02g07710D                                          132   1e-32   
ref|XP_001702699.1|  anthranilate phosphoribosyltransferase             129   2e-31   Chlamydomonas reinhardtii
gb|KEH35038.1|  anthranilate phosphoribosyltransferase                  128   3e-31   Medicago truncatula
ref|XP_003601245.1|  Anthranilate phosphoribosyltransferase             128   3e-31   Medicago truncatula
ref|XP_001418201.1|  predicted protein                                  123   2e-29   Ostreococcus lucimarinus CCE9901
gb|ABF93754.1|  Anthranilate phosphoribosyltransferase, chloropla...    123   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAO72571.1|  putative phosphoribosylanthranilate transferase         122   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007513285.1|  anthranilate phosphoribosyltransferase             122   4e-29   Bathycoccus prasinos
emb|CEF98313.1|  Glycosyl transferase, family 3                         120   1e-28   Ostreococcus tauri
ref|XP_003079802.1|  phosphoribosylanthranilate transferase (ISS)       118   1e-27   
ref|WP_013943362.1|  anthranilate phosphoribosyltransferase             117   1e-27   
ref|XP_006374528.1|  hypothetical protein POPTR_0015s08990g             114   6e-27   
ref|XP_005844184.1|  hypothetical protein CHLNCDRAFT_27114              116   8e-27   Chlorella variabilis
ref|WP_013655737.1|  anthranilate phosphoribosyltransferase             115   8e-27   Cellulosilyticum lentocellum
ref|WP_036748969.1|  anthranilate phosphoribosyltransferase             115   1e-26   
ref|WP_032777935.1|  anthranilate phosphoribosyltransferase             114   4e-26   Streptomyces albus
ref|XP_011400011.1|  Anthranilate phosphoribosyltransferase, chlo...    112   7e-26   Auxenochlorella protothecoides
gb|KIZ06377.1|  anthranilate phosphoribosyltransferase                  108   8e-26   Monoraphidium neglectum
ref|XP_005650910.1|  anthranilate phosphoribosyltransferase             112   9e-26   Coccomyxa subellipsoidea C-169
ref|WP_011719802.1|  anthranilate phosphoribosyltransferase             112   2e-25   Acidothermus cellulolyticus
ref|WP_028963703.1|  anthranilate phosphoribosyltransferase             112   2e-25   
ref|WP_031108756.1|  anthranilate phosphoribosyltransferase             111   3e-25   
ref|XP_003059416.1|  predicted protein                                  108   3e-25   Micromonas pusilla CCMP1545
ref|WP_003985921.1|  MULTISPECIES: anthranilate phosphoribosyltra...    111   4e-25   Streptomycetaceae
ref|WP_030373243.1|  anthranilate phosphoribosyltransferase             111   4e-25   Streptomyces rimosus
gb|EWC61407.1|  Anthranilate phosphoribosyltransferase                  111   4e-25   Actinokineospora spheciospongiae
ref|WP_035283340.1|  anthranilate phosphoribosyltransferase             110   5e-25   Actinokineospora
ref|WP_009066288.1|  anthranilate phosphoribosyltransferase             110   5e-25   Clostridium sp. MSTE9
ref|WP_042429942.1|  anthranilate phosphoribosyltransferase             110   5e-25   Clostridium jeddahense
ref|WP_027719401.1|  anthranilate phosphoribosyltransferase             110   5e-25   Desulfovirgula thermocuniculi
ref|WP_034839598.1|  anthranilate phosphoribosyltransferase [           109   1e-24   [Clostridium] cellulosi
ref|WP_015037428.1|  anthranilate phosphoribosyltransferase             109   1e-24   Streptomyces venezuelae
ref|WP_022475329.1|  anthranilate phosphoribosyltransferase             111   1e-24   
ref|WP_033014651.1|  anthranilate phosphoribosyltransferase             109   2e-24   Streptomyces rimosus
ref|WP_030646800.1|  anthranilate phosphoribosyltransferase             109   2e-24   Streptomyces rimosus
ref|WP_031190379.1|  MULTISPECIES: anthranilate phosphoribosyltra...    109   2e-24   Streptomyces
ref|WP_040196665.1|  anthranilate phosphoribosyltransferase             108   2e-24   Candidatus Soleaferrea massiliensis
gb|AEG15418.1|  Anthranilate phosphoribosyltransferase                  108   2e-24   Desulfofundulus kuznetsovii DSM 6115
gb|KJB53198.1|  hypothetical protein B456_008G296400                    108   2e-24   Gossypium raimondii
ref|WP_041283323.1|  anthranilate phosphoribosyltransferase             108   3e-24   
ref|WP_022519460.1|  anthranilate phosphoribosyltransferase             108   3e-24   
dbj|GAN32571.1|  anthranilate phosphoribosyltransferase component II    108   3e-24   Candidatus Brocadia sinica JPN1
ref|WP_019853464.1|  hypothetical protein                               108   4e-24   Actinopolyspora mortivallis
ref|WP_020073612.1|  anthranilate phosphoribosyltransferase [           108   5e-24   [Clostridium] sporosphaeroides
ref|WP_043781546.1|  anthranilate phosphoribosyltransferase             107   6e-24   Amycolatopsis rifamycinica
ref|WP_013224077.1|  anthranilate phosphoribosyltransferase             107   6e-24   Amycolatopsis mediterranei
ref|WP_009884638.1|  anthranilate phosphoribosyltransferase             108   6e-24   Brevibacterium linens
ref|WP_043717589.1|  anthranilate phosphoribosyltransferase             107   6e-24   Kutzneria sp. 744
ref|WP_027300024.1|  anthranilate phosphoribosyltransferase             107   6e-24   Rhodospirillales bacterium URHD0088
ref|WP_016455499.1|  anthranilate phosphoribosyltransferase             107   6e-24   Propionimicrobium lymphophilum
gb|KHF45379.1|  anthranilate phosphoribosyltransferase                  107   6e-24   Saccharomonospora viridis
ref|WP_040161788.1|  anthranilate phosphoribosyltransferase             107   7e-24   Nigerium massiliense
ref|WP_028821925.1|  anthranilate phosphoribosyltransferase             107   8e-24   Propionimicrobium lymphophilum
ref|WP_024110454.1|  anthranilate phosphoribosyltransferase             107   8e-24   Propionimicrobium sp. BV2F7
ref|WP_027360272.1|  anthranilate phosphoribosyltransferase             107   8e-24   Desulforegula conservatrix
ref|WP_015561942.1|  anthranilate phosphoribosyltransferase             105   9e-24   
ref|WP_030665748.1|  anthranilate phosphoribosyltransferase             107   1e-23   Streptomyces rimosus
ref|WP_022228818.1|  anthranilate phosphoribosyltransferase             107   1e-23   
ref|WP_008514408.1|  anthranilate phosphoribosyltransferase             107   1e-23   Dethiobacter alkaliphilus
ref|WP_033263633.1|  anthranilate phosphoribosyltransferase             107   1e-23   Amycolatopsis vancoresmycina
ref|WP_032767739.1|  anthranilate phosphoribosyltransferase             106   1e-23   Streptomyces sp. CNS654
ref|WP_015099058.1|  Anthranilate phosphoribosyltransferase             106   2e-23   Saccharothrix espanaensis
ref|WP_022165345.1|  anthranilate phosphoribosyltransferase             106   2e-23   
ref|WP_016640529.1|  putative Anthranilate phosphoribosyltransferase    106   2e-23   Streptomyces aurantiacus
ref|WP_021683455.1|  anthranilate phosphoribosyltransferase             108   2e-23   Ruminococcus callidus
ref|WP_013625962.1|  anthranilate phosphoribosyltransferase             106   2e-23   Syntrophobotulus glycolicus
ref|WP_022260177.1|  anthranilate phosphoribosyltransferase             105   2e-23   
ref|WP_018999930.1|  anthranilate phosphoribosyltransferase             105   2e-23   Megamonas rupellensis
ref|WP_013559022.1|  anthranilate phosphoribosyltransferase             105   3e-23   Anaerolinea thermophila
ref|WP_040894403.1|  hypothetical protein [                             107   3e-23   
ref|WP_022362252.1|  anthranilate phosphoribosyltransferase             107   3e-23   
gb|EEC58469.1|  anthranilate phosphoribosyltransferase [                107   3e-23   [Bacteroides] pectinophilus ATCC 43243
ref|WP_012201841.1|  anthranilate phosphoribosyltransferase             105   3e-23   Lachnoclostridium phytofermentans
ref|WP_020565440.1|  anthranilate phosphoribosyltransferase             105   3e-23   Methylosarcina fibrata
ref|WP_033427463.1|  anthranilate phosphoribosyltransferase             105   4e-23   Saccharothrix syringae
ref|WP_030286126.1|  anthranilate phosphoribosyltransferase             105   4e-23   
ref|WP_020644669.1|  anthranilate phosphoribosyltransferase             105   5e-23   Amycolatopsis balhimycina
ref|WP_031506531.1|  anthranilate phosphoribosyltransferase             105   5e-23   Streptomyces megasporus
ref|WP_029089260.1|  anthranilate phosphoribosyltransferase             105   5e-23   
ref|WP_012174987.1|  anthranilate phosphoribosyltransferase             105   5e-23   Desulfococcus oleovorans
ref|WP_030360044.1|  MULTISPECIES: anthranilate phosphoribosyltra...    105   5e-23   Streptomyces
ref|XP_008367540.1|  PREDICTED: anthranilate phosphoribosyltransf...    105   5e-23   
ref|WP_030666446.1|  anthranilate phosphoribosyltransferase             105   5e-23   
ref|WP_027356811.1|  anthranilate phosphoribosyltransferase             105   6e-23   Desulfofundulus thermocisternus
ref|XP_005792526.1|  hypothetical protein EMIHUDRAFT_439707             104   6e-23   Emiliania huxleyi CCMP1516
ref|WP_011457991.1|  anthranilate phosphoribosyltransferase             104   6e-23   Chlamydia felis
ref|XP_005780664.1|  hypothetical protein EMIHUDRAFT_442980             104   7e-23   Emiliania huxleyi CCMP1516
ref|WP_022050731.1|  anthranilate phosphoribosyltransferase             106   7e-23   
ref|WP_022228324.1|  anthranilate phosphoribosyltransferase             104   7e-23   
ref|WP_013719039.1|  anthranilate phosphoribosyltransferase             104   7e-23   Methanothrix soehngenii
ref|WP_019266771.1|  anthranilate phosphoribosyltransferase             104   7e-23   Methanobrevibacter smithii
ref|WP_035320345.1|  anthranilate phosphoribosyltransferase             104   7e-23   
ref|WP_019265032.1|  anthranilate phosphoribosyltransferase             104   8e-23   Methanobrevibacter smithii
ref|WP_022410714.1|  anthranilate phosphoribosyltransferase             106   8e-23   
ref|XP_005715714.1|  unnamed protein product                            104   8e-23   Chondrus crispus [carageen]
emb|CBJ25579.1|  Anthranilate Phosphoribosyltransferase                 104   8e-23   Ectocarpus siliculosus
ref|XP_001774234.1|  predicted protein                                  104   9e-23   
ref|WP_030931968.1|  anthranilate phosphoribosyltransferase             104   9e-23   Streptomyces violaceoruber
gb|EKD92352.1|  anthranilate phosphoribosyltransferase                  104   9e-23   uncultured bacterium
ref|WP_010225602.1|  anthranilate phosphoribosyltransferase             104   9e-23   Pseudonocardia sp. P1
ref|WP_004032794.1|  MULTISPECIES: anthranilate phosphoribosyltra...    104   9e-23   Methanobrevibacter smithii
ref|WP_019262637.1|  anthranilate phosphoribosyltransferase             104   9e-23   Methanobrevibacter smithii
ref|WP_010836575.1|  anthranilate phosphoribosyltransferase             104   1e-22   Rhodococcus rhodnii
ref|XP_002182062.1|  predicted protein                                  104   1e-22   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_041278539.1|  anthranilate phosphoribosyltransferase             104   1e-22   Desulfotalea psychrophila
ref|WP_026418221.1|  anthranilate phosphoribosyltransferase             104   1e-22   Actinoalloteichus
ref|WP_018085158.1|  hypothetical protein                               104   1e-22   Desulfurispora thermophila
ref|WP_024335001.1|  anthranilate phosphoribosyltransferase             104   1e-22   Desulfotignum balticum
ref|WP_012648509.1|  anthranilate phosphoribosyltransferase             104   1e-22   Geobacter daltonii
sp|Q6AMS5.1|TRPD_DESPS  RecName: Full=Anthranilate phosphoribosyl...    104   1e-22   Desulfotalea psychrophila LSv54
ref|WP_011954313.1|  anthranilate phosphoribosyltransferase             103   1e-22   Methanobrevibacter
ref|WP_021131015.1|  anthranilate phosphoribosyltransferase             103   1e-22   Phaeospirillum fulvum
ref|WP_028464755.1|  anthranilate phosphoribosyltransferase             103   1e-22   Nisaea denitrificans
ref|WP_025774851.1|  anthranilate phosphoribosyltransferase             103   1e-22   Moorella thermoacetica
ref|WP_033295562.1|  anthranilate phosphoribosyltransferase             103   1e-22   Amycolatopsis jejuensis
ref|WP_008539281.1|  anthranilate phosphoribosyltransferase             103   1e-22   Megamonas funiformis
ref|WP_031389016.1|  anthranilate phosphoribosyltransferase             103   1e-22   Kineothrix alysoides
dbj|GAF27123.1|  anthranilate phosphoribosyltransferase                 103   1e-22   Moorella thermoacetica Y72
ref|WP_002725684.1|  anthranilate phosphoribosyltransferase             103   1e-22   Phaeospirillum molischianum
ref|WP_015756518.1|  anthranilate phosphoribosyltransferase             103   1e-22   Desulfofarcimen acetoxidans
ref|WP_020402899.1|  hypothetical protein                               103   2e-22   Gracilimonas tropica
ref|WP_014526830.1|  anthranilate phosphoribosyltransferase             103   2e-22   Sinorhizobium meliloti
ref|WP_015800212.1|  anthranilate phosphoribosyltransferase             103   2e-22   Actinosynnema mirum
ref|WP_038671742.1|  anthranilate phosphoribosyltransferase             103   2e-22   Pelosinus sp. UFO1
ref|WP_039743450.1|  anthranilate phosphoribosyltransferase             103   2e-22   Geobacter pickeringii
ref|WP_016279538.1|  anthranilate phosphoribosyltransferase             103   2e-22   Lachnospiraceae bacterium A4
ref|WP_027943290.1|  anthranilate phosphoribosyltransferase             103   2e-22   Amycolatopsis taiwanensis
ref|WP_031434338.1|  anthranilate phosphoribosyltransferase             103   2e-22   Methylomarinum vadi
ref|WP_030001914.1|  anthranilate phosphoribosyltransferase             103   2e-22   
ref|WP_015069961.1|  Anthranilate phosphoribosyltransferase             103   2e-22   
ref|WP_022427770.1|  anthranilate phosphoribosyltransferase             105   2e-22   
ref|WP_022462656.1|  anthranilate phosphoribosyltransferase             103   2e-22   
ref|WP_027148542.1|  anthranilate phosphoribosyltransferase             103   2e-22   Methylobacter tundripaludum
gb|KHS53558.1|  Anthranilate phosphoribosyltransferase                  103   2e-22   Brevibacterium linens
ref|WP_009375719.1|  anthranilate phosphoribosyltransferase             103   2e-22   Brevibacterium casei
ref|WP_007675360.1|  anthranilate phosphoribosyltransferase             103   2e-22   alpha proteobacterium BAL199
ref|WP_012955018.1|  anthranilate phosphoribosyltransferase             103   2e-22   Methanobrevibacter ruminantium
ref|WP_031437313.1|  anthranilate phosphoribosyltransferase             103   2e-22   Methylobacter tundripaludum
ref|WP_016696672.1|  hypothetical protein                               103   2e-22   Actinoalloteichus spitiensis
ref|WP_021797131.1|  anthranilate phosphoribosyltransferase             103   3e-22   Propionibacterium acidifaciens
ref|WP_038288736.1|  hypothetical protein                               103   3e-22   
ref|WP_040437332.1|  anthranilate phosphoribosyltransferase [           102   3e-22   
ref|WP_039207793.1|  anthranilate phosphoribosyltransferase             103   3e-22   
ref|WP_014957725.1|  anthranilate phosphoribosyltransferase             102   3e-22   Desulfobacula toluolica
ref|WP_033437224.1|  anthranilate phosphoribosyltransferase             102   3e-22   Saccharothrix sp. NRRL B-16314
ref|WP_030249465.1|  MULTISPECIES: anthranilate phosphoribosyltra...    102   3e-22   Streptomyces
ref|WP_031453087.1|  anthranilate phosphoribosyltransferase             102   3e-22   
gb|ABR47291.1|  anthranilate phosphoribosyltransferase                  102   3e-22   Alkaliphilus metalliredigens QYMF
ref|WP_041721410.1|  anthranilate phosphoribosyltransferase             102   3e-22   Alkaliphilus metalliredigens
ref|WP_006891265.1|  anthranilate phosphoribosyltransferase             102   3e-22   Methylobacter tundripaludum
gb|EEG31676.1|  anthranilate phosphoribosyltransferase [ [              102   3e-22   [Clostridium] methylpentosum DSM 5476
ref|WP_004001198.1|  putative Anthranilate phosphoribosyltransfer...    102   4e-22   Streptomyces viridochromogenes
ref|WP_041220356.1|  anthranilate phosphoribosyltransferase             102   4e-22   
gb|ADJ25809.1|  anthranilate phosphoribosyltransferase                  102   4e-22   Dehalogenimonas lykanthroporepellens BL-DC-9
ref|WP_020625130.1|  hypothetical protein                               102   4e-22   Pseudonocardia sp. P2
ref|WP_022365797.1|  anthranilate phosphoribosyltransferase             102   4e-22   
ref|WP_028985069.1|  anthranilate phosphoribosyltransferase             102   4e-22   
ref|WP_026623208.1|  anthranilate phosphoribosyltransferase             102   4e-22   Ensifer sp. WSM1721
gb|EMS65127.1|  Anthranilate phosphoribosyltransferase, chloropla...  99.0    4e-22   Triticum urartu
ref|WP_042211920.1|  anthranilate phosphoribosyltransferase             102   4e-22   Lysinimicrobium mangrovi
ref|WP_029488036.1|  anthranilate phosphoribosyltransferase             102   5e-22   Epulopiscium sp. 'N.t. morphotype B'
gb|EWM24949.1|  anthranilate phosphoribosyltransferase                  103   5e-22   Nannochloropsis gaditana
ref|WP_029963995.1|  anthranilate phosphoribosyltransferase             102   5e-22   Ensifer sp. USDA 6670
ref|WP_028011610.1|  anthranilate phosphoribosyltransferase             102   5e-22   Sinorhizobium/Ensifer group
ref|WP_018094982.1|  anthranilate phosphoribosyltransferase             102   5e-22   Sinorhizobium/Ensifer group
ref|WP_019566170.1|  anthranilate phosphoribosyltransferase             102   5e-22   Agrobacterium
ref|WP_033188550.1|  anthranilate phosphoribosyltransferase             102   5e-22   Rhodococcus
ref|WP_015051681.1|  bifunctional glutamine amidotransferase/anth...    104   5e-22   Thermacetogenium phaeum
ref|WP_006903683.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_015280120.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_015241202.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_027990703.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_004811853.1|  MULTISPECIES: anthranilate phosphoribosyltra...    102   5e-22   
ref|WP_003533254.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_013636264.1|  MULTISPECIES: anthranilate phosphoribosyltra...    102   5e-22   
ref|WP_015359669.1|  MULTISPECIES: anthranilate phosphoribosyltra...    102   5e-22   
ref|WP_030883738.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_012565344.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_039643617.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_019267965.1|  anthranilate phosphoribosyltransferase             102   5e-22   
ref|WP_003515560.1|  anthranilate phosphoribosyltransferase             102   6e-22   
ref|WP_035166652.1|  anthranilate phosphoribosyltransferase             102   6e-22   
ref|WP_007827414.1|  anthranilate phosphoribosyltransferase             102   6e-22   
ref|WP_011006520.1|  anthranilate phosphoribosyltransferase             102   6e-22   
ref|WP_010943017.1|  anthranilate phosphoribosyltransferase             102   6e-22   
gb|AJT41041.1|  anthranilate phosphoribosyltransferase                  102   6e-22   
ref|WP_036334862.1|  anthranilate phosphoribosyltransferase             102   6e-22   
gb|EMS54550.1|  Anthranilate phosphoribosyltransferase, chloropla...    102   6e-22   
ref|WP_044731014.1|  anthranilate phosphoribosyltransferase             102   7e-22   
ref|WP_034417131.1|  anthranilate phosphoribosyltransferase             102   7e-22   
ref|WP_027095221.1|  anthranilate phosphoribosyltransferase [           102   7e-22   
ref|WP_022516557.1|  anthranilate phosphoribosyltransferase             102   7e-22   
ref|WP_041305457.1|  anthranilate phosphoribosyltransferase             102   7e-22   
ref|WP_026077213.1|  anthranilate phosphoribosyltransferase             102   7e-22   
ref|WP_027630300.1|  anthranilate phosphoribosyltransferase [           102   7e-22   
gb|ADG06423.1|  anthranilate phosphoribosyltransferase                  102   7e-22   
sp|P30525.1|TRPD_BACCA  RecName: Full=Anthranilate phosphoribosyl...    100   7e-22   
ref|WP_011392853.1|  anthranilate phosphoribosyltransferase             101   7e-22   
ref|WP_010284190.1|  anthranilate phosphoribosyltransferase             101   7e-22   
ref|WP_029502776.1|  anthranilate phosphoribosyltransferase             101   7e-22   
ref|WP_013485217.1|  anthranilate phosphoribosyltransferase             101   7e-22   
ref|WP_036726294.1|  anthranilate phosphoribosyltransferase             101   8e-22   
ref|WP_016667278.1|  MULTISPECIES: anthranilate phosphoribosyltra...    101   8e-22   
ref|WP_021470540.1|  anthranilate phosphoribosyltransferase             101   8e-22   
ref|WP_004625897.1|  anthranilate phosphoribosyltransferase [           101   8e-22   
ref|WP_009153131.1|  anthranilate phosphoribosyltransferase             101   9e-22   
ref|WP_037109174.1|  anthranilate phosphoribosyltransferase             101   9e-22   
ref|WP_019665965.1|  MULTISPECIES: hypothetical protein                 101   9e-22   
ref|WP_007089453.1|  anthranilate phosphoribosyltransferase             101   9e-22   
ref|WP_042458684.1|  anthranilate phosphoribosyltransferase             101   9e-22   
ref|WP_040543552.1|  anthranilate phosphoribosyltransferase             101   9e-22   
ref|WP_033027455.1|  anthranilate phosphoribosyltransferase             100   9e-22   
ref|WP_018376042.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_015286830.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_038285830.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_003989679.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_021983099.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_037991272.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_021170287.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_028894656.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_021322186.1|  MULTISPECIES: anthranilate phosphoribosyltra...    101   1e-21   
ref|WP_011022929.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_003495698.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_011231688.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_003517204.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_016101538.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_022924777.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_036949835.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_020809137.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_030248504.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_042380343.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_003522745.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_011685113.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_028794602.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_034087883.1|  anthranilate phosphoribosyltransferase             101   1e-21   
ref|WP_029869568.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_002158847.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_027158637.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_018239708.1|  anthranilate phosphoribosyltransferase             100   1e-21   
ref|WP_012257622.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   1e-21   
ref|WP_019174967.1|  hypothetical protein                               100   2e-21   
ref|WP_026614169.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_020012720.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   2e-21   
ref|WP_022113269.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_026021379.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_006583002.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_016490498.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_031459590.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_035777812.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_028457545.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_016093052.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_015560742.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_003503036.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_006698866.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   2e-21   
emb|CCC56906.1|  Anthranilate phosphoribosyltransferase                 100   2e-21   
ref|WP_028631062.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_037384375.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_036253208.1|  anthranilate phosphoribosyltransferase             100   2e-21   
gb|KJF66629.1|  anthranilate phosphoribosyltransferase                  100   2e-21   
ref|WP_004442111.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   2e-21   
ref|WP_028929378.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_044823175.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_009340731.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_015785436.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_033708904.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   2e-21   
ref|XP_005853457.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_001099646.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_037421810.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_030742545.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_014764365.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_007516286.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_012708006.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_035930390.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|XP_005535316.1|  anthranilate phosphoribosyltransferase             101   2e-21   
ref|WP_029719569.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_042398859.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_012032786.1|  anthranilate phosphoribosyltransferase             100   2e-21   
ref|WP_031408695.1|  anthranilate phosphoribosyltransferase             100   2e-21   
emb|CBX28536.1|  Anthranilate phosphoribosyltransferase                 100   3e-21   
ref|WP_013144898.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   3e-21   
ref|WP_015375268.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_040958217.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_017833528.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_020755331.1|  Anthranilate phosphoribosyltransferase             100   3e-21   
emb|CAM75269.1|  phosphoribosyl anthranilate transferase                100   3e-21   
ref|WP_010048926.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_037669481.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_028000452.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_043936701.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   3e-21   
ref|WP_038169388.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_024079120.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_001091861.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_029535286.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_016368726.1|  anthranilate phosphoribosyltransferase           96.3    3e-21   
ref|WP_027364574.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_016108024.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_001099644.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_006520490.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_020491591.1|  anthranilate phosphoribosyltransferase             100   3e-21   
ref|WP_043574227.1|  anthranilate phosphoribosyltransferase             100   3e-21   
gb|EPJ38879.1|  putative Anthranilate phosphoribosyltransferase         100   3e-21   
ref|WP_010268387.1|  MULTISPECIES: anthranilate phosphoribosyltra...    100   3e-21   
gb|AHF09860.1|  anthranilate phosphoribosyltransferase                99.8    3e-21   
ref|WP_036296109.1|  anthranilate phosphoribosyltransferase           99.8    3e-21   
ref|WP_001089854.1|  anthranilate phosphoribosyltransferase           99.8    3e-21   
ref|WP_038491201.1|  anthranilate phosphoribosyltransferase           99.8    3e-21   
ref|WP_015042598.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.8    4e-21   
ref|WP_038510186.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_007001989.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_028402631.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_005164175.1|  Anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_034857416.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_020483916.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_002140867.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.8    4e-21   
ref|WP_002149759.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_004869818.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_017984059.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_015231789.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_034273057.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_002125997.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.8    4e-21   
ref|WP_002201345.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_027934788.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_002135020.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_038603201.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_014002071.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_016104197.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_044437821.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_001089855.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.8    4e-21   
gb|ADU51567.1|  anthranilate phosphoribosyltransferase                99.8    4e-21   
ref|WP_016336049.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_019225527.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_026789580.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_017377374.1|  hypothetical protein                             99.8    4e-21   
ref|WP_035223122.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_037309386.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_002086923.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_009028659.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_033221864.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_017622319.1|  hypothetical protein                             99.8    4e-21   
ref|WP_020062697.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_037810045.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_043831118.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_002166133.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
ref|WP_028702798.1|  anthranilate phosphoribosyltransferase           99.8    4e-21   
gb|EME61456.1|  anthranilate phosphoribosyltransferase                99.8    4e-21   
ref|WP_015941488.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_024344220.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_033025741.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_025948484.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_013821018.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_007936299.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.4    5e-21   
ref|WP_039922100.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_016094536.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_027139302.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_002715677.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_020878623.1|  Anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_030758115.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_042409775.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_001978327.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_014079471.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_015748444.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_033706545.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_001067368.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_043248899.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_029437874.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_003573043.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_021141839.1|  MULTISPECIES: Anthranilate phosphoribosyltra...  99.4    5e-21   
ref|WP_001067371.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_001067360.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_036278850.1|  anthranilate phosphoribosyltransferase           99.4    5e-21   
ref|WP_006314426.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_016109557.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001067370.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.4    6e-21   
ref|WP_016122111.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001067364.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_010937160.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_014375906.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_010971800.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.4    6e-21   
ref|WP_038543037.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_016716897.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_016082433.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001067365.1|  MULTISPECIES: anthranilate phosphoribosyltra...  99.4    6e-21   
ref|WP_015864277.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001067362.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_042501798.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_016513132.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001067357.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_001089856.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   
ref|WP_016097959.1|  anthranilate phosphoribosyltransferase           99.4    6e-21   



>ref|XP_011098450.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=402

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 149/196 (76%), Gaps = 9/196 (5%)
 Frame = +1

Query  121  MAMLGCAATVSSFSR------THLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLR  282
            MA++  +A +SS S       ++ S   K SF +P    S++  +  S  +    R  L 
Sbjct  1    MAVIWKSAVLSSPSPLIFNNCSYSSEFHKSSFFKP---NSSNSFLRRSFLQPDFHRPPLH  57

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGL  462
            LPI S KELIE LL ++DL+EEEAE SLDFLLS GS+ALISAFLVLLRAKGET+EEIVGL
Sbjct  58   LPISSPKELIECLLKKEDLTEEEAEGSLDFLLSEGSQALISAFLVLLRAKGETYEEIVGL  117

Query  463  ARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSAC  642
            ARAM K    VEGL+NAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSAC
Sbjct  118  ARAMIKCCKKVEGLENAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSAC  177

Query  643  GSADVLEALGVTIELK  690
            GSADVLEALGV I L+
Sbjct  178  GSADVLEALGVAIGLE  193



>ref|XP_011098449.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=403

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 149/196 (76%), Gaps = 9/196 (5%)
 Frame = +1

Query  121  MAMLGCAATVSSFSR------THLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLR  282
            MA++  +A +SS S       ++ S   K SF +P    S++  +  S  +    R  L 
Sbjct  1    MAVIWKSAVLSSPSPLIFNNCSYSSEFHKSSFFKP---NSSNSFLRRSFLQPDFHRPPLH  57

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGL  462
            LPI S KELIE LL ++DL+EEEAE SLDFLLS GS+ALISAFLVLLRAKGET+EEIVGL
Sbjct  58   LPISSPKELIECLLKKEDLTEEEAEGSLDFLLSEGSQALISAFLVLLRAKGETYEEIVGL  117

Query  463  ARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSAC  642
            ARAM K    VEGL+NAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSAC
Sbjct  118  ARAMIKCCKKVEGLENAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSAC  177

Query  643  GSADVLEALGVTIELK  690
            GSADVLEALGV I L+
Sbjct  178  GSADVLEALGVAIGLE  193



>emb|CDP02090.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 139/177 (79%), Gaps = 6/177 (3%)
 Frame = +1

Query  175  SSLRKPSFTRP----IALVSTSRTIVSSESEDRCSRSQLRL--PIPSSKELIERLLNRQD  336
            S +RK SF  P    I     S ++  S     CS S L L  PI SSKELIERLL R+D
Sbjct  23   SGIRKFSFHPPKGARILFPRKSNSVRFSLHLPCCSGSPLELQRPISSSKELIERLLARKD  82

Query  337  LSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAV  516
            L+EEEAEASL+ LL+NGS+ALISAFLVLLRAKGETFEEI G ARAM K    VE L+N+V
Sbjct  83   LTEEEAEASLNLLLNNGSDALISAFLVLLRAKGETFEEIAGFARAMIKCCKKVESLENSV  142

Query  517  DIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            DIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  143  DIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGSADVLEALGVAIDL  199



>ref|XP_009768650.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=409

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I SSKELIE LLNR+DL+E EAEASLDF L +GSEALISAFLVLLRAKGETF+E+VGLAR
Sbjct  57   ISSSKELIECLLNRKDLNEAEAEASLDFFLKDGSEALISAFLVLLRAKGETFQEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            +M K    VEGL++AVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  SMIKCCRKVEGLNDAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIELK  690
            ADVLEALGVTIELK
Sbjct  177  ADVLEALGVTIELK  190



>ref|XP_009768649.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I SSKELIE LLNR+DL+E EAEASLDF L +GSEALISAFLVLLRAKGETF+E+VGLAR
Sbjct  57   ISSSKELIECLLNRKDLNEAEAEASLDFFLKDGSEALISAFLVLLRAKGETFQEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            +M K    VEGL++AVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  SMIKCCRKVEGLNDAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIELK  690
            ADVLEALGVTIELK
Sbjct  177  ADVLEALGVTIELK  190



>gb|EYU44770.1| hypothetical protein MIMGU_mgv1a007476mg [Erythranthe guttata]
Length=406

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = +1

Query  256  DRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKG  435
            D C R  L LPI S  EL+E LLN++DLSEEEAE SLDFLLS+ S++LISA+LVLLRAKG
Sbjct  51   DSC-RPPLHLPIFSPMELMECLLNKEDLSEEEAEGSLDFLLSDCSQSLISAYLVLLRAKG  109

Query  436  ETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQ  615
            ETFEEIVGLAR M K    VEGL+NAVDIVGTGGDGANTVNISTGAAILAAACGA+VAKQ
Sbjct  110  ETFEEIVGLARGMIKCCKKVEGLENAVDIVGTGGDGANTVNISTGAAILAAACGARVAKQ  169

Query  616  GNRSSSSACGSADVLEALGVTIELK  690
            GNRSSSSACGSADVLEALGV I+++
Sbjct  170  GNRSSSSACGSADVLEALGVAIDVE  194



>ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Solanum lycopersicum]
Length=386

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  265  SRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETF  444
            S+S L LPI SS++L+ERLL ++DL+E EAEASLDF+L +GSEALISAFLVLLRAKGETF
Sbjct  39   SQSSLHLPILSSQQLMERLLKKEDLNEAEAEASLDFMLKDGSEALISAFLVLLRAKGETF  98

Query  445  EEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNR  624
             E+VGLAR+M K    VEGL+++VDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGN 
Sbjct  99   REVVGLARSMIKCCRKVEGLNDSVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNT  158

Query  625  SSSSACGSADVLEALGVTIEL  687
            SSSSACGSADVLEALGV IEL
Sbjct  159  SSSSACGSADVLEALGVAIEL  179



>ref|XP_004173893.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like, 
partial [Cucumis sativus]
Length=212

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = +1

Query  217  VSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEA  396
            +S SRT+V+ +       +    P+ S   LIE L+NR DLSE+EAEASL +LL++ SEA
Sbjct  54   ISPSRTVVAVDVSS-AGVANASGPVTSFSNLIESLINRVDLSEDEAEASLQYLLNDASEA  112

Query  397  LISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaa  576
             ISAFLVLLRAKGET+EEIVGLARAM K  + V+GL +AVDIVGTGGDGANTVNISTGA+
Sbjct  113  AISAFLVLLRAKGETYEEIVGLARAMIKHSVKVDGLFDAVDIVGTGGDGANTVNISTGAS  172

Query  577  ilaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ILAAACG KVAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  173  ILAAACGTKVAKQGNRSSSSACGSADVLEALGVVIDL  209



>ref|XP_008374423.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Malus domestica]
Length=405

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  262  CSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGET  441
            C  S  +  I S  ELIE L++R DL+EEEAEASL+FLL++ +EALISAFLVLLRAKGET
Sbjct  54   CESSNSKPQIASFSELIESLISRVDLTEEEAEASLEFLLADANEALISAFLVLLRAKGET  113

Query  442  FEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGN  621
            + EIVGLA+AM K  L +EGLDNAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGN
Sbjct  114  YGEIVGLAKAMLKHSLKIEGLDNAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGN  173

Query  622  RSSSSACGSADVLEALGVTIEL  687
            RSSSSACGSADVLEALG+ I+L
Sbjct  174  RSSSSACGSADVLEALGIIIDL  195



>ref|XP_010940167.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=398

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 144/200 (72%), Gaps = 18/200 (9%)
 Frame = +1

Query  121  MAMLGCAATVSSFSRTHLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSR---SQLRLPI  291
            MA+ GC   +SS        + +P   +P     T R ++   +  R  R   + L   +
Sbjct  1    MALYGCLPRLSS------PYVGRP-LQQPRCHFPTFRPVLLPLAGGRARRRSITSLVPAL  53

Query  292  PSS--------KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFE  447
            P+S        KE+IE L++R DLSEEEAEASLD LL  G+EALISAFLVLLRAKGETFE
Sbjct  54   PTSVGPAQLTFKEVIELLIDRVDLSEEEAEASLDLLLVEGNEALISAFLVLLRAKGETFE  113

Query  448  EIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRS  627
            EIVGLARAM K  + VEGLD+AVD+VGTGGDGANTVNISTGA+ILAAA GA+VAKQGNR+
Sbjct  114  EIVGLARAMIKCSVRVEGLDDAVDVVGTGGDGANTVNISTGASILAAAAGARVAKQGNRA  173

Query  628  SSSACGSADVLEALGVTIEL  687
            SSSACGSADVLEALGV IEL
Sbjct  174  SSSACGSADVLEALGVKIEL  193



>ref|XP_010940166.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=398

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 144/200 (72%), Gaps = 18/200 (9%)
 Frame = +1

Query  121  MAMLGCAATVSSFSRTHLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSR---SQLRLPI  291
            MA+ GC   +SS        + +P   +P     T R ++   +  R  R   + L   +
Sbjct  1    MALYGCLPRLSS------PYVGRP-LQQPRCHFPTFRPVLLPLAGGRARRRSITSLVPAL  53

Query  292  PSS--------KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFE  447
            P+S        KE+IE L++R DLSEEEAEASLD LL  G+EALISAFLVLLRAKGETFE
Sbjct  54   PTSVGPAQLTFKEVIELLIDRVDLSEEEAEASLDLLLVEGNEALISAFLVLLRAKGETFE  113

Query  448  EIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRS  627
            EIVGLARAM K  + VEGLD+AVD+VGTGGDGANTVNISTGA+ILAAA GA+VAKQGNR+
Sbjct  114  EIVGLARAMIKCSVRVEGLDDAVDVVGTGGDGANTVNISTGASILAAAAGARVAKQGNRA  173

Query  628  SSSACGSADVLEALGVTIEL  687
            SSSACGSADVLEALGV IEL
Sbjct  174  SSSACGSADVLEALGVKIEL  193



>ref|XP_010248535.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=409

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA  465
            PI S K+LIE L+NRQDLSE EAEASLDFLL   + ALISAFLVLLRAKGETFEEIVGLA
Sbjct  63   PIQSFKQLIESLINRQDLSEVEAEASLDFLLKEANGALISAFLVLLRAKGETFEEIVGLA  122

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            RAM K  + VE + +AVDIVGTGGDGANTVNISTGA+ILAAA GA VAKQGNRSSSSACG
Sbjct  123  RAMLKYSVKVEEVGDAVDIVGTGGDGANTVNISTGASILAAASGANVAKQGNRSSSSACG  182

Query  646  SADVLEALGVTIEL  687
            SADVLEALGV I+L
Sbjct  183  SADVLEALGVVIDL  196



>ref|XP_010660887.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Vitis vinifera]
Length=406

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 147/193 (76%), Gaps = 4/193 (2%)
 Frame = +1

Query  121  MAMLGCAATVSSFSRTHLSSLRKPSFTRP----IALVSTSRTIVSSESEDRCSRSQLRLP  288
            MA+    A++S  S    +SL  P    P    +A +   R   S  +    SR+ L LP
Sbjct  1    MAVFAYTASISRPSPFLNNSLYFPPIQIPFFASLAPLPNRRNSKSIHTVLPSSRAPLDLP  60

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I SS++L+E LLNR+D SEEEAE SL+FLL++GSEALISAFLVLLRAKGETFEE+VGLAR
Sbjct  61   ITSSRQLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFLVLLRAKGETFEEVVGLAR  120

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEG+ +AVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS
Sbjct  121  AMIKCCSKVEGVYDAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS  180

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  181  ADVLEALGVIIDL  193



>ref|XP_008812170.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Phoenix dactylifera]
Length=402

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 14/200 (7%)
 Frame = +1

Query  121  MAMLGCAATVSSFSRTHLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIP--  294
            MA+ GC   +S         L++  + +P  L ST  T V   +  R  R  +   +P  
Sbjct  1    MALYGCLGRLSPPYEGR--PLQQQPYHKPRGLFSTY-TPVLRRAGGRAGRPSITSLVPAL  57

Query  295  ---------SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFE  447
                     S KE+IE L++R DLSE+EAEASLD LL+  +EALISAFLVLLRAKGETFE
Sbjct  58   PTSLGPAQVSFKEVIELLIDRVDLSEDEAEASLDLLLAEANEALISAFLVLLRAKGETFE  117

Query  448  EIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRS  627
            EIVGLARAM K G+ VEGLD+AVD+VGTGGDGANTVNISTGA+ILAAA GA VAKQGNR+
Sbjct  118  EIVGLARAMIKCGVRVEGLDDAVDVVGTGGDGANTVNISTGASILAAAAGASVAKQGNRA  177

Query  628  SSSACGSADVLEALGVTIEL  687
            SSSACGSADVL+ALGV I+L
Sbjct  178  SSSACGSADVLQALGVKIDL  197



>ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI34893.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 147/193 (76%), Gaps = 4/193 (2%)
 Frame = +1

Query  121  MAMLGCAATVSSFSRTHLSSLRKPSFTRP----IALVSTSRTIVSSESEDRCSRSQLRLP  288
            MA+    A++S  S    +SL  P    P    +A +   R   S  +    SR+ L LP
Sbjct  1    MAVFAYTASISRPSPFLNNSLYFPPIQIPFFASLAPLPNRRNSKSIHTVLPSSRAPLDLP  60

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I SS++L+E LLNR+D SEEEAE SL+FLL++GSEALISAFLVLLRAKGETFEE+VGLAR
Sbjct  61   ITSSRQLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFLVLLRAKGETFEEVVGLAR  120

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEG+ +AVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS
Sbjct  121  AMIKCCSKVEGVYDAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNRSSSSACGS  180

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  181  ADVLEALGVIIDL  193



>ref|XP_007036259.1| Tryptophan biosynthesis 1 [Theobroma cacao]
 gb|EOY20760.1| Tryptophan biosynthesis 1 [Theobroma cacao]
Length=424

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +1

Query  181  LRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEA  360
            L + S+ R + +VS   +  +S S     R +    I S  ELIE L+NR DL+E EAEA
Sbjct  39   LDRCSYQRIVKVVSDPASGSASVSALSSEREKPSSSIGSINELIESLINRVDLTESEAEA  98

Query  361  SLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGD  540
            SLDFLL+  +EALISAFLVLLRAKGETFEE+VGLARAM K    +EGL++ VDIVGTGGD
Sbjct  99   SLDFLLAEANEALISAFLVLLRAKGETFEEVVGLARAMIKHAWKLEGLNDVVDIVGTGGD  158

Query  541  GANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  159  GANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVLEALGVVIDL  207



>ref|XP_011464025.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Fragaria vesca subsp. vesca]
Length=394

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  280  RLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVG  459
            + P  S  ELIE L++++DLSE E+EA+++FLLS+ +EALISAFLVLLRAKGET+EEIVG
Sbjct  59   KPPFSSFNELIESLIDKKDLSESESEAAMEFLLSDTNEALISAFLVLLRAKGETYEEIVG  118

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            LA+AM K  L +EGLD+AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSA
Sbjct  119  LAKAMMKHSLPIEGLDDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSA  178

Query  640  CGSADVLEALGVTIEL  687
            CGSADVLEAL + IEL
Sbjct  179  CGSADVLEALDIVIEL  194



>ref|XP_008438562.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Cucumis melo]
Length=412

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  202  RPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLS  381
             P+A +S SRT+ + +       +    P+ S   LIE L+NR DLSE+EAEASL +LL 
Sbjct  49   HPLASISPSRTVAAVDVSS-AGVANASGPVTSFSNLIESLINRVDLSEDEAEASLQYLLD  107

Query  382  NGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNI  561
            + SEA ISAFLVLLRAKGET+EEIVGLARAM K  + V+GL +AVDIVGTGGDGANTVNI
Sbjct  108  DASEAAISAFLVLLRAKGETYEEIVGLARAMIKHSVKVDGLFDAVDIVGTGGDGANTVNI  167

Query  562  STGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            STGA+ILAAACG KVAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  168  STGASILAAACGTKVAKQGNRSSSSACGSADVLEALGVVIDL  209



>ref|XP_011001516.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=418

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            +P+  ELIE L+N+ DLSE EAEASLD+LL + SEALISAFLVLLRAKGETFEE+VGLAR
Sbjct  75   VPAFNELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLRAKGETFEEVVGLAR  134

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  135  AMFKHARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  194

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV I+L
Sbjct  195  ADVLEELGVVIDL  207



>ref|XP_004298957.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Fragaria vesca subsp. vesca]
Length=404

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  280  RLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVG  459
            + P  S  ELIE L++++DLSE E+EA+++FLLS+ +EALISAFLVLLRAKGET+EEIVG
Sbjct  59   KPPFSSFNELIESLIDKKDLSESESEAAMEFLLSDTNEALISAFLVLLRAKGETYEEIVG  118

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            LA+AM K  L +EGLD+AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSA
Sbjct  119  LAKAMMKHSLPIEGLDDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSA  178

Query  640  CGSADVLEALGVTIEL  687
            CGSADVLEAL + IEL
Sbjct  179  CGSADVLEALDIVIEL  194



>ref|XP_011001513.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=421

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            +P+  ELIE L+N+ DLSE EAEASLD+LL + SEALISAFLVLLRAKGETFEE+VGLAR
Sbjct  80   VPAFNELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLRAKGETFEEVVGLAR  139

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  140  AMFKHARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  199

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV I+L
Sbjct  200  ADVLEELGVVIDL  212



>ref|XP_011001514.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=423

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            +P+  ELIE L+N+ DLSE EAEASLD+LL + SEALISAFLVLLRAKGETFEE+VGLAR
Sbjct  80   VPAFNELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLRAKGETFEEVVGLAR  139

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  140  AMFKHARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  199

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV I+L
Sbjct  200  ADVLEELGVVIDL  212



>gb|KHG01059.1| Anthranilate phosphoribosyltransferase, chloroplastic -like protein 
[Gossypium arboreum]
Length=410

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S KELIE L+NR DL+E EAEASL+FLL+  +EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  68   VGSIKELIECLINRVDLTESEAEASLEFLLTEANEALISAFLVLLRAKGETFEEVVGLAR  127

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  128  AMLKHAWKVEGLNDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  187

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ ++L
Sbjct  188  ADVLEALGINLDL  200



>ref|XP_008813581.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=381

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = +1

Query  217  VSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEA  396
            V   R  ++S++ D  +   LR   PS KELIE L++R DLSEE+AEASLD LL   +EA
Sbjct  45   VRARRPSITSQAPDLAT--SLR---PSFKELIELLIDRVDLSEEQAEASLDLLLVEANEA  99

Query  397  LISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaa  576
            LISAFLVLLRAKGETFEEIVGLARAM K G+ VE LD+AVDIVGTGGDGANTVNISTGAA
Sbjct  100  LISAFLVLLRAKGETFEEIVGLARAMIKCGVKVEALDDAVDIVGTGGDGANTVNISTGAA  159

Query  577  ilaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ILAAA GA+VAKQGNR+SSSACGSADVLEALGV I+L
Sbjct  160  ILAAAAGARVAKQGNRASSSACGSADVLEALGVNIDL  196



>ref|XP_008813580.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=401

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = +1

Query  217  VSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEA  396
            V   R  ++S++ D  +   LR   PS KELIE L++R DLSEE+AEASLD LL   +EA
Sbjct  45   VRARRPSITSQAPDLAT--SLR---PSFKELIELLIDRVDLSEEQAEASLDLLLVEANEA  99

Query  397  LISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaa  576
            LISAFLVLLRAKGETFEEIVGLARAM K G+ VE LD+AVDIVGTGGDGANTVNISTGAA
Sbjct  100  LISAFLVLLRAKGETFEEIVGLARAMIKCGVKVEALDDAVDIVGTGGDGANTVNISTGAA  159

Query  577  ilaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ILAAA GA+VAKQGNR+SSSACGSADVLEALGV I+L
Sbjct  160  ILAAAAGARVAKQGNRASSSACGSADVLEALGVNIDL  196



>ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Solanum tuberosum]
Length=384

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  265  SRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETF  444
            S S L LP  SS++L+ERLLN++DL+E EAEASLDFLL +GSEALISAFLVLLRAKGETF
Sbjct  37   SPSSLHLPNLSSQQLMERLLNKEDLNEAEAEASLDFLLKDGSEALISAFLVLLRAKGETF  96

Query  445  EEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNR  624
             E+VGLAR+M K    VEGL++ VDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNR
Sbjct  97   REVVGLARSMIKCCRKVEGLNDCVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGNR  156

Query  625  SSSSACGSADVLEALGVTIEL  687
            SSSS+CGSADVLEALGV IEL
Sbjct  157  SSSSSCGSADVLEALGVAIEL  177



>ref|XP_004152482.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64320.1| hypothetical protein Csa_1G046170 [Cucumis sativus]
Length=412

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = +1

Query  217  VSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEA  396
            +S SRT+V+ +       +    P+ S   LIE L+NR DLSE+EAEASL +LL++ SEA
Sbjct  54   ISPSRTVVAVDVSS-AGVANASGPVTSFSNLIESLINRVDLSEDEAEASLQYLLNDASEA  112

Query  397  LISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaa  576
             ISAFLVLLRAKGET+EEIVGLARAM K  + V+GL +AVDIVGTGGDGANTVNISTGA+
Sbjct  113  AISAFLVLLRAKGETYEEIVGLARAMIKHSVKVDGLFDAVDIVGTGGDGANTVNISTGAS  172

Query  577  ilaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ILAAACG KVAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  173  ILAAACGTKVAKQGNRSSSSACGSADVLEALGVVIDL  209



>gb|KDP31079.1| hypothetical protein JCGZ_11455 [Jatropha curcas]
Length=417

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  220  STSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL  399
            S+SR   +  +   C R +   P  +  ELIE L++R DL+E EAE SL +LL++G+EAL
Sbjct  50   SSSRKSTTFVTALSCVREKSSTPTTAFNELIESLISRVDLTESEAETSLYYLLNDGNEAL  109

Query  400  ISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaai  579
            ISAFLVLLRAKGETFEEIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+I
Sbjct  110  ISAFLVLLRAKGETFEEIVGLARAMIKHARTVEGLVDAVDIVGTGGDGANTVNISTGASI  169

Query  580  laaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            LAAACG KVAKQGNRSSSSACGSADVLEALG+ I+L
Sbjct  170  LAAACGTKVAKQGNRSSSSACGSADVLEALGIIIDL  205



>gb|KCW83359.1| hypothetical protein EUGRSUZ_B00293 [Eucalyptus grandis]
Length=287

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  ELIE L++R+DLSE +AEASLDFLL + +EALISAFLVLLRAKGETFEE+VGLARAM
Sbjct  66   SFNELIESLISREDLSEADAEASLDFLLDDTNEALISAFLVLLRAKGETFEEVVGLARAM  125

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             K    VEGL + VDIVGTGGDGANTVNISTGA+IL AACGA+VAKQGNRSSSSACGSAD
Sbjct  126  IKHAKKVEGLVDVVDIVGTGGDGANTVNISTGASILTAACGARVAKQGNRSSSSACGSAD  185

Query  655  VLEALGVTIELK  690
            VLEALGV I+L+
Sbjct  186  VLEALGVAIDLE  197



>gb|KJB53200.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=385

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  ELIE L+NR DL+E EAEASL+FLL+  +EALISAFLVLLRAKGETFEE+VGLARAM
Sbjct  70   SINELIECLINRVDLTESEAEASLEFLLTEANEALISAFLVLLRAKGETFEEVVGLARAM  129

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             K    VEGL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSAD
Sbjct  130  LKHAWKVEGLNDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSAD  189

Query  655  VLEALGVTIEL  687
            VLEALG+ ++L
Sbjct  190  VLEALGIILDL  200



>gb|KJB53199.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=408

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S  ELIE L+NR DL+E EAEASL+FLL+  +EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  68   VGSINELIECLINRVDLTESEAEASLEFLLTEANEALISAFLVLLRAKGETFEEVVGLAR  127

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  128  AMLKHAWKVEGLNDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  187

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ ++L
Sbjct  188  ADVLEALGIILDL  200



>ref|XP_010549687.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Tarenaya hassleriana]
Length=427

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAEASL+FLL++ +EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  88   IKSFNQLIESLIDRVDLSESEAEASLEFLLNDANEALISAFLVLLRAKGETFEEVVGLAR  147

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K  + VEGLD+ VDIVGTGGDGA+TVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  148  AMFKHAIKVEGLDDVVDIVGTGGDGADTVNISTGASILAAACGAKVAKQGNRSSSSACGS  207

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  208  ADVLEALGVVIDL  220



>gb|KJB53197.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=410

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S  ELIE L+NR DL+E EAEASL+FLL+  +EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  68   VGSINELIECLINRVDLTESEAEASLEFLLTEANEALISAFLVLLRAKGETFEEVVGLAR  127

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  128  AMLKHAWKVEGLNDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  187

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ ++L
Sbjct  188  ADVLEALGIILDL  200



>ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Vitis vinifera]
 emb|CBI15006.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 121/151 (80%), Gaps = 6/151 (4%)
 Frame = +1

Query  253  EDRCSRSQL------RLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
            E RC    L        P  S  +LIE L++R DL+E EAEASLDFLLS  +EALISAFL
Sbjct  34   EQRCVTKTLVASRPISAPPTSFNKLIESLISRVDLTESEAEASLDFLLSEANEALISAFL  93

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGET+EE+VGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  94   VLLRAKGETYEEVVGLARAMIKCSRKVEGLKDAVDIVGTGGDGANTVNISTGASILAAAC  153

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GA VAKQGNRSSSSACGSADVLEALG+ IEL
Sbjct  154  GANVAKQGNRSSSSACGSADVLEALGIAIEL  184



>ref|XP_008351797.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate phosphoribosyltransferase, 
chloroplastic-like [Malus domestica]
Length=408

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +1

Query  244  SESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLL  423
            S SE   S+ Q    I S  ELIE L++R DL+EEEAEASL+FLL   +EALISAFLVLL
Sbjct  55   SVSEKPNSKPQ----IASFSELIESLISRVDLTEEEAEASLEFLLDGANEALISAFLVLL  110

Query  424  RAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgak  603
            RAKGET+EEIVGLA+AM K  L +EGL + VDIVGTGGDGANTVNISTGAAILA ACGAK
Sbjct  111  RAKGETYEEIVGLAKAMMKHSLKIEGLGDVVDIVGTGGDGANTVNISTGAAILATACGAK  170

Query  604  vaKQGNRSSSSACGSADVLEALGVTIEL  687
            VAKQGNRSSSSACGSADVL+ALG+ I+L
Sbjct  171  VAKQGNRSSSSACGSADVLDALGIIIDL  198



>ref|XP_010248534.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=412

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEE----I  453
            PI S K+LIE L+NRQDLSE EAEASLDFLL   + ALISAFLVLLRAKGETFEE    I
Sbjct  63   PIQSFKQLIESLINRQDLSEVEAEASLDFLLKEANGALISAFLVLLRAKGETFEEVHTTI  122

Query  454  VGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSS  633
            VGLARAM K  + VE + +AVDIVGTGGDGANTVNISTGA+ILAAA GA VAKQGNRSSS
Sbjct  123  VGLARAMLKYSVKVEEVGDAVDIVGTGGDGANTVNISTGASILAAASGANVAKQGNRSSS  182

Query  634  SACGSADVLEALGVTIEL  687
            SACGSADVLEALGV I+L
Sbjct  183  SACGSADVLEALGVVIDL  200



>ref|XP_010248533.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=413

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEE----I  453
            PI S K+LIE L+NRQDLSE EAEASLDFLL   + ALISAFLVLLRAKGETFEE    I
Sbjct  63   PIQSFKQLIESLINRQDLSEVEAEASLDFLLKEANGALISAFLVLLRAKGETFEEVHTTI  122

Query  454  VGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSS  633
            VGLARAM K  + VE + +AVDIVGTGGDGANTVNISTGA+ILAAA GA VAKQGNRSSS
Sbjct  123  VGLARAMLKYSVKVEEVGDAVDIVGTGGDGANTVNISTGASILAAASGANVAKQGNRSSS  182

Query  634  SACGSADVLEALGVTIEL  687
            SACGSADVLEALGV I+L
Sbjct  183  SACGSADVLEALGVVIDL  200



>ref|XP_007138060.1| hypothetical protein PHAVU_009G177200g [Phaseolus vulgaris]
 gb|ESW10054.1| hypothetical protein PHAVU_009G177200g [Phaseolus vulgaris]
Length=401

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = +1

Query  166  THLSSLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSE  345
            ++LSS R+  F+ P++ +  + +I SS +    + +    P+P   +LIE L++R +LSE
Sbjct  20   SNLSSQRRRFFSHPVSPLIQTTSIASSNATVSSNVATSIQPLP---QLIETLISRVNLSE  76

Query  346  EEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIV  525
            +EAEA LD LL + +EALISA LVLLRAKGETFEE+VGLARAM +    VEGL++ VDIV
Sbjct  77   DEAEACLDSLLQDPNEALISAVLVLLRAKGETFEEVVGLARAMLRHATKVEGLNDVVDIV  136

Query  526  GTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GTGGDGANTVNISTGA+IL AACGA+VAKQGNRSSSSACGSADVLEALGV I+L
Sbjct  137  GTGGDGANTVNISTGASILTAACGARVAKQGNRSSSSACGSADVLEALGVVIDL  190



>ref|XP_009762501.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=400

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++R+DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  57   ISTFSELIETLISRKDLTESEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  AMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  177  ADVLEALGIAIEL  189



>ref|XP_009762500.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=401

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++R+DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  57   ISTFSELIETLISRKDLTESEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  AMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  177  ADVLEALGIAIEL  189



>ref|XP_010027548.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Eucalyptus grandis]
 gb|KCW83358.1| hypothetical protein EUGRSUZ_B00293 [Eucalyptus grandis]
Length=403

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  ELIE L++R+DLSE +AEASLDFLL + +EALISAFLVLLRAKGETFEE+VGLARAM
Sbjct  66   SFNELIESLISREDLSEADAEASLDFLLDDTNEALISAFLVLLRAKGETFEEVVGLARAM  125

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             K    VEGL + VDIVGTGGDGANTVNISTGA+IL AACGA+VAKQGNRSSSSACGSAD
Sbjct  126  IKHAKKVEGLVDVVDIVGTGGDGANTVNISTGASILTAACGARVAKQGNRSSSSACGSAD  185

Query  655  VLEALGVTIELK  690
            VLEALGV I+L+
Sbjct  186  VLEALGVAIDLE  197



>ref|XP_010420535.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=441

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 135/182 (74%), Gaps = 18/182 (10%)
 Frame = +1

Query  151  SSFSRTHLS---SLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERL  321
            S FSR+ L+   +LR   FT P AL +       S              I S  +LIE L
Sbjct  68   SFFSRSSLACSQNLR--GFTAPEALPTACENATPSS-------------IKSFNQLIETL  112

Query  322  LNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEG  501
            ++R DLSE+EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLARAM K    VEG
Sbjct  113  IDRVDLSEDEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLARAMMKHARKVEG  172

Query  502  LDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTI  681
            L +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGSADVLEALGV +
Sbjct  173  LVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLEALGVML  232

Query  682  EL  687
            +L
Sbjct  233  DL  234



>ref|XP_010420534.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=442

 Score =   177 bits (449),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE+EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLAR
Sbjct  103  IKSFNQLIETLIDRVDLSEDEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLAR  162

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  163  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  222

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  223  ADVLEALGVMLDL  235



>ref|XP_010492792.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=442

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE+EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLAR
Sbjct  103  IKSFNQLIETLIDRVDLSEDEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLAR  162

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  163  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  222

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  223  ADVLEALGVKLDL  235



>ref|XP_010492791.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=443

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE+EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLAR
Sbjct  104  IKSFNQLIETLIDRVDLSEDEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLAR  163

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  164  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  223

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  224  ADVLEALGVKLDL  236



>ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis]
Length=425

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEI-VGLARAMRK  480
            ELIE L+NR DLSE EAEASLD+LL + +EALISAFLVLLRAKGETFEE+ VGLARAM K
Sbjct  88   ELIESLINRVDLSESEAEASLDYLLDDVNEALISAFLVLLRAKGETFEEVNVGLARAMIK  147

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
                VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVL
Sbjct  148  HARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVL  207

Query  661  EALGVTIEL  687
            EALGV I+L
Sbjct  208  EALGVVIDL  216



>ref|XP_009383611.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=414

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            KE+IE L+N  DLSEEEAEASL  L+    EALISAFLVLLR KGETFEEIVGLARAM  
Sbjct  75   KEVIETLINGVDLSEEEAEASLKLLIDEADEALISAFLVLLRVKGETFEEIVGLARAMID  134

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
              + VEG+D+AVDIVGTGGDGANTVNISTGA+ILAAA G K+AKQGNRSSSSACGSADVL
Sbjct  135  CAVKVEGIDDAVDIVGTGGDGANTVNISTGASILAAAAGLKIAKQGNRSSSSACGSADVL  194

Query  661  EALGVTIEL  687
            EALGV IEL
Sbjct  195  EALGVNIEL  203



>ref|XP_010110365.1| Anthranilate phosphoribosyltransferase [Morus notabilis]
 gb|EXC26103.1| Anthranilate phosphoribosyltransferase [Morus notabilis]
Length=401

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA  465
            P  S  ELIE L++  DLS  EAEASLDFLL+   EALISAFLVL+RAKGET+EEIVGLA
Sbjct  62   PTTSFNELIESLISGVDLSAAEAEASLDFLLNGADEALISAFLVLMRAKGETYEEIVGLA  121

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            RAM K  + VEGL +AVDIVGTGGDGANTVNISTGA+IL AACGAKVAKQGNRSSSSACG
Sbjct  122  RAMLKHSVKVEGLVDAVDIVGTGGDGANTVNISTGASILTAACGAKVAKQGNRSSSSACG  181

Query  646  SADVLEALGVTIELK  690
            SADVLEA+GV ++L+
Sbjct  182  SADVLEAMGVVLDLQ  196



>ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana]
 sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana]
 dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana]
 prf||1909347A phosphoribosylanthranilate transferase
Length=444

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  105  IKSFNQLIETLIDRVDLSETEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  164

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  165  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  224

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  225  ADVLEALGVVLDL  237



>ref|XP_010454020.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Camelina sativa]
Length=441

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLAR
Sbjct  102  IKSFNQLIESLIDRVDLSEAEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLAR  161

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  162  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  221

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV + L
Sbjct  222  ADVLEALGVMLNL  234



>ref|XP_010454019.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Camelina sativa]
Length=442

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLLS  +E LISAFLVLLRAKGETFEE+VGLAR
Sbjct  103  IKSFNQLIESLIDRVDLSEAEAESSLEFLLSEANEVLISAFLVLLRAKGETFEEVVGLAR  162

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  163  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  222

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV + L
Sbjct  223  ADVLEALGVMLNL  235



>ref|XP_009597052.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Nicotiana tomentosiformis]
Length=409

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  116  ISTFSELIEALISGKDLTESEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  175

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  176  AMIKNCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  235

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  236  ADVLEALGIAIEL  248



>ref|XP_010678793.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=409

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            E+IE L+NR DLS  EAEASL+FLLS+ +EALISAFLVLLRAKGET+EEIVGLA AM K 
Sbjct  71   EVIESLINRTDLSVSEAEASLNFLLSDANEALISAFLVLLRAKGETYEEIVGLANAMMKH  130

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               V+GL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVLE
Sbjct  131  CKSVDGLEDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVLE  190

Query  664  ALGVTIELK  690
             LG+ I+L+
Sbjct  191  ELGIAIDLE  199



>gb|EYU22141.1| hypothetical protein MIMGU_mgv1a007249mg [Erythranthe guttata]
Length=413

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            +LIE L++  DLSE EAEASLDFLL    EALISAFLVLLRAKGET+EE+VGLARAM K 
Sbjct  71   QLIESLISGVDLSEAEAEASLDFLLDGADEALISAFLVLLRAKGETYEEVVGLARAMIKH  130

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVLE
Sbjct  131  SRKVEGLTDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVLE  190

Query  664  ALGVTIELK  690
            ALGV I L+
Sbjct  191  ALGVAINLE  199



>ref|XP_009597049.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=459

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  116  ISTFSELIEALISGKDLTESEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  175

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  176  AMIKNCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  235

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  236  ADVLEALGIAIEL  248



>ref|XP_009597051.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=455

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  116  ISTFSELIEALISGKDLTESEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  175

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  176  AMIKNCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  235

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  236  ADVLEALGIAIEL  248



>ref|XP_011071889.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Sesamum indicum]
Length=409

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            +LIE L++  DLSE EAEASLDFLL    EALISAFLVLLRAKGET+EE+VGLARAM K 
Sbjct  68   QLIEALISGVDLSEAEAEASLDFLLDGADEALISAFLVLLRAKGETYEEVVGLARAMIKH  127

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVLE
Sbjct  128  CRKVEGLSDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVLE  187

Query  664  ALGVTIELK  690
            ALGV I L+
Sbjct  188  ALGVAISLE  196



>ref|XP_006840664.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda]
 gb|ERN02339.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda]
Length=423

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARA  471
            P  KE++E L+  +DLS+EEAEA+LD+LLS  +EA ISAFLVLLRAKGET+EEI GLA+A
Sbjct  81   PQFKEVLESLIEMEDLSKEEAEAALDYLLSEANEAQISAFLVLLRAKGETYEEITGLAKA  140

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M K  + VEGL  AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSA
Sbjct  141  MIKYCIRVEGLSEAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSA  200

Query  652  DVLEALGVTIELK  690
            DVLE LGV I+L+
Sbjct  201  DVLEELGVIIDLE  213



>gb|ADZ24712.1| anthranilate phosphoribosyltransferase [Solanum pennellii]
Length=365

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E E+E SLDFLL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  59   ISTFSELIEALISGKDLTESESEDSLDFLLDGADEALISAFLVLLRAKGETFEEVVGLAR  118

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  119  AMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  178

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  179  ADVLEELGVAIEL  191



>ref|XP_009787827.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=380

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  +LIE L++ +DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  57   ISTFSKLIEDLISGKDLTEYEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL + VDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  AMIKHCRQVEGLSDVVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  177  ADVLEALGIAIEL  189



>ref|XP_004241508.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=401

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E E+E SLDFLL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  59   ISTFSELIEALISGKDLTESESEDSLDFLLDGADEALISAFLVLLRAKGETFEEVVGLAR  118

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  119  AMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  178

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  179  ADVLEELGVAIEL  191



>ref|XP_009787826.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=400

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  +LIE L++ +DL+E EAE SLD+LL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  57   ISTFSKLIEDLISGKDLTEYEAEESLDYLLDGADEALISAFLVLLRAKGETFEEVVGLAR  116

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL + VDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  117  AMIKHCRQVEGLSDVVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  176

Query  649  ADVLEALGVTIEL  687
            ADVLEALG+ IEL
Sbjct  177  ADVLEALGIAIEL  189



>ref|XP_004241509.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=398

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E E+E SLDFLL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  59   ISTFSELIEALISGKDLTESESEDSLDFLLDGADEALISAFLVLLRAKGETFEEVVGLAR  118

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGS
Sbjct  119  AMIKHCRQVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGS  178

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  179  ADVLEELGVAIEL  191



>emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera]
Length=830

 Score =   171 bits (434),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 129/226 (57%), Positives = 148/226 (65%), Gaps = 36/226 (16%)
 Frame = +1

Query  118  VMAMLGCAATVSSFSRTHLSSLRKPSFTRP----IALVSTSRTIVSSESEDRCSRSQLRL  285
            VMA+    A++S  S    +SL  P    P    +A +   R   S  +    SR+ L L
Sbjct  392  VMAVFAYTASISRPSPFLNNSLYFPPIQIPFFASLAPLPNRRNSKSIHTVLPSSRAPLDL  451

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA  465
            PI SS++L+E LLNR+D SEEEAE SL+FLL++GSEALISAFLVLLRAKGETFEE+VGLA
Sbjct  452  PITSSRQLLECLLNREDFSEEEAEESLNFLLNDGSEALISAFLVLLRAKGETFEEVVGLA  511

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaK-----------  612
            RAM K    VEG+ +AVDIVGTGGDGANTVNISTGAAILAAACGAKVAK           
Sbjct  512  RAMIKCCSKVEGVYDAVDIVGTGGDGANTVNISTGAAILAAACGAKVAKDYLLTWLKYVI  571

Query  613  ---------------------QGNRSSSSACGSADVLEALGVTIEL  687
                                 QGNRSSSSACGSADVLEALGV I+L
Sbjct  572  CNVGLYGKMEIYNIGVVFELQQGNRSSSSACGSADVLEALGVIIDL  617



>emb|CDP16914.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  313  ERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLL  492
            E L++  DLSE EAE SLDFLL    EAL+SAFLVLLRAKGET+EE+VGLARAM K    
Sbjct  73   ETLISGVDLSESEAEESLDFLLDGADEALLSAFLVLLRAKGETYEEVVGLARAMIKHCRK  132

Query  493  VEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALG  672
            VEGLD+AVDIVGTGGDGANTVNISTGA+ILAAACG KVAKQGNRSSSSACGSADVLE LG
Sbjct  133  VEGLDDAVDIVGTGGDGANTVNISTGASILAAACGVKVAKQGNRSSSSACGSADVLEELG  192

Query  673  VTIEL  687
            + IEL
Sbjct  193  IAIEL  197



>ref|XP_002318059.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa]
 gb|EEE96279.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa]
Length=420

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA-  465
            +P+  ELIE L+N+ DLSE EAEASLD+LL + SEALISAFLVLLRAKGETFEE   +  
Sbjct  75   VPAFNELIESLINKVDLSESEAEASLDYLLDDASEALISAFLVLLRAKGETFEEARNIYI  134

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
             AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACG
Sbjct  135  SAMFKHARKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACG  194

Query  646  SADVLEALGVTIEL  687
            SADVLE LGV I+L
Sbjct  195  SADVLEELGVVIDL  208



>ref|XP_009776444.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate phosphoribosyltransferase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=284

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  319  LLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVE  498
            L++ +DL+E EAE SLD+LL    EALISAF VLLR KGETFEE+VGLARAM K    VE
Sbjct  2    LISGKDLTEYEAEESLDYLLDGADEALISAFFVLLRTKGETFEEVVGLARAMIKHCRQVE  61

Query  499  GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVT  678
            GL + VDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQGNRSSSSACGSADVLEALG+ 
Sbjct  62   GLSDVVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGNRSSSSACGSADVLEALGIA  121

Query  679  IEL  687
            IEL
Sbjct  122  IEL  124



>ref|XP_004501916.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=428

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = +1

Query  289  IPSSK---ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVG  459
            +PS K   ++IE L+N  DLSE EAE+ L+ LLS G+EALISA LVLLRAKGET EEI G
Sbjct  89   LPSVKSISQIIESLINGVDLSEVEAESCLELLLSEGNEALISAVLVLLRAKGETDEEIAG  148

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            LAR M K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACG KVAKQGNRSSSSA
Sbjct  149  LARTMMKHAKKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGVKVAKQGNRSSSSA  208

Query  640  CGSADVLEALGVTIEL  687
            CGSADVLEALG+ IEL
Sbjct  209  CGSADVLEALGIAIEL  224



>ref|XP_004501915.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=441

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = +1

Query  289  IPSSK---ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVG  459
            +PS K   ++IE L+N  DLSE EAE+ L+ LLS G+EALISA LVLLRAKGET EEI G
Sbjct  89   LPSVKSISQIIESLINGVDLSEVEAESCLELLLSEGNEALISAVLVLLRAKGETDEEIAG  148

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            LAR M K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACG KVAKQGNRSSSSA
Sbjct  149  LARTMMKHAKKVEGLVDAVDIVGTGGDGANTVNISTGASILAAACGVKVAKQGNRSSSSA  208

Query  640  CGSADVLEALGVTIEL  687
            CGSADVLEALG+ IEL
Sbjct  209  CGSADVLEALGIAIEL  224



>ref|XP_006400341.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
 gb|ESQ41794.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
Length=372

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE E E+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  109  IKSFNQLIEALIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  168

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM  R   VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  169  AMMNRARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  228

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  229  ADVLEALGVVIDL  241



>ref|XP_009121033.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brassica rapa]
Length=429

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S  +LIE L++R DLSE E E+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  90   VKSFNQLIESLIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  149

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  150  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  209

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  210  ADVLEALGVVIDL  222



>emb|CDY38473.1| BnaA10g16850D [Brassica napus]
Length=429

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S  +LIE L++R DLSE E E+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  90   VKSFNQLIESLIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  149

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  150  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  209

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  210  ADVLEALGVVIDL  222



>ref|XP_006400342.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
 gb|ESQ41795.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
Length=448

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE E E+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  109  IKSFNQLIEALIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  168

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM  R   VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  169  AMMNRARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  228

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  229  ADVLEALGVVIDL  241



>emb|CDY25471.1| BnaC09g39860D [Brassica napus]
Length=433

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            + S K+LIE L++R DLSE E E+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  94   VKSFKQLIESLIDRVDLSESETESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  153

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M K    V+GL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  154  GMMKHARKVDGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  213

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  214  ADVLEALGVVIDL  226



>ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48052.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  105  IKSFNQLIETLIDRVDLSESEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  164

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  165  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  224

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  225  ADVLEALGVVLDL  237



>gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana]
 gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana]
Length=441

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  102  IKSFNQLIETLIDRVDLSESEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  161

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  162  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  221

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  222  ADVLEALGVALDL  234



>gb|AFW89746.1| hypothetical protein ZEAMMB73_227948 [Zea mays]
Length=330

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +++E L+   D SEE+AEA+L  LL    EA ISAFLVLLRAKGETFEEIVGLA+
Sbjct  56   IGSFDKVLEALIGGTDFSEEDAEATLKLLLDEKDEARISAFLVLLRAKGETFEEIVGLAK  115

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGS
Sbjct  116  AMLSCCIRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGS  175

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV IEL
Sbjct  176  ADVLEALGVNIEL  188



>ref|XP_010251181.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Nelumbo nucifera]
Length=413

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I SSKELIE L+N  DLSEE+AEASLDFLL + +E L+SA LVLLRAKGETFEEIVGLAR
Sbjct  63   ILSSKELIESLINGVDLSEEQAEASLDFLLKDANEVLVSALLVLLRAKGETFEEIVGLAR  122

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            A+ K    VE + +AVDIVGTGGDGANTVNISTGA+ILAAA GAKVAKQGNRSSSSACGS
Sbjct  123  AIIKYCRKVEEVGDAVDIVGTGGDGANTVNISTGASILAAASGAKVAKQGNRSSSSACGS  182

Query  649  ADVLEALGVTIEL  687
            ADVL+ALGV I+L
Sbjct  183  ADVLQALGVAIDL  195



>ref|XP_003558920.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brachypodium distachyon]
Length=400

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            ++++E L+     SEEEAEA+L  LL+  +EA I+AFLVLLRAKGET+EEIVGLA+AM  
Sbjct  69   EQVLEELIGGAHFSEEEAEATLHLLLNEENEARIAAFLVLLRAKGETYEEIVGLAKAMMN  128

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
              + VEGLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSADVL
Sbjct  129  HCVRVEGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSADVL  188

Query  661  EALGVTIEL  687
            EALGV IEL
Sbjct  189  EALGVNIEL  197



>ref|XP_008658036.1| PREDICTED: blue fluorescent1 isoform X1 [Zea mays]
 gb|AFW89745.1| blue fluorescent1 [Zea mays]
Length=393

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +++E L+   D SEE+AEA+L  LL    EA ISAFLVLLRAKGETFEEIVGLA+
Sbjct  56   IGSFDKVLEALIGGTDFSEEDAEATLKLLLDEKDEARISAFLVLLRAKGETFEEIVGLAK  115

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGS
Sbjct  116  AMLSCCIRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGS  175

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV IEL
Sbjct  176  ADVLEALGVNIEL  188



>dbj|BAJ87749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96150.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92390.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = +1

Query  184  RKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSS---KELIERLLNRQDLSEEEA  354
            R+PS  RP   V  +R +  +    + + +      P +   ++++E+L+   D +E+EA
Sbjct  26   RRPSTARP---VGPARRLPPARVAVQPAAAPAPAASPGTATFEQVLEQLIGGADFTEDEA  82

Query  355  EASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTG  534
            EA+L  LL+  +EA I+AFLVLLRAKGET+EEIVGLA+AM +  + VEGL +AVDIVGTG
Sbjct  83   EATLQLLLNEKNEARIAAFLVLLRAKGETYEEIVGLAKAMMRNCVRVEGLHDAVDIVGTG  142

Query  535  GDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSADVLEALGV IEL
Sbjct  143  GDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSADVLEALGVNIEL  193



>gb|KFK26024.1| hypothetical protein AALP_AA8G193700 [Arabis alpina]
Length=426

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++  DLSE E E+SL+FLL+  +E LISAFLVLLRAKGET+EEIVGLAR
Sbjct  87   IKSFNQLIETLIDGVDLSESETESSLEFLLNEANEVLISAFLVLLRAKGETYEEIVGLAR  146

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGS
Sbjct  147  AMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGS  206

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  207  ADVLEALGVVIDL  219



>ref|XP_006287763.1| hypothetical protein CARUB_v10000975mg [Capsella rubella]
 gb|EOA20661.1| hypothetical protein CARUB_v10000975mg [Capsella rubella]
Length=441

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 131/180 (73%), Gaps = 14/180 (8%)
 Frame = +1

Query  151  SSFSRTHLSSLRKPS-FTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLN  327
            S FSR+  +  + P  F+ P AL +       S              I S  +LIE L++
Sbjct  68   SFFSRSSFACSQNPGGFSAPEALPTACENASPSS-------------IKSFNQLIETLID  114

Query  328  RQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLD  507
            R DLSE EAE+SL+FLL+  +E LISAFLVLLRAKGET+EE+VGLARAM K    VEGL 
Sbjct  115  RVDLSESEAESSLEFLLNEANEVLISAFLVLLRAKGETYEEVVGLARAMMKHARKVEGLV  174

Query  508  NAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGSADVLE LGV ++L
Sbjct  175  DAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLETLGVELDL  234



>ref|XP_008245012.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Prunus mume]
Length=405

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 10/168 (6%)
 Frame = +1

Query  184  RKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEAS  363
            ++ S  R  ALVS S  IVS  S+          PI S  ELIE L++R DLSE EAEAS
Sbjct  38   QRSSAARVCALVSAS-PIVSERSKP---------PIASFNELIESLIDRVDLSEAEAEAS  87

Query  364  LDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDG  543
            L+FLL + +EALISAFLVLLRAKGET+ EIVGLA+ M K  L +EG+D+AVDIVGTGGDG
Sbjct  88   LEFLLRDANEALISAFLVLLRAKGETYGEIVGLAKGMMKHSLKIEGIDDAVDIVGTGGDG  147

Query  544  ANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ANTVNISTGAAILAAACGAKVAKQG+RSSSSACGSADVLE+LG+ I+L
Sbjct  148  ANTVNISTGAAILAAACGAKVAKQGSRSSSSACGSADVLESLGIIIDL  195



>emb|CDX85428.1| BnaA02g03850D [Brassica napus]
Length=436

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +LIE L++R DLSE EAE+SLDFLL++ +EALISAFLVLLRAKGET+EEIVGLARAM
Sbjct  99   SFNQLIESLIDRVDLSESEAESSLDFLLNDANEALISAFLVLLRAKGETYEEIVGLARAM  158

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQG+RSSSSACGSAD
Sbjct  159  MKHARKVEGLADAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGSRSSSSACGSAD  218

Query  655  VLEALGVTIEL  687
            VLEALGV I+L
Sbjct  219  VLEALGVVIDL  229



>ref|XP_007211039.1| hypothetical protein PRUPE_ppa019367mg, partial [Prunus persica]
 gb|EMJ12238.1| hypothetical protein PRUPE_ppa019367mg, partial [Prunus persica]
Length=396

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 10/168 (6%)
 Frame = +1

Query  184  RKPSFTRPIALVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEAS  363
            ++ S  R  AL+S S  IVS  S+          PI S KELIE L++R DLSE EAE S
Sbjct  38   QRSSAARVCALLSAS-PIVSERSKP---------PIASFKELIESLIDRVDLSEAEAEDS  87

Query  364  LDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDG  543
            L+FLL + +EALISAFLVLLRAKGET+ EIVGLA+ M K  L ++G+D+AVDIVGTGGDG
Sbjct  88   LEFLLRDANEALISAFLVLLRAKGETYGEIVGLAKGMMKHSLKIDGIDDAVDIVGTGGDG  147

Query  544  ANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ANTVNISTGAAILAAACGAKVAKQG+RSSSSACGSADVLEALG+ I+L
Sbjct  148  ANTVNISTGAAILAAACGAKVAKQGSRSSSSACGSADVLEALGIIIDL  195



>ref|XP_010421683.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=418

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  349  EAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVG  528
            +AE+SL+FLL+   E LISAFLVLLRAKGET+EE+VGLARAM K    VEGL + VDIVG
Sbjct  100  QAESSLEFLLNEADEVLISAFLVLLRAKGETYEEVVGLARAMIKHARKVEGLGDVVDIVG  159

Query  529  TGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            TGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSACGSADVLEALGV ++L
Sbjct  160  TGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLEALGVMLDL  212



>ref|XP_002986483.1| hypothetical protein SELMODRAFT_425447 [Selaginella moellendorffii]
 gb|EFJ12340.1| hypothetical protein SELMODRAFT_425447 [Selaginella moellendorffii]
Length=364

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = +1

Query  259  RCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGE  438
            +C+ S     +P    LIE LL + DL+ E+ E+  D LL     A ISAFLVLLRAK E
Sbjct  8    QCAASNSLHSVP---RLIESLLEKTDLTSEQTESVTDMLLEGADAAQISAFLVLLRAKNE  64

Query  439  TFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQG  618
            TFEEI GLA+AM KR + V GL   +DIVGTGGDGANTVNISTGA ILAA+CGAKVAK G
Sbjct  65   TFEEIAGLAKAMIKRSIAVPGLAGGLDIVGTGGDGANTVNISTGACILAASCGAKVAKHG  124

Query  619  NRSSSSACGSADVLEALGVTIEL  687
            NRSSSSACGSADVLEALGV I L
Sbjct  125  NRSSSSACGSADVLEALGVEINL  147



>ref|XP_009126226.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brassica rapa]
Length=432

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            +LIE L++R DLSE EAE+SLDFLL++ +EALISAFLVLLRAKGET+EEIVGLARAM K 
Sbjct  98   QLIESLIDRVDLSESEAESSLDFLLNDANEALISAFLVLLRAKGETYEEIVGLARAMMKH  157

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQG+RSSSSACGSADVLE
Sbjct  158  ARKVEGLLDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGSRSSSSACGSADVLE  217

Query  664  ALGVTIEL  687
            ALGV I+L
Sbjct  218  ALGVVIDL  225



>ref|XP_010421681.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010421682.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=433

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +1

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGL  462
            L I +  +LIE L++  DLSE EAE+SL+FLL+   E LISAFLVLLRAKGET+EE+VGL
Sbjct  93   LSINTFNQLIETLIDWVDLSESEAESSLEFLLNEADEVLISAFLVLLRAKGETYEEVVGL  152

Query  463  ARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSAC  642
            ARAM K    VEGL + VDIVGTGGDGANTVNISTG++ILAAACGAKVAKQGNRSSSSAC
Sbjct  153  ARAMIKHARKVEGLGDVVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSAC  212

Query  643  GSADVLEALGVTIEL  687
            GSADVLEALGV ++L
Sbjct  213  GSADVLEALGVMLDL  227



>ref|XP_004985893.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Setaria italica]
Length=394

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +++E L+   D SEE+AEA+L  LL    EA I+AFLVLLRAKGET+EEIVGLA 
Sbjct  58   IGSFDKVLEALIAGTDFSEEDAEATLRLLLEEKDEARIAAFLVLLRAKGETYEEIVGLAN  117

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGS
Sbjct  118  AMLSCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGS  177

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV IEL
Sbjct  178  ADVLEALGVNIEL  190



>ref|XP_009362988.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Pyrus x bretschneideri]
Length=408

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRG  486
            LIE L++R DL+EEEAEASL+FLL + +EALISAFLVLLRAKGET+EEIVGLA+AM K  
Sbjct  72   LIESLISRVDLTEEEAEASLEFLLDDANEALISAFLVLLRAKGETYEEIVGLAKAMMKHS  131

Query  487  LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEA  666
            L +EGL + VDIVGTGGDGANTVNISTGAAILAAACGAKVAKQG+RSSSSACGSADVLEA
Sbjct  132  LKIEGLGDVVDIVGTGGDGANTVNISTGAAILAAACGAKVAKQGSRSSSSACGSADVLEA  191

Query  667  LGVTIEL  687
            LG+ I+L
Sbjct  192  LGIIIDL  198



>ref|XP_003523084.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Glycine max]
 gb|KHN30924.1| Anthranilate phosphoribosyltransferase, chloroplastic [Glycine 
soja]
Length=399

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 141/195 (72%), Gaps = 15/195 (8%)
 Frame = +1

Query  127  MLGCAATVSSFSRTHLSS----LRKPSFTRPIALVSTSRTIVSSE----SEDRCSRSQLR  282
            M    A  S F+   L S    LR+  F+ PI+ + T RT+++SE    S D  S +   
Sbjct  1    MAQAHALFSPFNPRLLPSSSPILRRRFFSLPISPL-THRTVIASENVAVSPDAASSTH--  57

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGL  462
                S  ++IE L++  DLSEEEAEA L+ LL   +EALISA LVLLRAKGET+EE+VGL
Sbjct  58   ----SLPQVIETLISGVDLSEEEAEACLNLLLHEPNEALISALLVLLRAKGETYEEVVGL  113

Query  463  ARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSAC  642
            ARAM K    VEGLD+ VDIVGTGGDGANTVNISTGA+ILAAACGA+VAKQG+RSSSSAC
Sbjct  114  ARAMFKHATKVEGLDDVVDIVGTGGDGANTVNISTGASILAAACGARVAKQGSRSSSSAC  173

Query  643  GSADVLEALGVTIEL  687
            GSADVLEALGV I+L
Sbjct  174  GSADVLEALGVVIDL  188



>ref|XP_006439848.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53088.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=422

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 140/211 (66%), Gaps = 27/211 (13%)
 Frame = +1

Query  109  NAVVMAMLG----CAATVSSFSRTH------LSSLRKPSFT--------RPIALVSTSRT  234
            NA  M M       A + S F+  H      L SLR   FT        R +  + T + 
Sbjct  60   NATTMTMRALLNLTAVSSSPFNNNHPNHRPSLPSLRNCGFTTAGNNPRCRELTAIQTPQP  119

Query  235  IVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
             VS  +         R   P   ELI+ L++R DL+E EA+ASLD+LL+   EALISAFL
Sbjct  120  AVSDNT---------RPLTPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFL  170

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGETF EIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  171  VLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAAC  230

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GAKVAKQG+RSSSSACGSADVLEALGV I+L
Sbjct  231  GAKVAKQGSRSSSSACGSADVLEALGVVIDL  261



>ref|XP_006439846.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53086.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=468

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 140/211 (66%), Gaps = 27/211 (13%)
 Frame = +1

Query  109  NAVVMAMLG----CAATVSSFSRTH------LSSLRKPSFT--------RPIALVSTSRT  234
            NA  M M       A + S F+  H      L SLR   FT        R +  + T + 
Sbjct  60   NATTMTMRALLNLTAVSSSPFNNNHPNHRPSLPSLRNCGFTTAGNNPRCRELTAIQTPQP  119

Query  235  IVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
             VS  +         R   P   ELI+ L++R DL+E EA+ASLD+LL+   EALISAFL
Sbjct  120  AVSDNT---------RPLTPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFL  170

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGETF EIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  171  VLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAAC  230

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GAKVAKQG+RSSSSACGSADVLEALGV I+L
Sbjct  231  GAKVAKQGSRSSSSACGSADVLEALGVVIDL  261



>ref|XP_006439847.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53087.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=470

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 140/211 (66%), Gaps = 27/211 (13%)
 Frame = +1

Query  109  NAVVMAMLG----CAATVSSFSRTH------LSSLRKPSFT--------RPIALVSTSRT  234
            NA  M M       A + S F+  H      L SLR   FT        R +  + T + 
Sbjct  60   NATTMTMRALLNLTAVSSSPFNNNHPNHRPSLPSLRNCGFTTAGNNPRCRELTAIQTPQP  119

Query  235  IVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
             VS  +         R   P   ELI+ L++R DL+E EA+ASLD+LL+   EALISAFL
Sbjct  120  AVSDNT---------RPLTPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFL  170

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGETF EIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  171  VLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAAC  230

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GAKVAKQG+RSSSSACGSADVLEALGV I+L
Sbjct  231  GAKVAKQGSRSSSSACGSADVLEALGVVIDL  261



>ref|XP_006439849.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53089.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=468

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 140/211 (66%), Gaps = 27/211 (13%)
 Frame = +1

Query  109  NAVVMAMLG----CAATVSSFSRTH------LSSLRKPSFT--------RPIALVSTSRT  234
            NA  M M       A + S F+  H      L SLR   FT        R +  + T + 
Sbjct  60   NATTMTMRALLNLTAVSSSPFNNNHPNHRPSLPSLRNCGFTTAGNNPRCRELTAIQTPQP  119

Query  235  IVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
             VS  +         R   P   ELI+ L++R DL+E EA+ASLD+LL+   EALISAFL
Sbjct  120  AVSDNT---------RPLTPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFL  170

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGETF EIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  171  VLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAAC  230

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GAKVAKQG+RSSSSACGSADVLEALGV I+L
Sbjct  231  GAKVAKQGSRSSSSACGSADVLEALGVVIDL  261



>ref|XP_002465954.1| hypothetical protein SORBIDRAFT_01g048790 [Sorghum bicolor]
 gb|EER92952.1| hypothetical protein SORBIDRAFT_01g048790 [Sorghum bicolor]
Length=399

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +++E L+   D SEE+AE +L  LL    EA ISAFLVLLRAKGET+EEIVGLA+
Sbjct  53   IGSFDKVLEALIRGTDFSEEDAETTLRLLLDEKDEARISAFLVLLRAKGETYEEIVGLAK  112

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + V+GL++AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGS
Sbjct  113  AMLSCCVRVDGLEDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGS  172

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV IEL
Sbjct  173  ADVLEALGVNIEL  185



>ref|XP_006476804.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Citrus sinensis]
Length=413

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 140/211 (66%), Gaps = 27/211 (13%)
 Frame = +1

Query  109  NAVVMAMLG----CAATVSSFSRTH------LSSLRKPSFT--------RPIALVSTSRT  234
            NA  M M       A + S F+  H      L SL    FT        R +  + T + 
Sbjct  3    NATTMTMRALLNLTAVSSSPFNNNHPNHRPFLPSLGNCGFTTAGNNPRCRELTAIQTPQP  62

Query  235  IVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFL  414
             VS  +     R Q     P   ELI+ L++R DL+E EA+ASLD+LL+   EALISAFL
Sbjct  63   AVSDNT-----RPQ----TPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFL  113

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            VLLRAKGETF EIVGLARAM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAAC
Sbjct  114  VLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAAC  173

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            GAKVAKQG+RSSSSACGSADVLEALGV I+L
Sbjct  174  GAKVAKQGSRSSSSACGSADVLEALGVVIDL  204



>ref|XP_006650997.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like, 
partial [Oryza brachyantha]
Length=324

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  337  LSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAV  516
             S+EEAEA+L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM    + VEGLD+AV
Sbjct  2    FSQEEAEATLRLLLQEENEARIAAFLVLLRAKGETYEEIVGLAKAMISCCVRVEGLDDAV  61

Query  517  DIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            DIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSADVLEALGV IEL
Sbjct  62   DIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSADVLEALGVNIEL  118



>ref|XP_006347447.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=401

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E E+E SLDFLL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  59   ISTFSELIEALISGKDLTESESEDSLDFLLDGADEALISAFLVLLRAKGETFEEVVGLAR  118

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQG+RSSSSACGS
Sbjct  119  AMIKHCRRVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGSRSSSSACGS  178

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  179  ADVLEELGVAIEL  191



>ref|XP_006347448.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=398

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I +  ELIE L++ +DL+E E+E SLDFLL    EALISAFLVLLRAKGETFEE+VGLAR
Sbjct  59   ISTFSELIEALISGKDLTESESEDSLDFLLDGADEALISAFLVLLRAKGETFEEVVGLAR  118

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQG+RSSSSACGS
Sbjct  119  AMIKHCRRVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQGSRSSSSACGS  178

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  179  ADVLEELGVAIEL  191



>gb|AFK40049.1| unknown [Lotus japonicus]
Length=402

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 133/195 (68%), Gaps = 17/195 (9%)
 Frame = +1

Query  124  AMLGCAATVSSFSRTH-------LSSLRKPSFTRPIALVSTSRTIVSSESEDRCSRSQLR  282
            A+     +  SF  TH       L+ LR P    PI     S  + ++ S +    S   
Sbjct  6    ALFSTLTSSPSFFFTHHRVPSPNLTLLRTPPLPSPI-----SHRVSAAVSRNAGVSS---  57

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGL  462
              I S  +LIE L+N  DLSE EAEA LD +L+  +EALISA LVLLRA+GETFEE+VGL
Sbjct  58   --IKSVPQLIESLINGVDLSETEAEACLDLVLNEPNEALISAVLVLLRARGETFEEVVGL  115

Query  463  ARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSAC  642
            ARAM K    VEGL + VDIVGTGGDGANTVNISTGA+ILAAACG KVAKQG+RSSSSAC
Sbjct  116  ARAMMKHANKVEGLVDVVDIVGTGGDGANTVNISTGASILAAACGVKVAKQGSRSSSSAC  175

Query  643  GSADVLEALGVTIEL  687
            GSADVLEALGV I+L
Sbjct  176  GSADVLEALGVVIDL  190



>ref|NP_001048822.1| Os03g0126000 [Oryza sativa Japonica Group]
 gb|ABF93753.1| Anthranilate phosphoribosyltransferase, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10736.1| Os03g0126000 [Oryza sativa Japonica Group]
 dbj|BAH00606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +++E L+     SEEEAEA+L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM
Sbjct  62   SFDKVLETLIGGDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAM  121

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
                + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSAD
Sbjct  122  IGCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSAD  181

Query  655  VLEALGVTIEL  687
            VLEA GV IEL
Sbjct  182  VLEAFGVNIEL  192



>gb|AAM19104.1|AC104427_2 Putative phosphoribosylanthranilate transferase [Oryza sativa 
Japonica Group]
 gb|EAZ25430.1| hypothetical protein OsJ_09246 [Oryza sativa Japonica Group]
Length=409

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +++E L+     SEEEAEA+L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM
Sbjct  62   SFDKVLETLIGGDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAM  121

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
                + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSAD
Sbjct  122  IGCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSAD  181

Query  655  VLEALGVTIEL  687
            VLEA GV IEL
Sbjct  182  VLEAFGVNIEL  192



>gb|KIZ06379.1| anthranilate phosphoribosyltransferase [Monoraphidium neglectum]
Length=224

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            KE+IE L+ RQDLS++++E +L  +L + S    +AFLVLLRAKGET +EI G+ARA  +
Sbjct  2    KEIIEALIARQDLSQQQSEDALLSVLDDFSPEQTAAFLVLLRAKGETPDEIAGMARAFLQ  61

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            RGL VE     VDIVGTGGDG  +VNISTGA+++ AA G +VAK GNRS SS CGSADVL
Sbjct  62   RGLHVETAKGVVDIVGTGGDGIGSVNISTGASVIVAAAGGRVAKHGNRSVSSLCGSADVL  121

Query  661  EALGVTIEL  687
            EALGV I+L
Sbjct  122  EALGVEIDL  130



>gb|EAY88350.1| hypothetical protein OsI_09808 [Oryza sativa Indica Group]
Length=411

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +++E L+     SEEEAE +L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM
Sbjct  62   SFDKVLEALIGGDHFSEEEAEVTLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAM  121

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
                + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSAD
Sbjct  122  IGCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSAD  181

Query  655  VLEALGVTIEL  687
            VLEALGV IEL
Sbjct  182  VLEALGVNIEL  192



>ref|XP_002964901.1| hypothetical protein SELMODRAFT_230552 [Selaginella moellendorffii]
 gb|EFJ33739.1| hypothetical protein SELMODRAFT_230552 [Selaginella moellendorffii]
Length=394

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 90/134 (67%), Gaps = 3/134 (2%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S   LIE LL + DL+ E+ E+  D LL     A ISAFLVLLRAK ETFEEI GLA+AM
Sbjct  48   SVPRLIETLLEKTDLTSEQTESVTDMLLEGADAAQISAFLVLLRAKNETFEEIAGLAKAM  107

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaK---QGNRSSSSACG  645
             KR + V GL   +DIVGTGGDGANTVNIS  +        ++  K    GNRSSSSACG
Sbjct  108  IKRSIAVPGLVGGLDIVGTGGDGANTVNISDWSLYPCCFLRSQGCKGTMHGNRSSSSACG  167

Query  646  SADVLEALGVTIEL  687
            SADVLEALGV I L
Sbjct  168  SADVLEALGVEINL  181



>ref|XP_002880727.1| hypothetical protein ARALYDRAFT_901281 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56986.1| hypothetical protein ARALYDRAFT_901281 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  108  IKSFNQLIETLIDRVDLSEAEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  167

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
            AM K    VEGL +AVDIVG GGDGANTVNISTG
Sbjct  168  AMMKHARKVEGLVDAVDIVGIGGDGANTVNISTG  201



>ref|XP_002878960.1| hypothetical protein ARALYDRAFT_901396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55219.1| hypothetical protein ARALYDRAFT_901396 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+  +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  152  IKSFNQLIETLIDRVDLSEAEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLAR  211

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
             M K    VEGL +AVDIVGTGGDGANTVNISTG
Sbjct  212  EMMKHARKVEGLVDAVDIVGTGGDGANTVNISTG  245



>ref|XP_002883816.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60075.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 3/94 (3%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL+   EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  81   IKSFNQLIETLIDRVDLSEAEAESSLEFLLN---EALISAFLVLLRAKGETYEEIVGLAR  137

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
            AM K    VEGL +A+DIVGTGGDGANTVNISTG
Sbjct  138  AMMKHARKVEGLVDAMDIVGTGGDGANTVNISTG  171



>emb|CDY02664.1| BnaC02g07710D [Brassica napus]
Length=432

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            I S  +LIE L++R DLSE EAE+SL+FLL++ +EALISAFLVLLRAKGET+EEIVGLAR
Sbjct  93   IKSFNQLIESLIDRVDLSESEAESSLEFLLNDTNEALISAFLVLLRAKGETYEEIVGLAR  152

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM K    VEGL +AVDIVGTGGDGANTVNISTG++ILAAACGAKVAKQG+RSSSSACGS
Sbjct  153  AMMKHARKVEGLADAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGSRSSSSACGS  212

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV I+L
Sbjct  213  ADVLEALGVVIDL  225



>ref|XP_001702699.1| anthranilate phosphoribosyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06478.1| anthranilate phosphoribosyltransferase [Chlamydomonas reinhardtii]
Length=390

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  202  RPIALVSTSRTIVSSESEDRC-SRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLL  378
            RP A  ST RT     S  RC ++ Q+R       E+IE+L+ R+DL+E++AE +L  LL
Sbjct  19   RPSA-ASTVRTSTCRSSSVRCQAKMQMR-------EVIEKLIVREDLTEKQAEEALGTLL  70

Query  379  SNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVN  558
             +      +AFLVLLRAKGET  EI GLA+AM  + L V+     VDIVGTGGDG  +VN
Sbjct  71   DDFVTEQAAAFLVLLRAKGETPAEIAGLAKAMLDKALPVKTSQPVVDIVGTGGDGIGSVN  130

Query  559  ISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            ISTGA+ILAAA GAKVAK GNRS SS CGSADVLEALG+ I+L
Sbjct  131  ISTGASILAAAAGAKVAKHGNRSVSSLCGSADVLEALGIAIDL  173



>gb|KEH35038.1| anthranilate phosphoribosyltransferase [Medicago truncatula]
Length=363

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA  465
            P+ S  +LIE L+N  DLSE+EAE+ +  L++   EALISA LVLLRAKGET EE+ GLA
Sbjct  52   PVQSVTQLIESLINGVDLSEDEAESCVHLLVNEPDEALISAVLVLLRAKGETVEEVSGLA  111

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            +AM +    VEGL + VDIVGTGGDGANTVNISTG++ILAAACG KVAKQG+RSSSSACG
Sbjct  112  KAMMRHATKVEGLVDVVDIVGTGGDGANTVNISTGSSILAAACGVKVAKQGSRSSSSACG  171

Query  646  SADVLEALGVTIEL  687
            SADVLE LGV I+L
Sbjct  172  SADVLEELGVVIDL  185



>ref|XP_003601245.1| Anthranilate phosphoribosyltransferase [Medicago truncatula]
 gb|AES71496.1| anthranilate phosphoribosyltransferase [Medicago truncatula]
 gb|AFK40968.1| unknown [Medicago truncatula]
Length=394

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLA  465
            P+ S  +LIE L+N  DLSE+EAE+ +  L++   EALISA LVLLRAKGET EE+ GLA
Sbjct  52   PVQSVTQLIESLINGVDLSEDEAESCVHLLVNEPDEALISAVLVLLRAKGETVEEVSGLA  111

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            +AM +    VEGL + VDIVGTGGDGANTVNISTG++ILAAACG KVAKQG+RSSSSACG
Sbjct  112  KAMMRHATKVEGLVDVVDIVGTGGDGANTVNISTGSSILAAACGVKVAKQGSRSSSSACG  171

Query  646  SADVLEALGVTIEL  687
            SADVLE LGV I+L
Sbjct  172  SADVLEELGVVIDL  185



>ref|XP_001418201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=370

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            +++IE L    DLSEE+A A+++ LL +     I+AFLVLLRAKGET  E+ GLARAM+ 
Sbjct  35   RKVIEDLCEGADLSEEDAHAAMEALL-DADPTQIAAFLVLLRAKGETASEMAGLARAMQS  93

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            R + V+  D+ +DIVGTGGD A TVNISTG+ +LAAA GAKVAK G+RS SS CGS DVL
Sbjct  94   RAVTVDAGDDVLDIVGTGGDDAGTVNISTGSCVLAAAAGAKVAKHGSRSVSSLCGSGDVL  153

Query  661  EALGVTIEL  687
            EALGV IEL
Sbjct  154  EALGVDIEL  162



>gb|ABF93754.1| Anthranilate phosphoribosyltransferase, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=385

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +++E L+     SEEEAEA+L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM
Sbjct  62   SFDKVLETLIGGDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAM  121

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
                + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSAD
Sbjct  122  IGCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSAD  181



>gb|AAO72571.1| putative phosphoribosylanthranilate transferase [Oryza sativa 
Japonica Group]
Length=320

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRG  486
            ++E L+     SEEEAEA+L  LL   +EA I+AFLVLLRAKGET+EEIVGLA+AM    
Sbjct  1    VLETLIGGDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKAMIGCC  60

Query  487  LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            + V+GLD+AVDIVGTGGDGA+TVNISTG+ ILAAA GAKVAKQG+R+SSSACGSAD
Sbjct  61   VRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSAD  116



>ref|XP_007513285.1| anthranilate phosphoribosyltransferase [Bathycoccus prasinos]
 emb|CCO16843.1| anthranilate phosphoribosyltransferase [Bathycoccus prasinos]
Length=405

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            +++IE L   +DLSE EA  +++ LL + SE  I+AFLVLLRAKGET  E+ GLARAM+ 
Sbjct  70   QKVIENLCEGKDLSENEAFEAMEALL-DASENQIAAFLVLLRAKGETSSEMAGLARAMQS  128

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            R + V   D+ +DIVGTGGD A TVNISTG+ +LAAA GAKVAK G+RS SS CGSADVL
Sbjct  129  RAVQVNAGDDVLDIVGTGGDSAGTVNISTGSCVLAAAAGAKVAKHGSRSVSSLCGSADVL  188

Query  661  EALGVTIEL  687
            EALGV +E+
Sbjct  189  EALGVAVEI  197



>emb|CEF98313.1| Glycosyl transferase, family 3 [Ostreococcus tauri]
Length=362

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            +++IE L    DLSEE A A+++ LL +  +A I+AFLVLLRAKGET  E+ GLA+AM+ 
Sbjct  27   RKVIEDLCAGVDLSEERAYAAMEALL-DADQAQIAAFLVLLRAKGETAAEMAGLAKAMQS  85

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            R + V+  D  +DIVGTGGD A TVNISTG+ +LAAA GAKVAK G+RS SS CGS DVL
Sbjct  86   RAVEVDAGDEVLDIVGTGGDDAGTVNISTGSCVLAAAAGAKVAKHGSRSVSSLCGSGDVL  145

Query  661  EALGVTIEL  687
            EALGV IEL
Sbjct  146  EALGVEIEL  154



>ref|XP_003079802.1| phosphoribosylanthranilate transferase (ISS) [Ostreococcus tauri]
Length=352

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            +++IE L    DLSEE A A+++ LL +  +A I+AFLVLLRAKGET  E+ GLA+AM+ 
Sbjct  22   RKVIEDLCAGVDLSEERAYAAMEALL-DADQAQIAAFLVLLRAKGETAAEMAGLAKAMQS  80

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            R + V+  D  +DIVGTGGD A TVNISTG+ +LAAA GAKVAK G+RS SS CGS DVL
Sbjct  81   RAVEVDAGDEVLDIVGTGGDDAGTVNISTGSCVLAAAAGAKVAKHGSRSVSSLCGSGDVL  140

Query  661  EALGVTIE  684
            EALGV I+
Sbjct  141  EALGVEID  148



>ref|WP_013943362.1| anthranilate phosphoribosyltransferase [Simkania negevensis]
 emb|CCB88895.1| Anthranilate phosphoribosyltransferase [Simkania negevensis Z]
Length=330

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            K++IE+L+N +DL+ +  E  +  ++S  +E+ ++AFLVL+R KGET +E+ G+ +AMR+
Sbjct  3    KQVIEQLINGEDLTHDVCEKVIHEMISGRNESQMAAFLVLMRQKGETADELFGIVKAMRQ  62

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            + + V      +DIVGTGGD +++VNISTGA+ILAAACG KVAK GNR+SSS CGSADVL
Sbjct  63   KMIPVPIEIPVLDIVGTGGDQSHSVNISTGASILAAACGVKVAKHGNRASSSKCGSADVL  122

Query  661  EALGVTIEL  687
            EA+G+ IEL
Sbjct  123  EAMGLPIEL  131



>ref|XP_006374528.1| hypothetical protein POPTR_0015s08990g [Populus trichocarpa]
 gb|ERP52325.1| hypothetical protein POPTR_0015s08990g [Populus trichocarpa]
Length=245

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 70/94 (74%), Gaps = 11/94 (12%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLAR  468
            IP+  ELIE L+ + DLSE EAEASLD+LL + SEA+I AFLVLLRAKGETFEE+     
Sbjct  75   IPAFNELIESLIIKVDLSESEAEASLDYLLDDASEAVIIAFLVLLRAKGETFEELS----  130

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
                   LVEGL + VDIVGTGGDGANTVNI TG
Sbjct  131  -------LVEGLADVVDIVGTGGDGANTVNIFTG  157



>ref|XP_005844184.1| hypothetical protein CHLNCDRAFT_27114, partial [Chlorella variabilis]
 gb|EFN52082.1| hypothetical protein CHLNCDRAFT_27114 [Chlorella variabilis]
Length=355

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            +++E L+ RQDLSE++   +L  L++      ++AFLVLLRAKGET EEI GLA+AMR  
Sbjct  2    QVLEVLMQRQDLSEQQTSEALQALVAGAEPTQMAAFLVLLRAKGETAEEIAGLAKAMRAL  61

Query  484  GLLV----EGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
             + V    +G    +DIVGTGGDG  +VNISTGA ++AAA GAKVAK GNRS SS CGSA
Sbjct  62   SIPVHTSYDGKCWVLDIVGTGGDGIGSVNISTGATVVAAAAGAKVAKHGNRSVSSLCGSA  121

Query  652  DVLEALGVTIEL  687
            DVLEALGV +EL
Sbjct  122  DVLEALGVAVEL  133



>ref|WP_013655737.1| anthranilate phosphoribosyltransferase [Cellulosilyticum lentocellum]
 gb|ADZ82436.1| anthranilate phosphoribosyltransferase [Clostridium lentocellum 
DSM 5427]
Length=340

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            E+ +++L  ++LS EEA  ++D+++S   SEA I ++L  LR KGET EEI G A+ MR+
Sbjct  3    EIAKKVLEGKNLSIEEATLAMDWIMSGEASEAQIGSYLTALRMKGETIEEITGSAKGMRE  62

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            + L ++G  N +DIVGTGGD  NT N+ST A+++ AA G +VAK GNRS SS CGSADVL
Sbjct  63   KCLQLKGEGNLIDIVGTGGDCTNTFNVSTVASLVVAAAGIQVAKHGNRSVSSKCGSADVL  122

Query  661  EALGVTIEL  687
            EALGV ++L
Sbjct  123  EALGVKLDL  131



>ref|WP_036748969.1| anthranilate phosphoribosyltransferase [Peptococcaceae bacterium 
SCADC1_2_3]
 gb|KFD41278.1| anthranilate phosphoribosyltransferase [Peptococcaceae bacterium 
SCADC1_2_3]
 gb|KFI36666.1| anthranilate phosphoribosyltransferase [Peptococcaceae bacterium 
SCADC1_2_3]
 gb|KFI37525.1| anthranilate phosphoribosyltransferase [Peptococcaceae bacterium 
SCADC1_2_3]
Length=337

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I R+++ QDLSEE+A+  ++ ++    S A I+AFL  LR KGET +EI G AR MR
Sbjct  3    KEAIARVVSGQDLSEEQAKQVMEIIMEGRASPAQIAAFLTALRLKGETVKEITGFARVMR  62

Query  478  KRGLLVEGLDN-AVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            ++   +    +  VD  GTGGDGANT NIST  A + A  G  VAK GNRS SS CGSAD
Sbjct  63   QKATTISSTHSLVVDTCGTGGDGANTFNISTATAFILAGAGIPVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VLEALGV ++L
Sbjct  123  VLEALGVKVDL  133



>ref|WP_032777935.1| anthranilate phosphoribosyltransferase [Streptomyces albus]
Length=354

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 12/152 (8%)
 Frame = +1

Query  238  VSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFL  414
            V++E +DR           +  EL++RLLNR DLS ++   ++D ++S  +  + ++  L
Sbjct  3    VTAEPQDR-----------NWPELLDRLLNRTDLSSQDTSWAMDEIMSGSAGHVRLAGLL  51

Query  415  VLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaac  594
            V LR+KGET +EI G+ RAM +  L ++    A+DIVGTGGDG+++VNIST +AI+AAA 
Sbjct  52   VALRSKGETVDEIEGMVRAMHRHALPLDVAGPALDIVGTGGDGSDSVNISTMSAIVAAAA  111

Query  595  gakvaKQGNRSSSSACGSADVLEALGVTIELK  690
            GA+V K GNRS+SSACGSADVLE LGV + + 
Sbjct  112  GARVVKHGNRSASSACGSADVLEELGVDLTVP  143



>ref|XP_011400011.1| Anthranilate phosphoribosyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27055.1| Anthranilate phosphoribosyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
Length=312

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  373  LLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANT  552
            +++  S   ++AFLVLLRAKGET EEI GLA+AM + GL V+   + VDIVGTGGDG  +
Sbjct  1    MIAETSPTQLAAFLVLLRAKGETAEEIAGLAQAMLELGLRVDTPHDVVDIVGTGGDGIGS  60

Query  553  VNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            VNISTGA ++AAA GA+VAK GNRS SS CGSADVLEALGVT+EL
Sbjct  61   VNISTGACVVAAAAGARVAKHGNRSVSSLCGSADVLEALGVTVEL  105



>gb|KIZ06377.1| anthranilate phosphoribosyltransferase [Monoraphidium neglectum]
Length=144

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +1

Query  403  SAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaail  582
            +AFLVLLRAKGET +EI G+ARA  + GL VE     VDIVGTGGDG  +VNISTGA+++
Sbjct  15   AAFLVLLRAKGETPDEIAGMARAFLQHGLHVETAKGVVDIVGTGGDGIGSVNISTGASVI  74

Query  583  aaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
             AA G +VAK GNRS SS CGSADVLEALGV I+L
Sbjct  75   VAAAGGRVAKHGNRSVSSLCGSADVLEALGVEIDL  109



>ref|XP_005650910.1| anthranilate phosphoribosyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26366.1| anthranilate phosphoribosyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=338

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            +++E LL ++DL+E + + +L  L+    +  ++AFLVLLRAKGET EE+ GLA+AMR++
Sbjct  2    QILEALLEQRDLTELQTQEALTALVDGAHQTQMAAFLVLLRAKGETAEEVAGLAKAMREK  61

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
             + V    + +DIVGTGGDG  +VNISTGA ++AAA GAKVAK GNRS SS CGSADVLE
Sbjct  62   SVHVATSGDVLDIVGTGGDGIGSVNISTGATVIAAAAGAKVAKHGNRSVSSLCGSADVLE  121

Query  664  ALGVTIEL  687
            ALG+ +++
Sbjct  122  ALGIAVDI  129



>ref|WP_011719802.1| anthranilate phosphoribosyltransferase [Acidothermus cellulolyticus]
 sp|A0LTH9.1|TRPD_ACIC1 RecName: Full=Anthranilate phosphoribosyltransferase [Acidothermus 
cellulolyticus 11B]
 gb|ABK52739.1| anthranilate phosphoribosyltransferase [Acidothermus cellulolyticus 
11B]
Length=355

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            PS  E++  LL R+DL+E EA  ++  ++S   ++A I+AF V LRAKGE+ EE+ GL+ 
Sbjct  6    PSWPEVLSALLARRDLTEAEAAWAMHQIMSGEATDAQIAAFAVALRAKGESAEEVSGLSS  65

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M      V  +  A+DIVG+GGD A+TVNIST AAI+AAA G  VAK GNR++SSACGS
Sbjct  66   VMLALAAPVPPIGEALDIVGSGGDRAHTVNISTMAAIVAAATGVVVAKHGNRAASSACGS  125

Query  649  ADVLEALGVTIEL  687
            AD+LEALGV I+L
Sbjct  126  ADLLEALGVAIDL  138



>ref|WP_028963703.1| anthranilate phosphoribosyltransferase [Streptomyces thermolilacinus]
Length=363

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARA  471
            S  EL+  LL R+ LS ++ + ++D ++S  +  + ++  LV LRAKGET EEI GL RA
Sbjct  12   SWPELLNALLERRSLSADDTDWAMDEVMSGAAGPVRLAGLLVALRAKGETVEEIEGLVRA  71

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M +  + ++    AVDIVGTGGDG+N+VN+ST +A++AA  GA+V K GNRS+SSACGSA
Sbjct  72   MGRHAVPLDVPGPAVDIVGTGGDGSNSVNVSTMSAVVAAGAGARVVKHGNRSASSACGSA  131

Query  652  DVLEALGVTIELK  690
            DVLE LGV + L 
Sbjct  132  DVLEELGVALSLP  144



>ref|WP_031108756.1| anthranilate phosphoribosyltransferase, partial [Streptomyces 
sp. NRRL S-146]
Length=310

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARA  471
            S   L+  LL+ +++   E E ++D ++S  +  + ++  LV LRAKGET EEI GL RA
Sbjct  11   SWPALLNSLLDLKNVPARETEWAMDQVMSGVAGPVRLAGLLVALRAKGETVEEIDGLVRA  70

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            MR+  + ++    +VDIVGTGGDG+N+VN+ST +AI+AA  G +V K GNRS+SSACGSA
Sbjct  71   MRRHAVPLDVPGPSVDIVGTGGDGSNSVNVSTMSAIVAAGAGLRVVKHGNRSASSACGSA  130

Query  652  DVLEALGVTIELK  690
            D+LE LGVT+EL 
Sbjct  131  DLLEELGVTLELP  143



>ref|XP_003059416.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56548.1| predicted protein [Micromonas pusilla CCMP1545]
Length=198

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            + +IERL +R+DL+EEE EASLD LL +   A I+AFLVLLRAKGET  E+ G+ARAM+ 
Sbjct  74   RNIIERLCDREDLTEEETEASLDALL-DADPAQIAAFLVLLRAKGETPAEMAGMARAMKG  132

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
            R + V+  D+ +DIVGTGGD A TVNISTG
Sbjct  133  RAVAVDAGDDVLDIVGTGGDDAGTVNISTG  162



>ref|WP_003985921.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Streptomyces]
 gb|ELQ78457.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus 
subsp. rimosus ATCC 10970]
 gb|KEF09340.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
 gb|KEF15412.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus 
R6-500]
 gb|KEF19786.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
Length=352

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD ++S   S A ++AFLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGALLARRDLPADSTAWALDQVMSGRASSAQLAAFLVALRAKGETAGEITGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>ref|WP_030373243.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
Length=352

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD ++S   S A ++AFLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGALLARRDLPADSTAWALDQVMSGRASSAQLAAFLVALRAKGETAGEIAGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>gb|EWC61407.1| Anthranilate phosphoribosyltransferase [Actinokineospora sp. 
EG49]
Length=356

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            PS   L+ RL+ R DL+E +   ++  ++S + + A I+ F V LRAKGET +EI G+A 
Sbjct  11   PSWPGLLNRLIERADLTEADTTWAMGQIMSGSATPAQIAGFAVALRAKGETPQEIAGMAA  70

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M     LV    +AVD+VGTGGD A+TVNIST AAI AAA G  V K GNR++SS CG+
Sbjct  71   GMLAHARLVHVDGHAVDVVGTGGDQAHTVNISTMAAITAAAAGVPVVKHGNRAASSQCGT  130

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  131  ADVLEELGVAIEL  143



>ref|WP_035283340.1| anthranilate phosphoribosyltransferase [Actinokineospora sp. 
EG49]
Length=354

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            PS   L+ RL+ R DL+E +   ++  ++S + + A I+ F V LRAKGET +EI G+A 
Sbjct  9    PSWPGLLNRLIERADLTEADTTWAMGQIMSGSATPAQIAGFAVALRAKGETPQEIAGMAA  68

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M     LV    +AVD+VGTGGD A+TVNIST AAI AAA G  V K GNR++SS CG+
Sbjct  69   GMLAHARLVHVDGHAVDVVGTGGDQAHTVNISTMAAITAAAAGVPVVKHGNRAASSQCGT  128

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV IEL
Sbjct  129  ADVLEELGVAIEL  141



>ref|WP_009066288.1| anthranilate phosphoribosyltransferase [Clostridium sp. MSTE9]
 gb|EJF38333.1| anthranilate phosphoribosyltransferase [Clostridium sp. MSTE9]
Length=341

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMR  477
            KE   +L++R+DL+ +EA A +D ++S G+  +  +AFL  L AKGET EEI   A  MR
Sbjct  3    KEATSKLIDRKDLTYDEARAVMDEIMSGGTSPVQTAAFLAALSAKGETIEEITACAAGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R L VE  D+ ++IVGTGGDG+N+ NIST ++I+ AA G +VAK GNR++SS  G+AD 
Sbjct  63   ARALPVEYTDDLLEIVGTGGDGSNSFNISTTSSIVIAAGGVRVAKHGNRAASSRSGAADC  122

Query  658  LEALGVTIEL  687
            LEALGV I L
Sbjct  123  LEALGVNISL  132



>ref|WP_042429942.1| anthranilate phosphoribosyltransferase [Clostridium sp. JCD]
Length=341

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMR  477
            KE   +L++R+DL+ +EA A +D ++S G+  +  +AFL  L AKGET EEI   A  MR
Sbjct  3    KEATSKLIDRKDLTYDEARAVMDEIMSGGTSPVQTAAFLAALSAKGETIEEITACAAGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R L VE  D+ ++IVGTGGDG+N+ NIST ++I+ AA G +VAK GNR++SS  G+AD 
Sbjct  63   ARALPVEYTDDLLEIVGTGGDGSNSFNISTTSSIVIAAGGVRVAKHGNRAASSRSGAADC  122

Query  658  LEALGVTIEL  687
            LEALGV I L
Sbjct  123  LEALGVNISL  132



>ref|WP_027719401.1| anthranilate phosphoribosyltransferase [Desulfovirgula thermocuniculi]
Length=344

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            +E I RL+ + DLSE EAE  +D ++S   + A I AFL  LR KGET  EI G ARAMR
Sbjct  3    REAIARLIAKSDLSETEAEQVMDEIMSGQATAAQIGAFLTALRLKGETAAEITGFARAMR  62

Query  478  KRGLLVEGLDN-AVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +  + V       VD  GTGGDG+ T NIST AA++ A  G  VAK GNRS SS CGSAD
Sbjct  63   RHAVQVRTRHPLVVDTCGTGGDGSGTFNISTAAALVVAGAGVPVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VLEALGV +EL
Sbjct  123  VLEALGVNLEL  133



>ref|WP_034839598.1| anthranilate phosphoribosyltransferase [[Clostridium] cellulosi]
 emb|CDZ24645.1| Anthranilate phosphoribosyltransferase [ [[Clostridium] cellulosi]
Length=339

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +L++  DL+E+EA A++D ++S   + A IS +L  LRAKGET +EI   AR MR
Sbjct  3    KEAIAKLVDGIDLTEQEACAAMDEIMSGTATPAQISGYLTALRAKGETVDEITASARVMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             + L V    +A+DIVGTGGD A T N+ST ++I+AAA G ++AK GNRS SS CG+ADV
Sbjct  63   SKALPVPEGRDAMDIVGTGGDCAFTFNVSTVSSIVAAAAGVRIAKHGNRSVSSKCGAADV  122

Query  658  LEALGVTIEL  687
            L ALGV I+L
Sbjct  123  LAALGVKIDL  132



>ref|WP_015037428.1| anthranilate phosphoribosyltransferase [Streptomyces venezuelae]
 emb|CCA59533.1| Anthranilate phosphoribosyltransferase [Streptomyces venezuelae 
ATCC 10712]
Length=354

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLAR  468
            P   +L++ LLN + LS  + E ++D ++S  +  + ++  +V LRAKGET EEI GL R
Sbjct  10   PGWPDLLDALLNGRSLSARDTEWAMDDVMSGRAGPVRLAGLMVALRAKGETVEEIEGLVR  69

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            A+ +  + +E     +DIVGTGGDG+N+VNIST +AI+AA  GA+V K GNRS+SSACGS
Sbjct  70   ALYRHAVRLEVPGPTLDIVGTGGDGSNSVNISTMSAIVAAGAGARVVKHGNRSASSACGS  129

Query  649  ADVLEALGVTIELK  690
            ADVLE LGV + L+
Sbjct  130  ADVLEELGVALRLE  143



>ref|WP_022475329.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:353]
 emb|CDE80029.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:353]
Length=543

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARA  471
            S K+ I   ++R+DL+E+EA ++++ ++ +  + A  +AFLV +R KGET +EI G A+ 
Sbjct  208  SLKKYIAMAVDRKDLTEDEAYSAMNIIMGDAATPAQTAAFLVAMRMKGETIDEITGFAKG  267

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            MR +  ++EG  +A+DIVGTGGD A T NIST ++ + AA G  VAK GNR++SS  G+A
Sbjct  268  MRSKASVIEGFRSAIDIVGTGGDMAGTFNISTTSSFVIAAAGIPVAKHGNRAASSKSGAA  327

Query  652  DVLEALGVTIE  684
            D L+ALGV I+
Sbjct  328  DCLDALGVNIK  338



>ref|WP_033014651.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
Length=352

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD ++S   S A ++ FLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGALLARRDLPADSTAWALDQVMSGRASAAQLAGFLVALRAKGETAGEITGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>ref|WP_030646800.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
Length=352

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD ++S   S A ++ FLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGALLARRDLPADSTAWALDQVMSGRASAAQLAGFLVALRAKGETAGEITGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>ref|WP_031190379.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Streptomyces]
Length=352

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD ++S   S A ++ FLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGALLARRDLPADSTAWALDQVMSGRASAAQLAGFLVALRAKGETAGEITGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>ref|WP_040196665.1| anthranilate phosphoribosyltransferase [Candidatus Soleaferrea 
massiliensis]
Length=339

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            +E I +LL+RQ+L+ EEA+A +D ++    + A I +FL  +R KGET EEI   A  MR
Sbjct  3    REAIVKLLDRQNLTLEEAKAVMDEIMQGKATNAQIGSFLTAMRMKGETIEEITACAMIMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            K    ++   + ++IVGTGGDGA T NIST +A++ AA G  VAK GNRS SS CGSADV
Sbjct  63   KLCTKLQHDRDVLEIVGTGGDGAYTFNISTVSALVIAAAGVPVAKHGNRSVSSKCGSADV  122

Query  658  LEALGVTIEL  687
            LEALGV I+L
Sbjct  123  LEALGVKIDL  132



>gb|AEG15418.1| Anthranilate phosphoribosyltransferase [Desulfotomaculum kuznetsovii 
DSM 6115]
Length=345

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I R +  Q L+E+EAE  +D +++   S A I+A L  +R KGET EEI G AR+MR
Sbjct  4    KEAISRAVAGQSLAEKEAEQVMDEIMTGQASPAQIAALLTAMRFKGETIEEITGFARSMR  63

Query  478  KRGLLVEGLDNA-VDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +    V       VD  GTGGDGANT NIST AA + A  G  VAK GNRS SS CGSAD
Sbjct  64   RHATPVRSRHPLLVDTCGTGGDGANTFNISTIAAFVLAGAGVPVAKHGNRSVSSRCGSAD  123

Query  655  VLEALGVTIEL  687
            VLEALGV +EL
Sbjct  124  VLEALGVNLEL  134



>gb|KJB53198.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=362

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  439  TFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQG  618
            +  E+VGLARAM K    VEGL++AVDIVGTGGDGANTVNISTGA+ILAAACGAKVAKQG
Sbjct  70   SINEVVGLARAMLKHAWKVEGLNDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQG  129

Query  619  NRSSSSACGSADVLEALGVTIEL  687
            NRSSSSACGSADVLEALG+ ++L
Sbjct  130  NRSSSSACGSADVLEALGIILDL  152



>ref|WP_041283323.1| anthranilate phosphoribosyltransferase [Desulfotomaculum kuznetsovii]
Length=344

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I R +  Q L+E+EAE  +D +++   S A I+A L  +R KGET EEI G AR+MR
Sbjct  3    KEAISRAVAGQSLAEKEAEQVMDEIMTGQASPAQIAALLTAMRFKGETIEEITGFARSMR  62

Query  478  KRGLLVEGLDNA-VDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +    V       VD  GTGGDGANT NIST AA + A  G  VAK GNRS SS CGSAD
Sbjct  63   RHATPVRSRHPLLVDTCGTGGDGANTFNISTIAAFVLAGAGVPVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VLEALGV +EL
Sbjct  123  VLEALGVNLEL  133



>ref|WP_022519460.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:100]
 emb|CDF46365.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:100]
Length=338

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMRK  480
            E  ++++ RQDL+  EAE  +D ++S  +EA+ ++AFL  LR KGET EEI   A+ MRK
Sbjct  4    EATKKVVERQDLTAAEAEQVMDEIMSGEAEAVNMAAFLTALRMKGETVEEITAFAKGMRK  63

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
             G+ V    + ++IVGTGGD AN++NIST A+IL AA G KVAK GNRS SS  G+AD L
Sbjct  64   HGIKVPVQGDVLEIVGTGGDEANSINISTTASILVAAAGYKVAKHGNRSVSSKSGAADCL  123

Query  661  EALGVTIELK  690
            EALGV ++L+
Sbjct  124  EALGVKLDLE  133



>dbj|GAN32571.1| anthranilate phosphoribosyltransferase component II [Candidatus 
Brocadia sinica JPN1]
Length=371

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +1

Query  286  PIPSSKELIERLLNRQDLSEEEAEASLDFLL-SNGSEALISAFLVLLRAKGETFEEIVGL  462
            P+P  KE I +L+N+Q+LS EE+  ++  ++  N ++A I++F+  LR KGET EEI G 
Sbjct  32   PMPI-KEAISKLVNKQNLSTEESLTAMTQIMEGNATDAQIASFITALRMKGETVEEITGC  90

Query  463  ARAMRKRGLLVEGLDN-AVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
              AMRK+ + ++  DN  VD  GTGGD  NT NIST AA + A  G KVAK GN++SS  
Sbjct  91   TIAMRKKVVKIKVGDNTVVDTCGTGGDAKNTFNISTAAAFVVAGAGLKVAKHGNKASSGQ  150

Query  640  CGSADVLEALGVTIE  684
            CGSADVL+ LGV IE
Sbjct  151  CGSADVLKRLGVNIE  165



>ref|WP_019853464.1| hypothetical protein [Actinopolyspora mortivallis]
Length=350

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+  +L+ RL++ Q L   E   ++D +++   + A ++AF V LRAKGET  EI+G+A 
Sbjct  6    PTWPDLLSRLVSGQPLESTETAWAMDQIMTGEATPARVAAFAVALRAKGETSSEILGMAD  65

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    L +E  + AVD+VGTGGD A TVNIST  +I+ AACGA V K GNR++SS CG+
Sbjct  66   AMIAHALPLEIPNKAVDVVGTGGDRAGTVNISTMTSIVLAACGATVVKHGNRAASSNCGT  125

Query  649  ADVLEALGVTIELK  690
            ADVLE LGV I+L 
Sbjct  126  ADVLEELGVAIDLP  139



>ref|WP_020073612.1| anthranilate phosphoribosyltransferase [[Clostridium] sporosphaeroides]
Length=341

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMR  477
            KE   +L++R+DL+  EA A +D ++S G+  +  +AFL  L AKGET EEI   A  MR
Sbjct  3    KEATSKLIDRKDLTYGEALAVMDEIMSGGTSPVQTAAFLAALSAKGETIEEITACAAGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R L VE  D+ ++IVGTGGDG+N+ NIST ++++ AA G +VAK GNR++SS  G+AD 
Sbjct  63   ARALPVEYADDLLEIVGTGGDGSNSFNISTTSSLVIAAGGVRVAKHGNRAASSRSGAADC  122

Query  658  LEALGVTIEL  687
            LEALGV I L
Sbjct  123  LEALGVNISL  132



>ref|WP_043781546.1| anthranilate phosphoribosyltransferase [Amycolatopsis rifamycinica]
 gb|KDN20850.1| anthranilate phosphoribosyltransferase [Amycolatopsis rifamycinica]
Length=344

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = +1

Query  286  PIP-SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVG  459
            P+P +   L+++L+   DLS E+   ++D ++S   S A I+ F V LRAKGET EEI G
Sbjct  4    PVPRTWPPLLKQLVAGVDLSAEDTAWAMDQIMSGAASPARIAGFAVALRAKGETPEEIAG  63

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            +A  M      VE    AVDIVGTGGDG+N+VNIST A I+ AA GA VAK GNRS+SS 
Sbjct  64   MAATMLAHARRVELDRPAVDIVGTGGDGSNSVNISTMATIVTAAAGAPVAKHGNRSASSK  123

Query  640  CGSADVLEALGVTIELK  690
             G+ADVLEALGV I L 
Sbjct  124  SGAADVLEALGVRISLP  140



>ref|WP_013224077.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei]
 ref|YP_003764400.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei 
U32]
 gb|ADJ43998.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei 
U32]
 gb|AEK40728.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei 
S699]
 gb|AFO75710.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei 
S699]
 gb|AGT82839.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei 
RB]
 gb|KDO06573.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei]
 gb|KDU92006.1| anthranilate phosphoribosyltransferase [Amycolatopsis mediterranei]
Length=344

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = +1

Query  286  PIP-SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVG  459
            P+P +   L+++L+   DLS E+   ++D ++S   S A I+ F V LRAKGET EEI G
Sbjct  4    PVPRTWPPLLKQLVAGVDLSAEDTAWAMDQIMSGAASPARIAGFAVALRAKGETPEEIAG  63

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            +A  M      VE    AVDIVGTGGDG+N+VNIST A I+ AA GA VAK GNRS+SS 
Sbjct  64   MAATMLAHARRVELDRPAVDIVGTGGDGSNSVNISTMATIVTAAAGAPVAKHGNRSASSK  123

Query  640  CGSADVLEALGVTIELK  690
             G+ADVLEALGV I L 
Sbjct  124  SGAADVLEALGVRISLP  140



>ref|WP_009884638.1| anthranilate phosphoribosyltransferase [Brevibacterium linens]
Length=373

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +1

Query  214  LVSTSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGS-  390
            +  T RT    E++D  +R+       +  +L+  L+++QDL E  A  ++D ++S  + 
Sbjct  1    MTETPRT-TPPETQDSGTRTTSEGATYNWPDLLMNLMHQQDLDESAAAWAMDQIMSGQTP  59

Query  391  EALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTG  570
            +  ++AFLV    KGET  EI GL  AM    + + GL+++VDIVGTGGD A T NIS+ 
Sbjct  60   DVTMAAFLVAHHTKGETVSEIAGLVSAMMDHAVPLPGLEDSVDIVGTGGDRAKTANISST  119

Query  571  aailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            AA++ +A G +V K GNR++SSA GSADVLEALGV  ++
Sbjct  120  AAMIISASGQRVVKHGNRATSSASGSADVLEALGVRFDI  158



>ref|WP_043717589.1| anthranilate phosphoribosyltransferase, partial [Kutzneria sp. 
744]
 gb|EWM12751.1| anthranilate phosphoribosyltransferase, partial [Kutzneria sp. 
744]
Length=336

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+  +L+  LL R+DL+ E+   ++D ++S   + A I+ F + LRAKGET +E++G+A 
Sbjct  4    PTWPDLLGALLVREDLTAEQTGWAMDQVMSGEATPAQIAGFAIALRAKGETADEVLGMAD  63

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            +M +    V+    A+DIVGTGGD A+TVNIST  AI+ AA G  V K G R+SSS CG+
Sbjct  64   SMLRHARTVDVAGRAIDIVGTGGDQAHTVNISTMTAIVTAAAGVPVVKHGARASSSKCGT  123

Query  649  ADVLEALGVTIELK  690
             DVLE LGV IEL 
Sbjct  124  GDVLEELGVAIELP  137



>ref|WP_027300024.1| anthranilate phosphoribosyltransferase [Rhodospirillales bacterium 
URHD0088]
Length=345

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K LI R+   + LSE++A  + D ++S N + A +  FL+ LR +GET +EI G AR MR
Sbjct  5    KTLIGRVAAGERLSEDDAATAFDVMMSGNATPAQMGGFLMALRVRGETVDEITGAARTMR  64

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             + L +E   +A D  GTGGDG+ T NIST  AI+ A  G  +AK GNR+ SS CGSADV
Sbjct  65   AKALRIEAPPDAFDTAGTGGDGSGTFNISTATAIVLAGAGVPMAKHGNRNLSSHCGSADV  124

Query  658  LEALGVTIE  684
            L ALGV I+
Sbjct  125  LAALGVNID  133



>ref|WP_016455499.1| anthranilate phosphoribosyltransferase [Propionimicrobium lymphophilum]
 gb|EPD33124.1| anthranilate phosphoribosyltransferase [Propionimicrobium lymphophilum 
ACS-093-V-SCH5]
Length=360

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+  +L+  L+N +D+++E    ++  +LS N S A+++ F+V LRAKGE  EE+ GLA 
Sbjct  14   PTWPDLLTSLINGEDMTQENTAWAMSEILSGNVSPAIMAGFMVALRAKGEIVEEVAGLAD  73

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M  +   +E   NAVDIVG+GGD ANTVNIST AA++AAA GAKV K GNR++SS CG+
Sbjct  74   GMLAKARPIELSRNAVDIVGSGGDRANTVNISTMAAVVAAASGAKVIKHGNRAASSMCGT  133

Query  649  ADVLEALGVTI  681
            AD LEALG+ +
Sbjct  134  ADCLEALGLEL  144



>gb|KHF45379.1| anthranilate phosphoribosyltransferase [Saccharomonospora viridis]
Length=350

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = +1

Query  262  CSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGE  438
            C R ++ +P  +   ++ +L+ R DLSE+  E ++D ++S   + A I+ F V LRAKGE
Sbjct  3    CRRPEMNMPEYTWPTVLNQLIERVDLSEDATEWAMDQVMSGEATPAQIAGFAVALRAKGE  62

Query  439  TFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQG  618
            T  EI G+ARAM      V+    AVDIVGTGGD   +VNIST  +++ AA G  V K G
Sbjct  63   TAAEISGMARAMLHHANRVDLDVRAVDIVGTGGDRKGSVNISTMTSLVVAASGTPVVKHG  122

Query  619  NRSSSSACGSADVLEALGVTIE  684
             R++SS  G+ADVLEALG+TIE
Sbjct  123  GRAASSKSGAADVLEALGITIE  144



>ref|WP_040161788.1| anthranilate phosphoribosyltransferase [bacterium SIT7]
Length=349

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARA  471
            +  +++  +L   DL +  AE +++ +LS N +   I+ F+V LR KGET EEI GLA A
Sbjct  5    TWPDVLTSILEGHDLDKASAEWAMNEVLSGNATPVQIAGFMVALRGKGETVEEISGLADA  64

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M    L ++   +AVDIVG+GGD ANTVNIST AAI+AAA GA++ K GNR++SSACG+A
Sbjct  65   MLANALPIDLPTDAVDIVGSGGDRANTVNISTMAAIVAAAAGARIVKHGNRAASSACGTA  124

Query  652  DVLEALGVTIELK  690
            DVLE LG+ ++L 
Sbjct  125  DVLEELGIVLDLP  137



>ref|WP_028821925.1| anthranilate phosphoribosyltransferase [Propionimicrobium lymphophilum]
Length=360

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+  +L+  L+N +D+++E    ++  +LS N S A+++ F+V LRAKGE  EE+ GLA 
Sbjct  14   PTWPDLLTSLINGEDMTQENTAWAMSEILSGNVSPAIMAGFMVALRAKGEIVEEVAGLAD  73

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M  +   +E   NAVDIVG+GGD ANTVNIST AA++AAA GAKV K GNR++SS CG+
Sbjct  74   GMLAKARPIELSRNAVDIVGSGGDRANTVNISTMAAVVAAASGAKVIKHGNRAASSMCGT  133

Query  649  ADVLEALGVTI  681
            AD LEALG+ +
Sbjct  134  ADCLEALGLEL  144



>ref|WP_024110454.1| anthranilate phosphoribosyltransferase [Propionimicrobium sp. 
BV2F7]
 gb|ETJ98554.1| anthranilate phosphoribosyltransferase [Propionimicrobium sp. 
BV2F7]
Length=360

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+  +L+  L+N +D+++E    ++  +LS N S A+++ F+V LRAKGE  EE+ GLA 
Sbjct  14   PTWPDLLTSLINGEDMTQENTAWAMSEILSGNVSPAIMAGFMVALRAKGEIVEEVAGLAD  73

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
             M  +   +E   NAVDIVG+GGD ANTVNIST AA++AAA GAKV K GNR++SS CG+
Sbjct  74   GMLAKARPIELSRNAVDIVGSGGDRANTVNISTMAAVVAAASGAKVIKHGNRAASSMCGT  133

Query  649  ADVLEALGVTI  681
            AD LEALG+ +
Sbjct  134  ADCLEALGLEL  144



>ref|WP_027360272.1| anthranilate phosphoribosyltransferase [Desulforegula conservatrix]
Length=336

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = +1

Query  310  IERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMRKRG  486
            +++L++R DLSE E    ++F+ S  + ++ I+AF+  +  KGETFEE+ G AR+MR R 
Sbjct  6    LKKLISRVDLSENETADIMNFIFSGHATSIQIAAFMAAMATKGETFEELAGAARSMRSRA  65

Query  487  LLVEGLDN-AVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
              ++ +    VD  GTGGDGA T NIST +A + A  GA VAK GNRS SS CGSADVLE
Sbjct  66   KRIQVIKKPVVDTCGTGGDGAQTFNISTASAFVVAGAGAVVAKHGNRSVSSKCGSADVLE  125

Query  664  ALGVTIE  684
            ALGV +E
Sbjct  126  ALGVNLE  132



>ref|WP_015561942.1| anthranilate phosphoribosyltransferase [Megamonas hypermegale]
 ref|YP_007834279.1| anthranilate phosphoribosyltransferase [Megamonas hypermegale 
ART12/1]
 emb|CBL05642.1| anthranilate phosphoribosyltransferase [Megamonas hypermegale 
ART12/1]
Length=241

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I +L N+QDL+ E+A  S+  ++S   S   I++FL  LR KGET +EI   A+ MR
Sbjct  3    KQAIYQLSNKQDLTTEQAIVSMQEIMSGTASNIQIASFLTALRLKGETIDEITAFAQVMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            ++   ++  D+  +IVGTGGD ANT NIST A  + +A G KVAK GNRS SS CG+AD 
Sbjct  63   EKAQSIDYKDDLFEIVGTGGDEANTFNISTTAGFVISASGIKVAKHGNRSVSSKCGAADC  122

Query  658  LEALGVTIEL  687
            LEALG  +EL
Sbjct  123  LEALGTKLEL  132



>ref|WP_030665748.1| anthranilate phosphoribosyltransferase [Streptomyces rimosus]
Length=352

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   ++  LL R+DL  +    +LD +++   + A ++ FLV LRAKGET  EI GL R
Sbjct  8    PTWPGVLGTLLARRDLPADSTAWALDQVMTGQATGAQLAGFLVALRAKGETAGEITGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    + ++     +DIVGTGGDG+++VN+ST +A++AAA GA+V K GNRS+SSACGS
Sbjct  68   AMYAHAVPLDVPGPTLDIVGTGGDGSDSVNVSTMSAVVAAAAGARVVKHGNRSASSACGS  127

Query  649  ADVLEALGVTIEL  687
            ADVLE LGV +EL
Sbjct  128  ADVLEELGVVLEL  140



>ref|WP_022228818.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:41]
 emb|CDB94013.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:41]
Length=337

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLL-SNGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KEL++++   Q+L+ EEA  ++D +L    S  L+SAFL  LR KGET +EIVG    M+
Sbjct  2    KELLKKVTEGQNLTREEAAKAMDMMLEGTASPVLVSAFLTALRMKGETVDEIVGCTEMMK  61

Query  478  KRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             +G  V+ G D  +D VGTGGDGAN+ NIST +  + AA G  VAK GNR++SS  G++D
Sbjct  62   SKGGSVKLGTDEYIDFVGTGGDGANSFNISTTSMFVCAAAGVTVAKHGNRAASSKSGASD  121

Query  655  VLEALGVTIELK  690
            +LEALG  I L+
Sbjct  122  LLEALGANIMLE  133



>ref|WP_008514408.1| anthranilate phosphoribosyltransferase [Dethiobacter alkaliphilus]
 gb|EEG78491.1| anthranilate phosphoribosyltransferase [Dethiobacter alkaliphilus 
AHT 1]
Length=344

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KEL+ +L    DL+E EA++++  ++    + A ++AFLV L+ KGET  EI G A+AMR
Sbjct  2    KELLNKLCLGTDLTEMEAQSAMASIMDGEATPAQVAAFLVALKMKGETAGEIYGCAKAMR  61

Query  478  KRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +R   V+ G  N  D  GTGGDG  T NIST AA++AA  G  VAK GNRS SS CGSAD
Sbjct  62   QRSQKVQSGRANLTDTCGTGGDGRGTFNISTAAALIAAGAGLAVAKHGNRSVSSKCGSAD  121

Query  655  VLEALGVTIEL  687
            VLEALGVT+EL
Sbjct  122  VLEALGVTLEL  132



>ref|WP_033263633.1| anthranilate phosphoribosyltransferase [Amycolatopsis vancoresmycina]
Length=344

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 91/137 (66%), Gaps = 2/137 (1%)
 Frame = +1

Query  286  PIP-SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVG  459
            P+P +   L+++L+   DLS E+   ++D ++S   S A I+ F V LRAKGET EEI G
Sbjct  4    PVPRTWPPLLKQLIAGADLSAEDTAWAMDQIMSGAASPARIAGFAVALRAKGETPEEIAG  63

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            +A  M      VE    AVDIVGTGGDG+N+VNIST A I+ AA GA VAK GNRS+SS 
Sbjct  64   MAATMLAHARRVELDRPAVDIVGTGGDGSNSVNISTMATIVTAAAGAPVAKHGNRSASSK  123

Query  640  CGSADVLEALGVTIELK  690
             G+ADVLE LGV I L 
Sbjct  124  SGAADVLETLGVRISLP  140



>ref|WP_032767739.1| anthranilate phosphoribosyltransferase [Streptomyces sp. CNS654]
Length=352

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARA  471
            S  +L++ LL+ + L+  + E ++D ++S  +  + ++  +V LRAKGET EEI GL RA
Sbjct  9    SWPDLLDALLDGRSLTARDTEWAMDDVMSGRAGPVRLAGLMVALRAKGETVEEIEGLVRA  68

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            + +  + +E    A+DIVGTGGDG+N+VNIST +AI+AA  GA+V K GNRS+SSACGSA
Sbjct  69   LYRHAVRLEVPGPALDIVGTGGDGSNSVNISTMSAIVAAGAGARVVKHGNRSASSACGSA  128

Query  652  DVLEALGVTIELK  690
            DVLE LGV + L+
Sbjct  129  DVLEELGVALSLE  141



>ref|WP_015099058.1| Anthranilate phosphoribosyltransferase [Saccharothrix espanaensis]
 emb|CCH28945.1| Anthranilate phosphoribosyltransferase [Saccharothrix espanaensis 
DSM 44229]
Length=351

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMRK-  480
            L+ +L++R DLSE +   ++D ++S   + A +  F V LRAKGET EE+ GLA AM K 
Sbjct  9    LLNQLIDRVDLSEGDTSWAMDQIMSGAATPAQVGGFAVALRAKGETPEEVDGLASAMLKH  68

Query  481  -RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R   VEG   A DIVGTGGD +++VNIST AAI+ AA G  + K GNR++SS CG+ADV
Sbjct  69   ARRFTVEG--RAADIVGTGGDNSHSVNISTMAAIVTAAAGVPIVKHGNRAASSKCGTADV  126

Query  658  LEALGVTIELK  690
            LEALGV I+L 
Sbjct  127  LEALGVAIDLP  137



>ref|WP_022165345.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:192]
 emb|CDB12932.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:192]
Length=336

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGS-EALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE IE+L+N+QDL+ +EA+  ++ ++S  + + LISA+LV LR KGET EEI G A+ MR
Sbjct  3    KEAIEKLVNKQDLTFDEAKEVMNEIMSGETPDTLISAYLVALRMKGETIEEISGSAKGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
              G  +      ++IVGTGGD ANT N+ST +A +AAA G KVAK GNR  SS  G+ADV
Sbjct  63   DNGTKLSHDMEVLEIVGTGGDKANTFNVSTTSAFVAAAAGCKVAKHGNRGVSSKSGAADV  122

Query  658  LEALGVTI  681
            LEALG  I
Sbjct  123  LEALGANI  130



>ref|WP_016640529.1| putative Anthranilate phosphoribosyltransferase [Streptomyces 
aurantiacus]
 gb|EPH44546.1| putative Anthranilate phosphoribosyltransferase [Streptomyces 
aurantiacus JA 4570]
Length=352

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLA  465
            +P+  +++  LL  Q+L+ EE+  ++D ++S +  +A ++ FLV LRAKGE+ +EI G+A
Sbjct  7    VPTWPDVLTTLLRGQNLTAEESAWAMDQVMSGSAGDARLAGFLVALRAKGESADEIEGMA  66

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            RA+ +  + +      +DIVGTGGDG ++VN+ST +A++AA  GA+V K GNRS+SSACG
Sbjct  67   RALYEHAVRLNVPGPTLDIVGTGGDGTHSVNVSTMSAVVAAGAGARVVKHGNRSASSACG  126

Query  646  SADVLEALGVTIEL  687
            SADVLE LG+ + L
Sbjct  127  SADVLEELGLALTL  140



>ref|WP_021683455.1| anthranilate phosphoribosyltransferase [Ruminococcus callidus]
 gb|ERJ94712.1| anthranilate phosphoribosyltransferase [Ruminococcus callidus 
ATCC 27760]
Length=544

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I ++ + +DL+E EA+ ++D ++S + + A I+  LV LR KGET  EI G A+ MR
Sbjct  209  KKYIAQVTDGKDLTEAEAQDAMDIIMSGSATNAQIAGLLVALRMKGETIAEITGFAKGMR  268

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            ++   V G +N+++IVGTGGD AN+ NIST ++ + +A G  VAK GNRS SS  G+ADV
Sbjct  269  QKAKHVTGCENSIEIVGTGGDLANSFNISTTSSFVISAAGMPVAKHGNRSVSSKSGAADV  328

Query  658  LEALGVTIE  684
            LE+LGV I+
Sbjct  329  LESLGVKIQ  337



>ref|WP_013625962.1| anthranilate phosphoribosyltransferase [Syntrophobotulus glycolicus]
 gb|ADY57142.1| anthranilate phosphoribosyltransferase [Syntrophobotulus glycolicus 
DSM 8271]
Length=343

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLL-SNGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE+I +L   ++L+ EEA ++++ ++    ++A I AFL+ LR KGE+ EEI G AR MR
Sbjct  3    KEIIAKLAGLENLTAEEAASAMNEIMEGEATQAQIGAFLIALRMKGESIEEITGCARVMR  62

Query  478  KRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            ++   V      A+DIVGTGGD ANT NIST +A + AA G  VAK GNRS SS CGSAD
Sbjct  63   EKADRVAINRAEAIDIVGTGGDCANTFNISTCSAFIVAAAGVPVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VLEALG  I L
Sbjct  123  VLEALGTNITL  133



>ref|WP_022260177.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:251]
 emb|CDC33185.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:251]
Length=336

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KEL+ ++  +QDL+ +EA+ ++D ++S   SEA+IS+FL  L  KGET EEI G A  MR
Sbjct  3    KELLAKVSAKQDLTFDEAKQAIDEIMSGEVSEAVISSFLTALAMKGETEEEIAGAATGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             + +      +A+DIVGTGGD +N+ NIST +A +AAA G  + K GNR++SS CG+AD 
Sbjct  63   SKAMEFNIGGHALDIVGTGGDKSNSFNISTTSAFVAAAAGVTIVKHGNRAASSKCGTADC  122

Query  658  LEALGVTIE  684
            LEALGV I+
Sbjct  123  LEALGVKID  131



>ref|WP_018999930.1| anthranilate phosphoribosyltransferase [Megamonas rupellensis]
Length=337

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I +L N+QDL+ E+A  S+  ++S   S+  I++FL  LR KGET +EI   A+ MR
Sbjct  3    KQAIYQLSNKQDLTTEQAIVSMQEIMSGTASDIQIASFLTALRLKGETIDEITAFAQVMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            ++   ++  D+  +IVGTGGD ANT NIST A  + +A G KVAK GNRS SS CG+AD 
Sbjct  63   EKAQSIDYKDDLFEIVGTGGDEANTFNISTTAGFVISASGIKVAKHGNRSVSSKCGAADC  122

Query  658  LEALGVTIEL  687
            LEALG  +EL
Sbjct  123  LEALGTKLEL  132



>ref|WP_013559022.1| anthranilate phosphoribosyltransferase [Anaerolinea thermophila]
 dbj|BAJ62627.1| anthranilate phosphoribosyltransferase [Anaerolinea thermophila 
UNI-1]
Length=338

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K  I +++N Q LS +EAE +++ +++   + A I  +LV LR KGET EEI G ARAMR
Sbjct  3    KPYIAKVMNFQSLSAQEAEEAMNIIMNGEATPAQIGGYLVALRMKGETVEEITGSARAMR  62

Query  478  KRGLLVEGLDNA-VDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
                 V+      +D  GTGGDGA+T NIST AA + A  G KVAK GNR++SS CGSAD
Sbjct  63   AHASRVKVQSTPLIDTAGTGGDGAHTFNISTAAAFVIAGTGRKVAKHGNRAASSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VL+ALGV I L
Sbjct  123  VLDALGVRINL  133



>ref|WP_040894403.1| hypothetical protein [[Bacteroides] pectinophilus]
Length=544

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I    + ++L+E+EA A+++ ++ +  ++A  SAFL+ +R KGET EEI G A+ MR
Sbjct  210  KKYIALAADGKNLTEDEAYAAMNIIMGDAATKAQTSAFLMAMRMKGETIEEITGFAKGMR  269

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             +  +++G  +AVDIVGTGGD A T NIST ++ + AA G  VAK GNR++SS  G+AD 
Sbjct  270  NKASIIKGFRSAVDIVGTGGDMAGTFNISTTSSFVIAAAGIPVAKHGNRAASSKSGAADC  329

Query  658  LEALGVTIEL  687
            L+ALGV I+L
Sbjct  330  LDALGVNIKL  339



>ref|WP_022362252.1| anthranilate phosphoribosyltransferase [Bacteroides pectinophilus 
CAG:437]
 emb|CDD58455.1| anthranilate phosphoribosyltransferase [Bacteroides pectinophilus 
CAG:437]
Length=544

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I    + ++L+E+EA A+++ ++ +  ++A  SAFL+ +R KGET EEI G A+ MR
Sbjct  210  KKYIALAADGKNLTEDEAYAAMNIIMGDAATKAQTSAFLMAMRMKGETIEEITGFAKGMR  269

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             +  +++G  +AVDIVGTGGD A T NIST ++ + AA G  VAK GNR++SS  G+AD 
Sbjct  270  NKASIIKGFRSAVDIVGTGGDMAGTFNISTTSSFVIAAAGIPVAKHGNRAASSKSGAADC  329

Query  658  LEALGVTIEL  687
            L+ALGV I+L
Sbjct  330  LDALGVNIKL  339



>gb|EEC58469.1| anthranilate phosphoribosyltransferase [[Bacteroides] pectinophilus 
ATCC 43243]
Length=551

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I    + ++L+E+EA A+++ ++ +  ++A  SAFL+ +R KGET EEI G A+ MR
Sbjct  217  KKYIALAADGKNLTEDEAYAAMNIIMGDAATKAQTSAFLMAMRMKGETIEEITGFAKGMR  276

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             +  +++G  +AVDIVGTGGD A T NIST ++ + AA G  VAK GNR++SS  G+AD 
Sbjct  277  NKASIIKGFRSAVDIVGTGGDMAGTFNISTTSSFVIAAAGIPVAKHGNRAASSKSGAADC  336

Query  658  LEALGVTIEL  687
            L+ALGV I+L
Sbjct  337  LDALGVNIKL  346



>ref|WP_012201841.1| anthranilate phosphoribosyltransferase [Lachnoclostridium phytofermentans]
 sp|A9KL44.1|TRPD_CLOPH RecName: Full=Anthranilate phosphoribosyltransferase [Lachnoclostridium 
phytofermentans ISDg]
 gb|ABX44193.1| anthranilate phosphoribosyltransferase [Lachnoclostridium phytofermentans 
ISDg]
Length=336

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 86/131 (66%), Gaps = 3/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +L+N++DLS E AE  +D ++S   S  LI ++L  LR KGET +EI   A  MR
Sbjct  3    KEAIYQLVNKEDLSYEVAEQVMDEIMSGEASNVLIGSYLTALRMKGETIDEITASAAGMR  62

Query  478  KRGL-LVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            K  + L+  +D  ++IVGTGGD ANT NIST    + +A G  VAK GNR  SS CG+AD
Sbjct  63   KHCVRLLHNMD-VLEIVGTGGDEANTFNISTTTGFVVSAAGIPVAKHGNRCVSSKCGAAD  121

Query  655  VLEALGVTIEL  687
            VLEALGV I L
Sbjct  122  VLEALGVNIML  132



>ref|WP_020565440.1| anthranilate phosphoribosyltransferase [Methylosarcina fibrata]
Length=339

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ +++LL++Q+L+ EE  + +  ++S G ++A I  FLV LR KGET +E+V  A  +R
Sbjct  4    QQALQKLLDKQNLTAEEMHSVMRQIMSGGATDAQIGGFLVALRCKGETVDEMVSAAEVIR  63

Query  478  KRGLLVEGL-DNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +    V  + D+ VD  GTGGDGANT NIST  A + AA G +VAK GNRS SS CGSAD
Sbjct  64   ELAGKVPVVGDHVVDTCGTGGDGANTFNISTACAFVVAAAGGQVAKHGNRSVSSCCGSAD  123

Query  655  VLEALGVTIEL  687
            VLEA GV +EL
Sbjct  124  VLEAAGVNLEL  134



>ref|WP_033427463.1| anthranilate phosphoribosyltransferase [Saccharothrix syringae]
Length=353

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            L+ RL++R DLS+E+   ++D +++   + A + AFLV LRAKGET EE+ GLA  M   
Sbjct  11   LLNRLIDRADLSDEDTAWAMDQVMTGAATPAQVGAFLVALRAKGETPEEVDGLATMMLHH  70

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
                +      DIVGTGGD + +VNIST A ++ AA G  V K GNR++SS CG+ADVLE
Sbjct  71   ARRFDVAGRVADIVGTGGDQSGSVNISTMATLVTAAAGVPVVKHGNRAASSQCGTADVLE  130

Query  664  ALGVTIELK  690
            ALGV I+L 
Sbjct  131  ALGVAIDLP  139



>ref|WP_030286126.1| anthranilate phosphoribosyltransferase [Streptomyces catenulae]
Length=360

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 93/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLAR  468
            P   E++  LL+ ++L   E E ++D ++S  +  + ++  LV LRAKGET EEI GL R
Sbjct  8    PHWSEMLNALLDGRNLPAAETERAMDAVMSGAAGPVRLAGLLVALRAKGETVEEIEGLVR  67

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            + R+  + ++     VDIVGTGGDG+++VN+ST +A++AA  GA+V K GNR++SSACGS
Sbjct  68   SARRHAVPLDVPGPVVDIVGTGGDGSHSVNVSTMSAVVAAGAGARVVKHGNRAASSACGS  127

Query  649  ADVLEALGVTIELK  690
            ADVLE LGV + L 
Sbjct  128  ADVLEELGVALTLP  141



>ref|WP_020644669.1| anthranilate phosphoribosyltransferase [Amycolatopsis balhimycina]
Length=344

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = +1

Query  286  PIP-SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVG  459
            P+P +   L+++L+   DLS E+   ++D ++S   S A I+ F V LRAKGET EEI G
Sbjct  4    PVPRTWPPLLKQLIAGADLSAEDTAWAMDQIMSGAASPARIAGFAVALRAKGETPEEIAG  63

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            +A  M      VE    AVDIVGTGGDG+N+VNIST AAI+ AA GA VAK GNRS+SS 
Sbjct  64   MAATMLAHARRVELDRPAVDIVGTGGDGSNSVNISTMAAIVTAAAGAPVAKHGNRSASSK  123

Query  640  CGSADVLEALGVTIELK  690
             G+ADVLE LGV I L 
Sbjct  124  SGAADVLETLGVRISLP  140



>ref|WP_031506531.1| anthranilate phosphoribosyltransferase [Streptomyces megasporus]
Length=354

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLL-SNGSEALISAFLVLLRAKGETFEEIVGLARA  471
            +  +++  LL  +DLS +    ++D ++    ++A I+ F V LRAKGET +E+VG+ RA
Sbjct  16   TWPDVLSALLAGEDLSADSTAWAMDRIMRGEATDAQIAGFAVALRAKGETVDEVVGMVRA  75

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M     ++E    +VDIVGTGGD A TVNIST ++I+ A  GAKV K GNR++SSACG+A
Sbjct  76   MYGHAKVIEVPGPSVDIVGTGGDRARTVNISTMSSIVVAGTGAKVVKHGNRAASSACGTA  135

Query  652  DVLEALGVTIEL  687
            DVLE LGV ++L
Sbjct  136  DVLEKLGVNLDL  147



>ref|WP_029089260.1| anthranilate phosphoribosyltransferase [Brevibacterium album]
Length=350

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARA  471
            S  +L+  L+  +D+ EE A  ++D ++S    +  ++AFLV    KGET EEI GL R+
Sbjct  7    SWPDLLVGLMAGRDMDEETAAWAMDGIMSGEVPDVTMAAFLVAHHGKGETVEEISGLVRS  66

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M +  + + GL +AVDIVGTGGD A TVNIS+ A+ + AA G  + K GNR++SSA GSA
Sbjct  67   MFEHAVPLPGLSHAVDIVGTGGDRARTVNISSTASFVIAASGQPLVKHGNRATSSASGSA  126

Query  652  DVLEALGVTIEL  687
            DVLE LG+T++L
Sbjct  127  DVLEELGLTLDL  138



>ref|WP_012174987.1| anthranilate phosphoribosyltransferase [Desulfococcus oleovorans]
 sp|A8ZZX1.1|TRPD_DESOH RecName: Full=Anthranilate phosphoribosyltransferase [Desulfococcus 
oleovorans Hxd3]
 gb|ABW67371.1| anthranilate phosphoribosyltransferase [Desulfococcus oleovorans 
Hxd3]
Length=339

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASL-DFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            + + +++NR+DLS EE +    D    N ++A I AF+  L  KGETFEE+ G A AMR+
Sbjct  4    QTLSKIINRKDLSREEMDRIFSDIFSGNLTDAQIGAFMAALATKGETFEELAGAAEAMRR  63

Query  481  RGLLVEGLDNAV-DIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            +   ++     V D  GTGGDGA+T NIST +A + A  G  VAK GNRS SS CGSADV
Sbjct  64   KATRIQAASPVVVDTCGTGGDGAHTFNISTTSAFVVAGAGICVAKHGNRSVSSKCGSADV  123

Query  658  LEALGVTIELK  690
            LEALGV ++ +
Sbjct  124  LEALGVKLDTQ  134



>ref|WP_030360044.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Streptomyces]
Length=354

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGS-EALISAFLVLLRAKGETFEEIVGLARAMR  477
             EL+  LL+R+DLS  E   ++D ++S  +  A ++  +V LRAKGET EEI GL  AM 
Sbjct  12   PELLNALLSRRDLSAAETAWAMDQVMSGAAGPARLAGLMVALRAKGETAEEIDGLVDAMY  71

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +      +DIVGTGGDG+++VNIST +A++AA  GA+V K GNRS+SSACGSADV
Sbjct  72   AHAVPLSVPGPTLDIVGTGGDGSHSVNISTMSAVVAAGAGARVVKHGNRSASSACGSADV  131

Query  658  LEALGVTIELK  690
            LE LGV ++L 
Sbjct  132  LEELGVALDLP  142



>ref|XP_008367540.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Malus domestica]
Length=333

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  451  IVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSS  630
            IVGLA+AM K  L +EGL + VDIVGTGGDGANTVNISTGAAILA ACGAKVAKQGNRSS
Sbjct  45   IVGLAKAMMKHSLKIEGLGDVVDIVGTGGDGANTVNISTGAAILATACGAKVAKQGNRSS  104

Query  631  SSACGSADVLEALGVTIEL  687
            SSACGSADVL+ALG+ I+L
Sbjct  105  SSACGSADVLDALGIIIDL  123



>ref|WP_030666446.1| anthranilate phosphoribosyltransferase [Streptomyces cellulosae]
Length=351

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +1

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGS-EALISAFLVLLRAKGETFEEIVG  459
            + + +  +L+  LL+R DLS  + E ++D  +S  +  A ++A ++ LRAKGET  E+ G
Sbjct  1    MAVETWPQLLNALLDRNDLSTAQTEWAMDEAMSGAAGPARLAALMMGLRAKGETAAEVEG  60

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
            LAR M +  + +      +DIVGTGGDG+++VNIST +A++AA  G +V K GNRS+SSA
Sbjct  61   LARGMLRHAVPLTVPGRCLDIVGTGGDGSHSVNISTMSALVAAGAGVRVVKHGNRSASSA  120

Query  640  CGSADVLEALGVTIELK  690
            CGSADVLE LGV+++L 
Sbjct  121  CGSADVLEELGVSLDLP  137



>ref|WP_027356811.1| anthranilate phosphoribosyltransferase [Desulfotomaculum thermocisternum]
Length=344

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I R++  + LSE EAE  +D +++   S A I+A L  +R KGET EEI G AR+MR
Sbjct  3    KEAIGRVVAGESLSESEAERVMDEIMTGQASPAQIAALLTAMRLKGETIEEITGFARSMR  62

Query  478  KRGLLVEGLDNAV-DIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +    V      V D  GTGGDGA T NIST AA++ A  G  VAK GNRS SS CGSAD
Sbjct  63   RHATPVRSRHPVVVDTCGTGGDGAGTFNISTIAALVLAGAGVPVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            VLEALGV +EL
Sbjct  123  VLEALGVNLEL  133



>ref|XP_005792526.1| hypothetical protein EMIHUDRAFT_439707 [Emiliania huxleyi CCMP1516]
 gb|EOD40097.1| hypothetical protein EMIHUDRAFT_439707 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            K+ IE L+ RQDL+ +++ A+ + +++       +A LVLLR+KGET  E+ G+ R MR+
Sbjct  2    KDTIETLVQRQDLTLDQSAAAAEAIIAGADPCQAAALLVLLRSKGETPAEVAGMVRTMRR  61

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
              L V      +DIVGTGGDG +TVNIST A+++AAACGA VAK GNRS SS CGSADVL
Sbjct  62   HMLTVSPARPCIDIVGTGGDGHHTVNISTAASVVAAACGAAVAKHGNRSVSSKCGSADVL  121

Query  661  EALGVTIELK  690
            E +GV++ L 
Sbjct  122  EEVGVSLALP  131



>ref|WP_011457991.1| anthranilate phosphoribosyltransferase [Chlamydophila felis]
 sp|Q254S7.1|TRPD_CHLFF RecName: Full=Anthranilate phosphoribosyltransferase [Chlamydophila 
felis Fe/C-56]
 dbj|BAE81211.1| anthranilate phosphoribosyltransferase [Chlamydophila felis Fe/C-56]
Length=343

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            +  ++ ++N+  L+ +EAE+  + +L+      I+AFL +L+ +GET  EI G+  A++K
Sbjct  3    QTYLQSIMNQSHLTYDEAESVTNLMLNGSDPHQIAAFLAVLKYRGETPTEIAGMVSALQK  62

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            +   V+    A+DIVGTGGD ANTVNISTG+AIL+AACG  +AK GNRS SS  GSADVL
Sbjct  63   QATSVDLPFPALDIVGTGGDLANTVNISTGSAILSAACGIPIAKHGNRSVSSQSGSADVL  122

Query  661  EALGVTIEL  687
            EALG+ IE+
Sbjct  123  EALGIEIEM  131



>ref|XP_005780664.1| hypothetical protein EMIHUDRAFT_442980 [Emiliania huxleyi CCMP1516]
 gb|EOD28235.1| hypothetical protein EMIHUDRAFT_442980 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            K+ IE L+ RQDL+ +++ A+ + +++       +A LVLLR+KGET  E+ G+ R MR+
Sbjct  2    KDTIEALVQRQDLTLDQSAAAAEAIIAGADPCQAAALLVLLRSKGETPAEVAGMVRTMRR  61

Query  481  RGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
              L V      +DIVGTGGDG +TVNIST A+++AAACGA VAK GNRS SS CGSADVL
Sbjct  62   HMLTVSPARPCIDIVGTGGDGHHTVNISTAASVVAAACGAAVAKHGNRSVSSKCGSADVL  121

Query  661  EALGVTIELK  690
            E +GV++ L 
Sbjct  122  EEVGVSLALP  131



>ref|WP_022050731.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:254]
 emb|CCZ83928.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:254]
Length=544

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +1

Query  313  ERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMRKRGL  489
            E++LN  +L+E EA  ++D ++SN +  + I+ FL  LR KGET EEI G A+ MR +  
Sbjct  213  EKVLNGGNLTETEAMEAMDLIMSNAATDIQIAEFLTALRMKGETIEEITGFAKGMRAKAK  272

Query  490  LVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEAL  669
             V    +A+DIVGTGGD +N+ NIST +A + AA GAKVAK GNRS SS  G+ADVLE L
Sbjct  273  TVPNCKDAIDIVGTGGDCSNSFNISTTSAFIIAAAGAKVAKHGNRSVSSKSGAADVLERL  332

Query  670  GVTIE  684
            GV I+
Sbjct  333  GVKIQ  337



>ref|WP_022228324.1| anthranilate phosphoribosyltransferase [Megamonas funiformis 
CAG:377]
 emb|CDB97911.1| anthranilate phosphoribosyltransferase [Megamonas funiformis 
CAG:377]
Length=337

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I +L N+QDL+ E+A  S+  ++S   S+  I++FL  LR KGET +EI   A+ MR
Sbjct  3    KQAIYQLSNKQDLTTEQAIVSMQEIMSGTASDIQIASFLTALRLKGETIDEITVFAQVMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            ++   ++  D+  +IVGTGGD ANT NIST A  + +A G KVAK GNRS SS CG+AD 
Sbjct  63   EKAQSIDYKDDLFEIVGTGGDEANTFNISTTAGFVISASGIKVAKHGNRSVSSKCGAADC  122

Query  658  LEALGVTIEL  687
            LEALG  +EL
Sbjct  123  LEALGTKLEL  132



>ref|WP_013719039.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii]
 ref|YP_004383808.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii 
GP6]
 gb|AEB67990.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii 
GP6]
Length=341

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRG  486
             +++++  QDLS EE+EA +D + +  S+A+I A LV LR KGE+  EI G AR MR+  
Sbjct  3    YLQKIMEGQDLSLEESEALMDEIFNKASDAMIGAVLVALRRKGESVSEIAGFARKMRESA  62

Query  487  LLVEGLDNA--VDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVL  660
            + +E   +   VD  GTGGDG+NT+N+ST AAI+ AACG  VAK GN + SS CGSA+VL
Sbjct  63   IRIEPSVSGTLVDTCGTGGDGSNTINVSTAAAIVTAACGVPVAKHGNYAISSKCGSANVL  122

Query  661  EALGVTI  681
            +ALGV I
Sbjct  123  DALGVRI  129



>ref|WP_019266771.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii]
Length=335

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +++N  DL+ +EA  ++D ++S   SE  +SA+L  L  KGET EEI   A+AMR
Sbjct  3    KEAILKVINGNDLNADEAYNTMDEIMSGEASEVQMSAYLTALSMKGETIEEITASAKAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+N+ NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVKLLNDEEVLEIVGTGGDGSNSFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIELK  690
            LEALGV I ++
Sbjct  123  LEALGVNIYIE  133



>ref|WP_035320345.1| anthranilate phosphoribosyltransferase [Brevibacterium sp. VCM10]
Length=367

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = +1

Query  223  TSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGS-EAL  399
            T+  + +SE+    S +    P     +L+  L+++QDL  ++A  ++D ++S  + +  
Sbjct  2    TTSAVQASEARTTVSAAAENWP-----DLLMALMHQQDLEGDQAAWAMDQIMSGKTPDVT  56

Query  400  ISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaai  579
            ++AFL     KGET EEI GL  AM    + + GL+++VDIVGTGGD A T NIS+ AA+
Sbjct  57   MAAFLAAHHTKGETVEEIAGLVAAMMDHAVPLPGLEDSVDIVGTGGDRAKTANISSTAAM  116

Query  580  laaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            + +A G +V K GNR++SSA GSADVLEALGV  ++
Sbjct  117  IISATGQRVVKHGNRATSSASGSADVLEALGVRFDI  152



>ref|WP_019265032.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii]
Length=335

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +++N  DL+ +EA  ++D ++S   SE  +SA+L  L  KGET EEI   A+AMR
Sbjct  3    KEAILKVINGNDLNADEAYNTMDEIMSGEASEVQMSAYLTALSMKGETIEEITASAKAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+N+ NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVKLLNDEEVLEIVGTGGDGSNSFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIELK  690
            LEALGV I ++
Sbjct  123  LEALGVNIYIE  133



>ref|WP_022410714.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:330]
 emb|CDE11694.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:330]
Length=544

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 90/135 (67%), Gaps = 4/135 (3%)
 Frame = +1

Query  292  PSSKELIE---RLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVG  459
            P  K L +   ++++  DL+E+EA  ++D ++S G + A I + L  LR KGET  EI+G
Sbjct  203  PPKKALCKYAAKVVDGNDLTEQEAMEAMDIIMSGGATNAQIGSLLTALRMKGETIAEIIG  262

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
             A+ MR +   V G + +VDIVGTGGD AN+ NIST ++ + AA G  VAK GNRS SS 
Sbjct  263  FAKGMRAKAKHVAGCEESVDIVGTGGDLANSFNISTTSSFVIAAAGMPVAKHGNRSVSSK  322

Query  640  CGSADVLEALGVTIE  684
             G+ADVLE+LGV I+
Sbjct  323  SGAADVLESLGVKIQ  337



>ref|XP_005715714.1| unnamed protein product [Chondrus crispus]
 emb|CDF35895.1| unnamed protein product [Chondrus crispus]
Length=385

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = +1

Query  280  RLPIPSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIV  456
            R P  S +  +E+L+  ++L+ ++A  + D+ +S +  +A I+AFL LL AKGET  E+ 
Sbjct  41   RFPQCSMRPYLEKLVKLENLTLDDARTATDYAVSGDAHDAEIAAFLSLLSAKGETVAEVS  100

Query  457  GLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSS  636
            G+  +M+   + V+   + +DIVGTGGDGANTVNIST ++I+AAA G +VAK GNRS SS
Sbjct  101  GIVASMQHHMVQVQENHDVLDIVGTGGDGANTVNISTASSIVAAAAGCRVAKHGNRSVSS  160

Query  637  ACGSADVLEALGVTIEL  687
              GSADVLE LGV + L
Sbjct  161  KSGSADVLEELGVQLLL  177



>emb|CBJ25579.1| Anthranilate Phosphoribosyltransferase [Ectocarpus siliculosus]
Length=372

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  208  IALVSTSRTIVSSESEDRCSRSQLR---LPIPSS-KELIERLLNRQDLSEEEAEASLDFL  375
            + LV+ +R  V +    R   S  R   L + SS K  +E+L++  +LS  ++E +L  +
Sbjct  8    LYLVAVARAFVPNFGAVRSPVSTCRPCSLGLGSSLKPYLEKLIDGHELSAADSENALVSI  67

Query  376  LSNGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTV  555
            +       ++A L LLR KGET  EI G  R M+   + V    + +DIVGTGGDGA+T+
Sbjct  68   MEGAKAEQVAALLCLLRMKGETATEIAGCVRGMKSVAVPVHVEGDLLDIVGTGGDGAHTI  127

Query  556  NISTGaailaaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            N+ST + ILAAA GAKV K GNRS SS CGSADVLEALG++++L
Sbjct  128  NVSTASVILAAAAGAKVCKFGNRSVSSLCGSADVLEALGISVDL  171



>ref|XP_001774234.1| predicted protein [Physcomitrella patens]
 gb|EDQ61010.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARAM  474
            S  +++E+L+   +L++ + E  ++ LL++ + A+I AFL LLRAKGET +E+ GLA AM
Sbjct  70   SIPQVLEQLIQGTNLTQAQTEEVMETLLADANPAIIGAFLALLRAKGETLDEVTGLASAM  129

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
              R + V  +  ++DIVGTGGDGANTVNISTG+ ILAAACGAKVAK G+RSSSSACGSAD
Sbjct  130  LSRAIPVRTVPGSLDIVGTGGDGANTVNISTGSCILAAACGAKVAKHGSRSSSSACGSAD  189

Query  655  VLEALGVTIEL  687
            VLE LGV I+L
Sbjct  190  VLETLGVAIDL  200



>ref|WP_030931968.1| anthranilate phosphoribosyltransferase [Streptomyces violaceoruber]
Length=355

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNGS-EALISAFLVLLRAKGETFEEIVGLA  465
            + +  +L+  LL+R DLS  + E ++D  +S  +  A ++A ++ LRAKGET  E+ GLA
Sbjct  7    VETWPQLLNALLDRNDLSTAQTEWAMDEAMSGAAGPARLAALMMGLRAKGETAAEVEGLA  66

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            R M +  + +      +DIVGTGGDG+++VNIST +A++AA  G +V K GNRS+SSACG
Sbjct  67   RGMLRHAVPLTVPGRCLDIVGTGGDGSHSVNISTMSALVAAGAGVRVVKHGNRSASSACG  126

Query  646  SADVLEALGVTIELK  690
            SADVLE LGV+++L 
Sbjct  127  SADVLEELGVSLDLP  141



>gb|EKD92352.1| anthranilate phosphoribosyltransferase [uncultured bacterium]
Length=336

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  310  IERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMRKRG  486
            IE+L+  ++L     E +L+ LL+     L ISAFLVLL AKGET +E+  + + ++K+ 
Sbjct  7    IEKLMRGENLESAMLEKALEELLNPEINPLQISAFLVLLHAKGETVDELSTMIKTLKKKM  66

Query  487  LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEA  666
            + V      +DIVGTGGDG NT+NISTG+AILAA+CG K+AK GNRS SS  GSADVLEA
Sbjct  67   IPVPTKHKVLDIVGTGGDGLNTINISTGSAILAASCGVKIAKHGNRSVSSLTGSADVLEA  126

Query  667  LGVTIEL  687
            LGV I+L
Sbjct  127  LGVNIQL  133



>ref|WP_010225602.1| anthranilate phosphoribosyltransferase, partial [Pseudonocardia 
sp. P1]
Length=329

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  292  PSSKELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLAR  468
            P+   +I RL+  +D+S EE+  ++  + +   + A ++ FLV LRAKGET  EI G+A 
Sbjct  4    PTWPSVIGRLMRGEDVSAEESTWAMGRVFAGEATPAQLAGFLVALRAKGETAAEISGMAD  63

Query  469  AMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            AM    L VE    AVD+VGTGGD A TVNIST +AI+ AA GA V K G R++SS  G+
Sbjct  64   AMLAHALRVEVPGRAVDVVGTGGDQAQTVNISTMSAIVVAAAGAPVVKHGGRAASSQSGT  123

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV IEL
Sbjct  124  ADVLEALGVAIEL  136



>ref|WP_004032794.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Methanobrevibacter]
 gb|EEE42165.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii 
DSM 2375]
 gb|EFC93087.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii 
DSM 2374]
 emb|CDF29228.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii 
CAG:186]
Length=335

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +++N  DL+ +EA  ++D ++S   SE  +SA+L  L  KGET EEI    +AMR
Sbjct  3    KEAILKVVNGNDLNAKEAYGAMDEIMSGEASEVQMSAYLTALSMKGETIEEITASTKAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+NT NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVKLLNDEEVLEIVGTGGDGSNTFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIELK  690
            LEALGV I ++
Sbjct  123  LEALGVNIYIE  133



>ref|WP_019262637.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii]
Length=335

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +++N  DL+ +EA  ++D ++S   SE  +SA+L  L  KGET EEI    +AMR
Sbjct  3    KEAILKVVNGNDLNAKEAYGAMDEIMSGEASEVQMSAYLTALSMKGETIEEITASTKAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+NT NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVKLLNDEEVLEIVGTGGDGSNTFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIELK  690
            LEALGV I ++
Sbjct  123  LEALGVNIYIE  133



>ref|WP_010836575.1| anthranilate phosphoribosyltransferase [Rhodococcus rhodnii]
 gb|EOM78167.1| anthranilate phosphoribosyltransferase [Rhodococcus rhodnii LMG 
5362]
Length=366

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 100/153 (65%), Gaps = 5/153 (3%)
 Frame = +1

Query  244  SESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVL  420
            SES  R +       + S +E++  L +R+DLS E+A  +++ +++ N + A I+AF V 
Sbjct  6    SESTQRAAAPAGGATVWSWREILGALTDRRDLSSEQARWAMNEIMTDNATSAQIAAFGVG  65

Query  421  LRAKGETFEEIVGLARAMRKRGLLVE---GLDNAVDIVGTGGDGANTVNISTGaailaaa  591
            L+ KGET +E+ GLA AM     LVE   G D AVDIVGTGGD A TVNIST AA++ AA
Sbjct  66   LKMKGETPDEVSGLADAMYAHARLVEVPAGTD-AVDIVGTGGDRAGTVNISTMAAVVVAA  124

Query  592  cgakvaKQGNRSSSSACGSADVLEALGVTIELK  690
             G  V K GNR++SS  G ADVLEALGV I L+
Sbjct  125  AGVPVVKHGNRAASSKSGGADVLEALGVRIALE  157



>ref|XP_002182062.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 ref|XP_002182064.1| anthranilate phosphoribosyltransferase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC46602.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46604.1| anthranilate phosphoribosyltransferase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=357

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  295  SSKELIERLLN-RQDLSEEEAEASLDFLLSNGSEALISAFLVLLRAKGETFEEIVGLARA  471
            S K  IE L+   + L+ +E EA+   +L    E  + + L LLRA+GET  EI G+ RA
Sbjct  3    SLKPYIEILIQGTRPLTADETEAAFSEILQGADEVQVGSLLTLLRARGETPSEIAGMVRA  62

Query  472  MRKRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGS  648
            M K    V+ G    +DIVGTGGDGA+T+NIST + +LAAACG  VAK GNRS SSACGS
Sbjct  63   MNKACNAVDLGNRKLLDIVGTGGDGADTINISTASVVLAAACGCIVAKAGNRSVSSACGS  122

Query  649  ADVLEALGVTIEL  687
            ADVLEALGV ++L
Sbjct  123  ADVLEALGVKVDL  135



>ref|WP_041278539.1| anthranilate phosphoribosyltransferase [Desulfotalea psychrophila]
Length=339

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ I R++   DLSE E  AS++ ++S   S A I++F+  LR KGE  EEIVG  R MR
Sbjct  4    RQAIARVVTGADLSESEMMASMEEVMSGQASPAQIASFITALRMKGEAVEEIVGAVRVMR  63

Query  478  KRGLLVE-GL---DNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
             +   ++ GL   D  +DIVGTGGDGA+T N+ST  + + AA G  VAK GNR+ SS CG
Sbjct  64   DKATFIDCGLGPDDILMDIVGTGGDGADTFNVSTTTSFVVAAAGVAVAKHGNRAVSSRCG  123

Query  646  SADVLEALGVTIEL  687
            SADVLEALGV + L
Sbjct  124  SADVLEALGVDLSL  137



>ref|WP_026418221.1| anthranilate phosphoribosyltransferase [Actinoalloteichus cyanogriseus]
Length=351

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            L+ RL  R DLS  +   ++D ++S   + A I  F+  LRAKGE  EEI GLA AM   
Sbjct  11   LLSRLTARVDLSRADTAWAMDQIMSGTATGAQIGGFVAALRAKGEVAEEIEGLAEAMLGH  70

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               +E    AVD+VGTGGDGA+TVNIST  +I+ AA G +V K GNR++SS CG+ADVLE
Sbjct  71   ARRIEVGAGAVDVVGTGGDGAHTVNISTMTSIVVAAAGLRVVKHGNRAASSKCGTADVLE  130

Query  664  ALGVTIEL  687
             LGV I+L
Sbjct  131  RLGVAIDL  138



>ref|WP_018085158.1| hypothetical protein [Desulfurispora thermophila]
Length=353

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++LI +++    L  E+AE  +  ++S   S A I A LV LR KGET EEIVG ARAMR
Sbjct  2    QQLIGQIIEGHHLHMEQAEQLMTGIMSGQLSPAQIGALLVALRWKGETVEEIVGFARAMR  61

Query  478  KRGLLV-EGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            ++ + +    +  VD  GTGGDGA T+NIST AA++ A  G  VAK GNRS SS CGSAD
Sbjct  62   QKAIPIPHDHEVLVDTCGTGGDGAGTMNISTAAALVVAGAGIPVAKHGNRSVSSKCGSAD  121

Query  655  VLEALGVTIEL  687
            VLE LGV + L
Sbjct  122  VLEHLGVNLYL  132



>ref|WP_024335001.1| anthranilate phosphoribosyltransferase [Desulfotignum balticum]
Length=339

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 2/128 (2%)
 Frame = +1

Query  304  ELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMRK  480
            + + +++  QDL++++A   +  + S   + A   AF+  L  KGE FEE+ G A AMR+
Sbjct  5    QYLNQIIRGQDLTQDQAAEMITHIFSGSITPAQTGAFMAALATKGECFEELAGGALAMRR  64

Query  481  RGLLVEGLDNAV-DIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            + L V+ LD  V DIVGTGGDG NT N+ST A+ + A  G  VAK GNRS SS CGSADV
Sbjct  65   KALRVQTLDQTVIDIVGTGGDGTNTFNVSTTASFVVAGAGITVAKHGNRSVSSKCGSADV  124

Query  658  LEALGVTI  681
            LEALG+ +
Sbjct  125  LEALGINL  132



>ref|WP_012648509.1| anthranilate phosphoribosyltransferase [Geobacter daltonii]
 sp|B9M5M2.1|TRPD_GEODF RecName: Full=Anthranilate phosphoribosyltransferase [Geobacter 
daltonii FRC-32]
 gb|ACM21781.1| anthranilate phosphoribosyltransferase [Geobacter daltonii FRC-32]
Length=350

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 16/145 (11%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I R++ R+DLS+ E    +D ++S   + A I+AF+  LR KGET  EI G AR MR
Sbjct  3    KKAIARVVEREDLSQSEMIQVMDQIMSGEATPAQIAAFITALRMKGETVAEIAGAARVMR  62

Query  478  KRGLLVE---------------GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaK  612
             R   +                 L+  +D+VGTGGDG NT NIST  + + AACG KVAK
Sbjct  63   DRATRIRVGKNVLDLDRDDINIDLETILDVVGTGGDGTNTFNISTTVSFVVAACGVKVAK  122

Query  613  QGNRSSSSACGSADVLEALGVTIEL  687
             GNRS SSACGSADV+EALG+++E+
Sbjct  123  HGNRSVSSACGSADVVEALGISLEV  147



>sp|Q6AMS5.1|TRPD_DESPS RecName: Full=Anthranilate phosphoribosyltransferase [Desulfotalea 
psychrophila LSv54]
 emb|CAG36350.1| related to anthranilate phosphoribosyltransferase [Desulfotalea 
psychrophila LSv54]
Length=348

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ I R++   DLSE E  AS++ ++S   S A I++F+  LR KGE  EEIVG  R MR
Sbjct  13   RQAIARVVTGADLSESEMMASMEEVMSGQASPAQIASFITALRMKGEAVEEIVGAVRVMR  72

Query  478  KRGLLVE-GL---DNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
             +   ++ GL   D  +DIVGTGGDGA+T N+ST  + + AA G  VAK GNR+ SS CG
Sbjct  73   DKATFIDCGLGPDDILMDIVGTGGDGADTFNVSTTTSFVVAAAGVAVAKHGNRAVSSRCG  132

Query  646  SADVLEALGVTIEL  687
            SADVLEALGV + L
Sbjct  133  SADVLEALGVDLSL  146



>ref|WP_011954313.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii]
 ref|YP_001273717.1| anthranilate phosphoribosyltransferase [Methanobrevibacter smithii 
ATCC 35061]
 sp|A5UMC1.1|TRPD_METS3 RecName: Full=Anthranilate phosphoribosyltransferase [Methanobrevibacter 
smithii ATCC 35061]
 gb|ABQ87349.1| anthranilate phosphoribosyltransferase, TrpD [Methanobrevibacter 
smithii ATCC 35061]
Length=335

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I +++N  DL+ +EA  ++D ++S   SE  +SA+L  L  KGET EEI    +AMR
Sbjct  3    KEAILKVVNGNDLNAKEAYGAMDEIMSGESSEVQMSAYLTALSMKGETIEEITASTKAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+NT NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVKLLNDEEVLEIVGTGGDGSNTFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIELK  690
            LEALGV I ++
Sbjct  123  LEALGVNIYIE  133



>ref|WP_021131015.1| anthranilate phosphoribosyltransferase [Phaeospirillum fulvum]
 gb|EPY02890.1| anthranilate phosphoribosyltransferase [Phaeospirillum fulvum 
MGU-K5]
Length=349

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 85/129 (66%), Gaps = 1/129 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+++ RL   Q LSE EAEA  + ++S + + A I   L+ LR +GET EEI G AR MR
Sbjct  15   KDVLGRLGAGQTLSESEAEAVFEIIMSGDATPAQIGGLLMALRVRGETVEEITGAARIMR  74

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             + L +E    A+D  GTGGDG+ T NIST AA + AACG  VAK GNR+ SS  GSADV
Sbjct  75   SKALHIEAPPGAIDTCGTGGDGSGTYNISTAAAFVVAACGVPVAKHGNRALSSKSGSADV  134

Query  658  LEALGVTIE  684
            L ALG+ I+
Sbjct  135  LTALGIKID  143



>ref|WP_028464755.1| anthranilate phosphoribosyltransferase [Nisaea denitrificans]
Length=349

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLA  465
            I   K LI  +     LSE +A+A+ D ++S N + A +  FL+ LR +GET EEI G A
Sbjct  5    IQDMKSLIGHVATGASLSEAQAQAAFDIIMSGNATPAQMGGFLMALRVRGETVEEITGAA  64

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            +AMR + L +    NA+D VGTGGDGA T NIS+ +A + A  G  VAK GNR+ SS  G
Sbjct  65   KAMRAKALRISAPANAMDTVGTGGDGAKTYNISSASAFVLAGTGQPVAKHGNRALSSRTG  124

Query  646  SADVLEALGVTIE  684
            +ADVL ALG+  E
Sbjct  125  AADVLSALGINNE  137



>ref|WP_025774851.1| anthranilate phosphoribosyltransferase [Moorella thermoacetica]
Length=339

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K  I +++  Q LSE EA  ++D +++   + A I+AFL  LR KGET +EI G AR+MR
Sbjct  3    KAQISKVVAGQHLSEAEAAEAMDIIMAGEATPAQIAAFLTALRLKGETVDEITGFARSMR  62

Query  478  KRGL-LVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +R + L       VD  GTGGDG  T NIST AA + A  G  VAK GNRS SS CGSAD
Sbjct  63   RRAIPLTTSHPVFVDTCGTGGDGRQTFNISTTAAFVVAGAGVAVAKHGNRSVSSRCGSAD  122

Query  655  VLEALGVTIEL  687
            +LEALG+ ++L
Sbjct  123  MLEALGIKVDL  133



>ref|WP_033295562.1| anthranilate phosphoribosyltransferase [Amycolatopsis jejuensis]
Length=343

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            L+ RL+ R+DLS E+   ++D ++S   + A I  F + LRAKGET EEI GLA AM   
Sbjct  9    LLTRLIAREDLSAEDTAWAMDQIMSGAATPAQIGGFALGLRAKGETPEEISGLADAMLAH  68

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               +E    AVD+VGTGGD +N+VNIST A I+ AA G  VAK GNRS+SS  G+ADVLE
Sbjct  69   SRRIELRRPAVDLVGTGGDRSNSVNISTMATIVTAAAGTPVAKHGNRSASSKSGAADVLE  128

Query  664  ALGVTIEL  687
             LGV IEL
Sbjct  129  TLGVKIEL  136



>ref|WP_008539281.1| anthranilate phosphoribosyltransferase [Megamonas funiformis]
 gb|EHR35553.1| anthranilate phosphoribosyltransferase [Megamonas funiformis 
YIT 11815]
Length=337

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ I +L N+QDL+ E+A  S+  ++S   S   I++FL  LR KGET +EI   A+ MR
Sbjct  3    RQAIYQLSNKQDLTTEQAIVSMQEIMSGTASNIQIASFLTALRLKGETIDEITAFAQVMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            ++   ++  D+  +IVGTGGD ANT NIST A  + +A G KVAK GNRS SS CG+AD 
Sbjct  63   EKAQSIDYKDDLFEIVGTGGDEANTFNISTTAGFVISASGIKVAKHGNRSVSSKCGAADC  122

Query  658  LEALGVTIEL  687
            LEALG  +EL
Sbjct  123  LEALGTKLEL  132



>ref|WP_031389016.1| anthranilate phosphoribosyltransferase [Clostridium sp. KNHs209]
Length=335

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I++++ +QDLS +EAEA +D ++S + S+  +SA+L  L  KGE  EEI   A  MR
Sbjct  3    KEAIQKVVTKQDLSYQEAEAVMDEIMSGSASQIQMSAYLTALSLKGENIEEITASAAGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            K  + +      ++IVGTGGD +N+ NIST +AI+ +A G  VAK GNR++SS CG+ADV
Sbjct  63   KHCIRLLHDMEVLEIVGTGGDKSNSFNISTTSAIVVSAMGVPVAKHGNRAASSKCGAADV  122

Query  658  LEALGVTIEL  687
            LEALGV I +
Sbjct  123  LEALGVNINI  132



>dbj|GAF27123.1| anthranilate phosphoribosyltransferase [Moorella thermoacetica 
Y72]
Length=342

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 85/131 (65%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K  I +++  Q LSE EA  ++D +++   + A I+AFL  LR KGET +EI G AR+MR
Sbjct  6    KAQISKVVAGQHLSEAEAAEAMDIIMAGEATPAQIAAFLTALRLKGETVDEITGFARSMR  65

Query  478  KRGL-LVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            +R + L       VD  GTGGDG  T NIST AA + A  G  VAK GNRS SS CGSAD
Sbjct  66   RRAIPLTTSHPVFVDTCGTGGDGRQTFNISTTAAFVVAGAGVAVAKHGNRSVSSRCGSAD  125

Query  655  VLEALGVTIEL  687
            +LEALG+ ++L
Sbjct  126  MLEALGIKVDL  136



>ref|WP_002725684.1| anthranilate phosphoribosyltransferase [Phaeospirillum molischianum]
 emb|CCG39887.1| anthranilate phosphoribosyltransferase [Phaeospirillum molischianum 
DSM 120]
Length=349

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = +1

Query  292  PSSKELIERLLNR----QDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIV  456
            P++  +I+ +L R    Q LSE EAEA  + ++S + + A I   L+ LR +GET EEI 
Sbjct  8    PTAPAVIKDVLGRLGAGQTLSESEAEAVFEVIMSGDATPAQIGGLLMALRVRGETVEEIT  67

Query  457  GLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSS  636
            G AR MR + L +E    A+D  GTGGDG+ T NIST AA + AACG  VAK GNR+ SS
Sbjct  68   GAARIMRSKALHIEAPPGAIDTCGTGGDGSGTYNISTAAAFVVAACGVPVAKHGNRALSS  127

Query  637  ACGSADVLEALGVTIE  684
              GSADVL ALG+ I+
Sbjct  128  KSGSADVLTALGIKID  143



>ref|WP_015756518.1| anthranilate phosphoribosyltransferase [Desulfotomaculum acetoxidans]
 gb|ACV61802.1| anthranilate phosphoribosyltransferase [Desulfotomaculum acetoxidans 
DSM 771]
Length=344

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K ++E+++  + L+EEE+  +++ ++    + A I+A L  LR KGET +EI G AR MR
Sbjct  2    KAILEKVIAGEPLTEEESSYAMNLIMEGEATPAQIAALLTALRLKGETVDEITGFARVMR  61

Query  478  KRGLLVEG-LDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            ++  +VE      +D  GTGGDG+NT NIST AA++ A  G K+AK GNR+++S CGSAD
Sbjct  62   QKATVVEADFPMLLDTCGTGGDGSNTFNISTTAALVLAGAGVKIAKHGNRAATSKCGSAD  121

Query  655  VLEALGVTIELK  690
            VLE LGV +EL+
Sbjct  122  VLEKLGVNLELE  133



>ref|WP_020402899.1| hypothetical protein [Gracilimonas tropica]
Length=346

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K ++ +L   +DL+E EAEA+++ ++S   SE  I++FL  +R KGET EE+    + MR
Sbjct  4    KSILNKLSFSEDLTEIEAEAAMNLIMSGEISEPKIASFLTAMRLKGETVEELTAFVKVMR  63

Query  478  KRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
             + + V+  +  A+D+VGTGGD + T NIST A+ + AA G  V K GNRS+SS CGSAD
Sbjct  64   SKAVKVDVDVTGAIDLVGTGGDQSGTFNISTAASFITAAAGVPVIKHGNRSASSKCGSAD  123

Query  655  VLEALGVTIEL  687
            VLE LG +IEL
Sbjct  124  VLEHLGASIEL  134



>ref|WP_014526830.1| anthranilate phosphoribosyltransferase [Sinorhizobium meliloti]
 gb|AEG04326.1| anthranilate phosphoribosyltransferase [Sinorhizobium meliloti 
BL225C]
Length=337

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K  + ++  R+ LS E+A A+ + ++S   + A I  FL+ LR +GET +EIVG   AMR
Sbjct  5    KPFVAKVAAREALSREDARAAFEIIMSGAATPAQIGGFLMALRVRGETVDEIVGAVGAMR  64

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R L VE  D A+DIVGTGGDGA T NIST AA++ A  G  VAK GNR+ SS  G+AD 
Sbjct  65   ARMLPVEAPDGAIDIVGTGGDGAGTYNISTLAALIVAGAGVPVAKHGNRALSSKSGTADA  124

Query  658  LEALGVTIEL  687
            L  LGV +++
Sbjct  125  LSCLGVNLDI  134



>ref|WP_015800212.1| anthranilate phosphoribosyltransferase [Actinosynnema mirum]
 gb|ACU35322.1| anthranilate phosphoribosyltransferase [Actinosynnema mirum DSM 
43827]
Length=349

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAM--R  477
            L+ RLL+  DL+E++   ++D ++S   + A ++AF V LRAKGET EE+ GLA AM   
Sbjct  9    LLTRLLDGIDLAEDDTGWAMDRIMSGEATTAQVAAFAVALRAKGETPEEVDGLASAMLGH  68

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
             R   VEG   A DIVGTGGD + +VNIST A I+AAA G  V K GNR++SS CG+ADV
Sbjct  69   ARRFSVEG--RAADIVGTGGDSSGSVNISTMATIVAAAAGVPVVKHGNRAASSQCGTADV  126

Query  658  LEALGVTIELK  690
            LEALGV I+L 
Sbjct  127  LEALGVAIDLP  137



>ref|WP_038671742.1| anthranilate phosphoribosyltransferase [Pelosinus sp. UFO1]
 gb|AIF52341.1| Anthranilate phosphoribosyltransferase [Pelosinus sp. UFO1]
Length=343

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE + +++  + LS + A+ S+D ++S  GSEA I AF+  LR KGET EEI G A  MR
Sbjct  3    KEFLAQVIAGEHLSRQGAQQSMDMIMSGQGSEAQIGAFITALRMKGETIEEITGFAETMR  62

Query  478  KRGLLVE-GLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
               L +E G  + +D  GTGGD   T N+ST  A + A  G  VAK GN   SS+CGSAD
Sbjct  63   SHSLKIECGSKDMIDTCGTGGDKTGTFNVSTAVAFVLAGSGVVVAKHGNHGLSSSCGSAD  122

Query  655  VLEALGVTIEL  687
            VL ALGV ++L
Sbjct  123  VLTALGVRVDL  133



>ref|WP_039743450.1| anthranilate phosphoribosyltransferase [Geobacter pickeringii]
 gb|AJE03946.1| anthranilate phosphoribosyltransferase [Geobacter pickeringii]
Length=350

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 91/145 (63%), Gaps = 16/145 (11%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            K+ I +++ RQDL+E E    +D ++S G + A I++F+  LR KGET EEI G AR MR
Sbjct  3    KKAIAKVVERQDLTEAEMIEVMDQIMSGGATPAQIASFITALRMKGETVEEITGAARVMR  62

Query  478  KRGLLVEGLDNAV---------------DIVGTGGDGANTVNISTGaailaaacgakvaK  612
             R   +    N +               D+VGTGGDG NT NIST  + + +ACG KVAK
Sbjct  63   DRATPIRVGKNVLDIDRDDINIDRETILDVVGTGGDGTNTFNISTTVSFVISACGVKVAK  122

Query  613  QGNRSSSSACGSADVLEALGVTIEL  687
             GNR+ SSACGSADVLE+LGV +++
Sbjct  123  HGNRAVSSACGSADVLESLGVNLDV  147



>ref|WP_016279538.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
A4]
 gb|EOS35626.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
A4]
Length=336

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 5/137 (4%)
 Frame = +1

Query  283  LPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVG  459
            + I ++K+++E +    DL+ +EA   +D ++S  +E + +++FL  LR KGET EEI  
Sbjct  1    MIIEATKKIVENI----DLTADEAAQVMDEMMSGEAEQINMASFLTALRMKGETVEEITA  56

Query  460  LARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSA  639
             A+ MRK GL V    + ++IVGTGGD ANT+NIST A+I+ AA G KVAK GNRS SS 
Sbjct  57   FAKCMRKHGLKVPVSGDVLEIVGTGGDEANTINISTAASIVTAAAGYKVAKHGNRSVSSK  116

Query  640  CGSADVLEALGVTIELK  690
             G+AD LEALGV ++L+
Sbjct  117  SGAADCLEALGVKLDLE  133



>ref|WP_027943290.1| anthranilate phosphoribosyltransferase [Amycolatopsis taiwanensis]
Length=341

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            ++ RL+   DLSE++A  ++D ++S   +EA I AF V LRAKGET EEI G+A AM   
Sbjct  9    VLTRLIAGADLSEQDAAWAMDQIMSGAATEAQIGAFAVALRAKGETPEEISGMAEAMLAH  68

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               V+    AVD+VGTGGD + +VNIST +A++ AA G  V K GNRS+SS  G+ADVLE
Sbjct  69   AHRVQLDRPAVDVVGTGGDRSGSVNISTMSALVVAAAGVPVVKHGNRSASSKSGAADVLE  128

Query  664  ALGVTIELK  690
            ALGV I L 
Sbjct  129  ALGVAISLP  137



>ref|WP_031434338.1| anthranilate phosphoribosyltransferase [Methylomarinum vadi]
Length=338

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 4/132 (3%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ I+RLL+R DL+ EE    +  +++ G S+A I  FL+ LR KGET +EI   A  MR
Sbjct  4    QQAIQRLLDRNDLNGEEMRQVMQTIMTGGASDAQIGGFLIALRCKGETVDEIAAAASVMR  63

Query  478  KRG--LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
                 + V G ++ +D  GTGGDGANT NIST  A + AA G +VAK GNRS SS+CGSA
Sbjct  64   DLATKVPVRG-EHIIDTCGTGGDGANTFNISTTCAFVVAAAGGRVAKHGNRSVSSSCGSA  122

Query  652  DVLEALGVTIEL  687
            DVLEA GV ++L
Sbjct  123  DVLEAAGVNLDL  134



>ref|WP_030001914.1| anthranilate phosphoribosyltransferase [Marinimicrobia bacterium 
SCGC AAA003-E22]
Length=334

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNG--SEALISAFLVLLRAKGETFEEIVGLARAM  474
            K+ IE+LL  Q L++EE+   + F + +G   +A I+ FL+ LRAKGE   EI G A+AM
Sbjct  2    KQTIEKLLGNQSLTQEESRDVM-FRIMSGEYDDAQIAGFLIALRAKGERSAEIAGFAQAM  60

Query  475  RKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSAD  654
            R +   +E +D+A+D+ GTGGD + T NIST A+ + A  G  VAK GNRS +S  GSAD
Sbjct  61   RDKMTKIESVDDAIDMCGTGGDASGTFNISTAASFVVAGAGVPVAKHGNRSMTSKSGSAD  120

Query  655  VLEALGVTIEL  687
            VL ALGV I L
Sbjct  121  VLTALGVDITL  131



>ref|WP_015069961.1| Anthranilate phosphoribosyltransferase [Propionibacterium acidipropionici]
 gb|AFV89053.1| Anthranilate phosphoribosyltransferase [Propionibacterium acidipropionici 
ATCC 4875]
Length=348

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  295  SSKELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARA  471
            +  +L+  L+N  DL  E +  ++D +LS    A+ ++ F V LRAKGET EE+ GLA  
Sbjct  8    TWPDLLTDLVNGHDLDRERSIWAMDQVLSGDLSAVQVAGFAVALRAKGETVEELSGLAEG  67

Query  472  MRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            M  R   +E     VDIVGTGGD ANTVNIST AAI+A+  GA+V K GNR++SSACG+A
Sbjct  68   MLGRATPLELDRETVDIVGTGGDRANTVNISTMAAIVASGAGARVVKHGNRAASSACGTA  127

Query  652  DVLEALGVTIEL  687
            D LEALGV + L
Sbjct  128  DCLEALGVKLSL  139



>ref|WP_022427770.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:403]
 emb|CDE34021.1| anthranilate phosphoribosyltransferase [Ruminococcus sp. CAG:403]
Length=542

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +1

Query  316  RLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMRKRGLL  492
            RL+  Q+L+++EA  ++D ++S   +EA I+ FL  LR KGET +EI GLA  MR +  L
Sbjct  214  RLIEFQNLTQQEAAEAMDIIMSGQATEAQIAEFLTALRMKGETIDEISGLALGMRAKANL  273

Query  493  VEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLEALG  672
            V    +A+DIVGTGGD A++ NIST A+ + AA G KVAK GNRS SS  G+ADVLE LG
Sbjct  274  VPDSKDAIDIVGTGGDLASSFNISTTASFVIAAAGVKVAKHGNRSVSSKSGAADVLECLG  333

Query  673  VTIE  684
            V I+
Sbjct  334  VKIQ  337



>ref|WP_022462656.1| anthranilate phosphoribosyltransferase [Blautia sp. CAG:37]
 emb|CDE66733.1| anthranilate phosphoribosyltransferase [Blautia sp. CAG:37]
Length=339

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLSNGSEAL-ISAFLVLLRAKGETFEEIVGLARAMR  477
            +E I +L+N+++L+ E AE ++D ++   ++ + ISAFL  +  KGET EEI   A  MR
Sbjct  3    REAIVKLVNKENLTYEMAEGAMDEIMGGKADPIQISAFLTAMTMKGETIEEITACANGMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
            K G+ +E   + ++IVGTGGD +N+ NIST A+++ +A G  VAK GNR++SS  G+AD 
Sbjct  63   KHGVHMEHDKDVLEIVGTGGDKSNSFNISTTASLVISAGGVAVAKHGNRAASSKSGAADC  122

Query  658  LEALGVTIELK  690
            LEALGV ++L+
Sbjct  123  LEALGVKVDLE  133



>ref|WP_027148542.1| anthranilate phosphoribosyltransferase [Methylobacter tundripaludum]
Length=338

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ ++ LLN+Q+LS +E    +  ++S N ++A I  FL+ LR KGET +EI   A  MR
Sbjct  4    QQALQALLNKQNLSSDEMREVMRQIMSGNATDAQIGGFLIALRCKGETIDEIAAAAEVMR  63

Query  478  KRG--LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            +    + V G D+ +D  GTGGDGANT NIST  A + AA G +VAK GNRS SS+CGSA
Sbjct  64   ELAAKVAVTG-DHVIDTCGTGGDGANTFNISTTCAFVVAAAGGQVAKHGNRSVSSSCGSA  122

Query  652  DVLEALGVTIEL  687
            D+LEA GV ++L
Sbjct  123  DLLEAAGVNLDL  134



>gb|KHS53558.1| Anthranilate phosphoribosyltransferase [Brevibacterium linens]
Length=373

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +1

Query  223  TSRTIVSSESEDRCSRSQLRLPIPSSKELIERLLNRQDLSEEEAEASLDFLLSNGS-EAL  399
            T+   ++SE+      + +  P     +L+  L+++QDL   +A  ++D ++S  + +  
Sbjct  8    TTTAALASEASTTVPAADVNWP-----DLLMALMHQQDLDGVQAAWAMDQIMSGKTADVT  62

Query  400  ISAFLVLLRAKGETFEEIVGLARAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaai  579
            ++AFL     KGET EEI GL  AM    + + GL+++VDIVGTGGD A T NIS+ AA+
Sbjct  63   MAAFLAAHHTKGETVEEIAGLVAAMMDHAVPLPGLEDSVDIVGTGGDRAKTANISSTAAM  122

Query  580  laaacgakvaKQGNRSSSSACGSADVLEALGVTIEL  687
            + +A G +V K GNR++SSA GSADVLEALGV  ++
Sbjct  123  IISAAGQRVVKHGNRATSSASGSADVLEALGVRFDI  158



>ref|WP_009375719.1| anthranilate phosphoribosyltransferase [Brevibacterium casei]
 gb|EKU49694.1| anthranilate phosphoribosyltransferase [Brevibacterium casei 
S18]
Length=373

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLSNG-SEALISAFLVLLRAKGETFEEIVGLA  465
            +    +L+ +L++ QDL E EA  ++D ++S    +  ++AFL     KGET  EI GL 
Sbjct  25   VADWPDLLMKLMHGQDLDEAEASWAMDQIMSGEVPDVTMAAFLAAHHTKGETVAEIAGLV  84

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
             AM    + + GL+++VDIVGTGGD A T NIS+ AA++ AA G +V K GNR++SSA G
Sbjct  85   SAMMDHAVPLPGLEDSVDIVGTGGDRAKTANISSTAAMIIAATGQRVVKHGNRATSSASG  144

Query  646  SADVLEALGVTIEL  687
            SADVLEALGV  ++
Sbjct  145  SADVLEALGVRFDI  158



>ref|WP_007675360.1| anthranilate phosphoribosyltransferase [alpha proteobacterium 
BAL199]
 gb|EDP63751.1| anthranilate phosphoribosyltransferase [alpha proteobacterium 
BAL199]
Length=343

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +1

Query  289  IPSSKELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLA  465
            I   K LI R+ +   L+E EAE++ D ++S N + A +  FL+ LR +GET  EI G A
Sbjct  5    IQDMKALIARVADGATLTESEAESAFDIIMSGNATPAQMGGFLMALRVRGETVAEITGAA  64

Query  466  RAMRKRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACG  645
            R MR + L +   + A+D VGTGGDGA T NIST AA + A  G  VAK GNR+ SS  G
Sbjct  65   RTMRAKALKIPTPEGAIDTVGTGGDGAKTFNISTAAAFVVAGAGVVVAKHGNRALSSRAG  124

Query  646  SADVLEALGVTIE  684
            +ADVL  LGV I+
Sbjct  125  AADVLTHLGVNID  137



>ref|WP_012955018.1| anthranilate phosphoribosyltransferase [Methanobrevibacter ruminantium]
 ref|YP_003422954.1| anthranilate phosphoribosyltransferase TrpD [Methanobrevibacter 
ruminantium M1]
 gb|ADC46062.1| anthranilate phosphoribosyltransferase TrpD [Methanobrevibacter 
ruminantium M1]
Length=335

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            KE I ++   +DL+ +EA A++D ++S   SE  +SA+L  +  KGET EEI   A AMR
Sbjct  3    KEAILKVYKDEDLTYDEAYATMDEIMSGEASEVQMSAYLTAMSMKGETIEEITASAEAMR  62

Query  478  KRGLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADV  657
               + +   +  ++IVGTGGDG+NT NIST ++I+ +A G  VAK GNRS+SS CG+ADV
Sbjct  63   AHCVRLLNDEEVLEIVGTGGDGSNTFNISTTSSIVISAAGVPVAKHGNRSASSKCGAADV  122

Query  658  LEALGVTIEL  687
            LE LGV I +
Sbjct  123  LEELGVNIHI  132



>ref|WP_031437313.1| anthranilate phosphoribosyltransferase [Methylobacter tundripaludum]
Length=338

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = +1

Query  301  KELIERLLNRQDLSEEEAEASLDFLLS-NGSEALISAFLVLLRAKGETFEEIVGLARAMR  477
            ++ ++ LLN+Q+LS +E    +  ++S N ++A I  FL+ LR KGET +EI   A  MR
Sbjct  4    QQALQALLNKQNLSSDEMREVMRQIMSGNATDAQIGGFLIALRCKGETIDEIAAAAEVMR  63

Query  478  KRG--LLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSA  651
            +    + V G D+ +D  GTGGDGANT NIST  A + AA G +VAK GNRS SS+CGSA
Sbjct  64   ELAAKVAVTG-DHVIDTCGTGGDGANTFNISTTCAFVVAAAGGQVAKHGNRSVSSSCGSA  122

Query  652  DVLEALGVTIEL  687
            D+LEA GV ++L
Sbjct  123  DLLEAAGVNLDL  134



>ref|WP_016696672.1| hypothetical protein [Actinoalloteichus spitiensis]
Length=351

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = +1

Query  307  LIERLLNRQDLSEEEAEASLDFLLSN-GSEALISAFLVLLRAKGETFEEIVGLARAMRKR  483
            L+ RL  R DLS  +   ++D ++S   + A I  F+  LRAKGE  EEI GLA AM   
Sbjct  11   LLSRLTARVDLSRADTAWAMDQIMSGTATGAQIGGFVAALRAKGEVAEEIEGLAEAMLGH  70

Query  484  GLLVEGLDNAVDIVGTGGDGANTVNISTGaailaaacgakvaKQGNRSSSSACGSADVLE  663
               ++    AVD+VGTGGDGA+TVNIST  +I+ AA G +V K GNR++SS CG+ADVLE
Sbjct  71   ARRIDVGAGAVDVVGTGGDGAHTVNISTMTSIVVAAAGLRVVKHGNRAASSKCGTADVLE  130

Query  664  ALGVTIEL  687
             LGV I+L
Sbjct  131  RLGVAIDL  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520