BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020B05

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG25152.1|  Catalase isozyme 1                                      433   1e-147   Gossypium arboreum [tree cotton]
ref|XP_002521709.1|  catalase, putative                                 433   1e-147   Ricinus communis
gb|AIA61608.1|  catalase                                                433   1e-147   Gynostemma pentaphyllum [jiaogulan]
gb|ACJ11733.1|  catalase                                                432   3e-147   Gossypium hirsutum [American cotton]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    432   3e-147   Gossypium raimondii
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             430   3e-147   
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 431   6e-147   Cucumis melo [Oriental melon]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             431   6e-147   Populus trichocarpa [western balsam poplar]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             430   7e-147   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      431   1e-146   Fragaria vesca subsp. vesca
ref|XP_007018034.1|  Catalase 2                                         430   1e-146   
gb|AAX88799.1|  catalase                                                430   2e-146   Euphorbia characias
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             431   2e-146   
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         430   2e-146   Tarenaya hassleriana [spider flower]
ref|XP_010530333.1|  PREDICTED: catalase-2                              429   3e-146   Tarenaya hassleriana [spider flower]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              429   3e-146   Populus euphratica
ref|NP_001235974.1|  catalase-3                                         429   4e-146   Glycine max [soybeans]
ref|NP_001237556.1|  catalase-1/2                                       429   4e-146   Glycine max [soybeans]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    429   4e-146   Gossypium raimondii
gb|AET97564.1|  catalase                                                429   7e-146   Ziziphus jujuba [Chinese jujube]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      426   9e-146   Nelumbo nucifera [Indian lotus]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      428   1e-145   Vitis vinifera
ref|NP_001289779.1|  catalase isozyme 1                                 428   1e-145   Nelumbo nucifera [Indian lotus]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      427   2e-145   Nicotiana tomentosiformis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      427   2e-145   Nelumbo nucifera [Indian lotus]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          427   3e-145   Soldanella alpina
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               427   3e-145   Gossypium hirsutum [American cotton]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      427   3e-145   Nicotiana sylvestris
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               427   4e-145   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDX72514.1|  BnaC07g45360D                                          426   4e-145   
gb|AAD17935.1|  catalase                                                426   5e-145   Brassica juncea [brown mustard]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             426   5e-145   Phaseolus vulgaris [French bean]
ref|NP_001291326.1|  catalase isozyme 1                                 426   5e-145   Sesamum indicum [beniseed]
gb|ABF93811.1|  Catalase-1, putative, expressed                         422   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009138342.1|  PREDICTED: catalase-2                              426   7e-145   Brassica rapa
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         426   7e-145   Tarenaya hassleriana [spider flower]
gb|AAF71742.1|AF248491_1  catalase                                      426   7e-145   Raphanus sativus
gb|AAD17933.1|  catalase                                                426   7e-145   Brassica juncea [brown mustard]
gb|AFN81243.1|  catalase 1                                              426   9e-145   Brassica rapa subsp. pekinensis [bai cai]
emb|CAD42908.1|  catalase                                               426   9e-145   Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             426   9e-145   Prunus persica
emb|CDP01803.1|  unnamed protein product                                426   9e-145   Coffea canephora [robusta coffee]
gb|ADC95629.1|  catalase                                                426   1e-144   Bruguiera gymnorhiza [Burma mangrove]
gb|AAC19397.1|  leaf catalase                                           426   1e-144   Mesembryanthemum crystallinum
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      426   1e-144   Solanum tuberosum [potatoes]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           426   1e-144   
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           425   1e-144   Sesamum indicum [beniseed]
ref|XP_010094556.1|  Catalase isozyme 1                                 425   1e-144   Morus notabilis
gb|AJE26131.1|  catalase                                                425   1e-144   Salix matsudana [tortured willow]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          425   2e-144   Amborella trichopoda
ref|XP_007046520.1|  Catalase 2                                         425   2e-144   Theobroma cacao [chocolate]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      425   2e-144   Prunus mume [ume]
dbj|BAJ33995.1|  unnamed protein product                                425   2e-144   Eutrema halophilum
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    424   2e-144   
emb|CAA64220.1|  catalase                                               425   2e-144   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30147.1|  catalase                                                425   2e-144   Arabis alpina [alpine rockcress]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      425   2e-144   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             424   3e-144   Eutrema salsugineum [saltwater cress]
dbj|BAH19523.1|  AT4G35090                                              424   3e-144   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                424   3e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             426   3e-144   Eutrema salsugineum [saltwater cress]
ref|NP_001031791.1|  catalase 2                                         424   3e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      424   3e-144   
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             424   3e-144   
ref|NP_195235.1|  catalase 2                                            424   3e-144   Arabidopsis thaliana [mouse-ear cress]
gb|ADU56199.1|  catalase                                                424   3e-144   Hevea brasiliensis [jebe]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       424   4e-144   Cucumis sativus [cucumbers]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      424   4e-144   Cucumis melo [Oriental melon]
gb|ACA50528.1|  putative catalase 2                                     424   4e-144   Brassica napus [oilseed rape]
gb|AAR84577.1|  catalase 1b                                             422   5e-144   Lotus japonicus
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         424   5e-144   Camelina sativa [gold-of-pleasure]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     423   6e-144   Eucalyptus grandis [rose gum]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         424   6e-144   Jatropha curcas
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               424   6e-144   Gossypium hirsutum [American cotton]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                424   7e-144   Erythranthe guttata [common monkey flower]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    424   7e-144   Gossypium raimondii
ref|XP_010437527.1|  PREDICTED: catalase-2                              424   7e-144   Camelina sativa [gold-of-pleasure]
gb|KJB17474.1|  hypothetical protein B456_003G002800                    422   7e-144   Gossypium raimondii
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             423   7e-144   Eutrema salsugineum [saltwater cress]
gb|KHG12976.1|  Catalase isozyme 2                                      423   8e-144   Gossypium arboreum [tree cotton]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         423   8e-144   Camelina sativa [gold-of-pleasure]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                423   9e-144   Erythranthe guttata [common monkey flower]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      423   1e-143   Populus euphratica
ref|XP_002306976.2|  catalase family protein                            423   1e-143   
gb|AAM97542.1|  catalase 3                                              423   1e-143   Capsicum annuum
gb|EPS69543.1|  catalase                                                423   1e-143   Genlisea aurea
gb|ABY21704.1|  catalase-1 precursor                                    423   1e-143   Panax ginseng [Asiatic ginseng]
gb|AAD17936.1|  catalase                                                423   1e-143   Brassica juncea [brown mustard]
gb|AAR84578.1|  catalase 1a                                             423   1e-143   Lotus japonicus
gb|ACV92695.1|  catalase                                                422   2e-143   Brassica oleracea
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              422   2e-143   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 422   2e-143   Populus euphratica
ref|XP_002301920.1|  catalase family protein                            422   2e-143   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               422   2e-143   Populus deltoides
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              422   2e-143   
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      422   2e-143   
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             422   2e-143   Capsella rubella
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              423   2e-143   Brassica rapa
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              422   3e-143   Cicer arietinum [garbanzo]
gb|KEH36313.1|  catalase heme-binding enzyme                            419   4e-143   Medicago truncatula
ref|NP_001234186.1|  catalase isozyme 2                                 421   4e-143   
emb|CDX69111.1|  BnaC01g03420D                                          421   5e-143   
gb|ACL27272.1|  catalase                                                421   5e-143   Nicotiana benthamiana
gb|AFU90823.1|  catalase                                                420   5e-143   Populus x beijingensis
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      421   5e-143   Nicotiana sylvestris
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             421   6e-143   
gb|AAB71764.1|  catalase 1                                              421   6e-143   Nicotiana tabacum [American tobacco]
emb|CCP37650.1|  catalase-1                                             421   6e-143   Nicotiana tabacum [American tobacco]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      421   6e-143   Elaeis guineensis
gb|AAO17721.1|  catalase                                                421   6e-143   Hypericum perforatum
ref|NP_001237571.1|  catalase-4                                         421   7e-143   Glycine max [soybeans]
ref|NP_001048861.1|  Os03g0131200                                       421   1e-142   
gb|AFU90822.1|  catalase                                                420   1e-142   Populus tomentosa [Chinese white poplar]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              421   1e-142   Populus euphratica
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         420   1e-142   Oryza brachyantha
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    420   1e-142   Arabis alpina [alpine rockcress]
dbj|BAA34714.1|  catalase                                               420   1e-142   Oryza sativa [red rice]
emb|CDY01363.1|  BnaA07g11360D                                          420   1e-142   
ref|NP_001240021.1|  catalase                                           420   2e-142   Glycine max [soybeans]
ref|XP_009103333.1|  PREDICTED: catalase-1                              420   2e-142   Brassica rapa
gb|ACJ71244.1|  catalase 2                                              416   2e-142   Vigna unguiculata
emb|CDY31877.1|  BnaC07g15270D                                          420   2e-142   Brassica napus [oilseed rape]
ref|XP_009106100.1|  PREDICTED: catalase-2                              419   2e-142   Brassica rapa
emb|CDP07287.1|  unnamed protein product                                419   2e-142   Coffea canephora [robusta coffee]
gb|AAB86582.2|  catalase                                                419   2e-142   Raphanus sativus
gb|ACJ71245.1|  catalase 2                                              416   2e-142   Vigna unguiculata
ref|XP_010692546.1|  PREDICTED: catalase                                419   3e-142   Beta vulgaris subsp. vulgaris [field beet]
prf||1906388A  catalase                                                 419   3e-142   Arabidopsis thaliana [mouse-ear cress]
gb|AAK67359.2|AF390210_1  catalase                                      419   3e-142   Suaeda salsa
gb|AFU48609.1|  catalase 1                                              419   3e-142   Nicotiana benthamiana
gb|KEH36312.1|  catalase heme-binding enzyme                            419   3e-142   Medicago truncatula
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      419   4e-142   Phoenix dactylifera
gb|AHB72694.1|  catalase                                                419   4e-142   Beta vulgaris subsp. maritima [sea beet]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 419   4e-142   Phoenix dactylifera
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          419   5e-142   Helianthus annuus
gb|AIP93616.1|  CAT1                                                    419   6e-142   Bassia scoparia [burning bush]
gb|AGI65617.1|  catalase                                                417   6e-142   Fragaria x ananassa
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 418   7e-142   Solanum tuberosum [potatoes]
gb|AAC17731.1|  catalase 1                                              418   1e-141   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            418   1e-141   Arabidopsis thaliana [mouse-ear cress]
gb|ACH63223.1|  catalase                                                418   1e-141   Rheum australe [Himalayan rhubarb]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      418   1e-141   Nicotiana tomentosiformis
dbj|BAJ90861.1|  predicted protein                                      418   1e-141   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADZ45555.1|  catalase                                                418   1e-141   Vigna radiata [mung bean]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          417   1e-141   Vigna radiata var. radiata [golden gram]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             417   2e-141   Citrus clementina [clementine]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      417   2e-141   Solanum lycopersicum
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      417   2e-141   Citrus sinensis [apfelsine]
gb|ADZ45556.1|  catalase                                                417   2e-141   Vigna radiata [mung bean]
dbj|BAA34205.1|  catalase                                               417   2e-141   Oryza sativa Japonica Group [Japonica rice]
gb|AAF19965.1|AF207906_1  catalase 1                                    417   2e-141   Zantedeschia aethiopica [arum-lily]
emb|CAA45564.1|  catalase                                               417   2e-141   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43177.1|  TPA: catalase2                                         417   3e-141   
prf||2104177A  catalase                                                 417   3e-141   Helianthus annuus
gb|AGV54297.1|  peroxisomal catalase                                    417   3e-141   Phaseolus vulgaris [French bean]
emb|CDY17510.1|  BnaC03g65530D                                          416   3e-141   Brassica napus [oilseed rape]
emb|CDX76313.1|  BnaA08g10870D                                          416   3e-141   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               416   4e-141   Ricinus communis
gb|AIS20825.1|  CAT                                                     416   4e-141   Pyrus x bretschneideri [bai li]
gb|ABK24453.1|  unknown                                                 416   5e-141   Picea sitchensis
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         416   5e-141   Setaria italica
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      416   5e-141   Phoenix dactylifera
dbj|BAH37035.1|  catalase 1                                             416   6e-141   Pisum sativum [garden pea]
tpg|DAA43178.1|  TPA: catalase2                                         417   6e-141   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 416   6e-141   Nicotiana sylvestris
gb|AIZ77475.1|  catalase                                                416   6e-141   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003558892.1|  PREDICTED: catalase-1                              416   8e-141   Brachypodium distachyon [annual false brome]
gb|AAB07026.1|  catalase 1                                              416   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061175.1|  PREDICTED: catalase-like                           415   1e-140   Eucalyptus grandis [rose gum]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 415   1e-140   Elaeis guineensis
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 415   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY52649.1|  BnaAnng11640D                                          413   2e-140   Brassica napus [oilseed rape]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             415   2e-140   Phaseolus vulgaris [French bean]
gb|AFD29285.1|  catalase                                                415   2e-140   Vicia faba [broad bean]
gb|AHA50082.1|  catalase                                                415   2e-140   Eleutherococcus senticosus
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       415   2e-140   Triticum aestivum [Canadian hard winter wheat]
gb|ACB11496.1|  catalase                                                414   2e-140   Pinus sylvestris [Scotch pine]
emb|CAG23920.1|  catalase                                               414   4e-140   Festuca arundinacea [tall fescue]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 414   4e-140   Nicotiana tomentosiformis
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         414   5e-140   Camelina sativa [gold-of-pleasure]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      413   6e-140   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF61732.1|AF243517_1  catalase 2                                    413   7e-140   Helianthus annuus
gb|ACL35349.1|  catalase                                                413   8e-140   Picea glauca
ref|XP_010477308.1|  PREDICTED: catalase-1                              413   8e-140   Camelina sativa [gold-of-pleasure]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      413   9e-140   Elaeis guineensis
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             413   1e-139   Selaginella moellendorffii
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     415   2e-139   Eucalyptus grandis [rose gum]
gb|AAB62892.1|  catalase-1                                              412   3e-139   Nicotiana glutinosa
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               411   4e-139   Cucurbita pepo
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              411   4e-139   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            411   4e-139   Pisum sativum [garden pea]
gb|AAM97541.1|  catalase 2                                              411   4e-139   Capsicum annuum
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         410   9e-139   Camelina sativa [gold-of-pleasure]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 425   1e-138   
prf||1803522A  catalase                                                 409   3e-138   Zea mays [maize]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               409   3e-138   Zea mays [maize]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               409   3e-138   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAJ88747.1|  predicted protein                                      409   2e-137   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAG43363.1|AF151368_1  catalase                                      407   2e-137   Hevea brasiliensis [jebe]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      407   3e-137   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          406   4e-137   
ref|NP_001241808.1|  catalase isozyme B                                 406   5e-137   Zea mays [maize]
gb|AIU99488.1|  catalase                                                406   5e-137   Saccharum hybrid cultivar ROC22
ref|NP_001105310.1|  catalase isozyme 2                                 405   8e-137   
emb|CDY29518.1|  BnaA06g14520D                                          405   9e-137   Brassica napus [oilseed rape]
gb|AIM43584.1|  catalase                                                405   9e-137   Saccharum hybrid cultivar Yacheng05-179
emb|CDY40645.1|  BnaA03g53180D                                          405   1e-136   Brassica napus [oilseed rape]
gb|AIU99486.1|  catalase                                                405   1e-136   Saccharum spontaneum [fodder cane]
ref|XP_009149540.1|  PREDICTED: catalase-1                              405   1e-136   Brassica rapa
emb|CDY31490.1|  BnaC05g15990D                                          405   1e-136   Brassica napus [oilseed rape]
gb|AIU99481.1|  catalase                                                405   1e-136   Saccharum spontaneum [fodder cane]
gb|AIU99480.1|  catalase                                                405   2e-136   Saccharum spontaneum [fodder cane]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               405   2e-136   Zea mays [maize]
ref|NP_001105415.1|  catalase isozyme 1                                 404   2e-136   
gb|AIU99479.1|  catalase                                                404   2e-136   Saccharum arundinaceum
gb|AIU99487.1|  catalase                                                404   2e-136   Saccharum hybrid cultivar ROC22
emb|CAA42720.1|  catalase-1                                             404   3e-136   Zea mays [maize]
gb|AGE15298.2|  catalase 1                                              403   5e-136   Eriobotrya japonica [loquat]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    403   6e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001058635.1|  Os06g0727200                                       403   6e-136   
gb|AGC65520.1|  catalase                                                403   8e-136   Eriobotrya japonica [loquat]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 402   2e-135   Oryza brachyantha
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 403   3e-135   
gb|AIU99483.1|  catalase                                                401   4e-135   Saccharum hybrid cultivar ROC22
gb|AIU99484.1|  catalase                                                401   4e-135   Saccharum arundinaceum
gb|AIU99482.1|  catalase                                                401   5e-135   Saccharum hybrid cultivar ROC22
gb|AAY59707.1|  catalase                                                401   6e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      400   1e-134   Brachypodium distachyon [annual false brome]
dbj|BAA34204.1|  catalase                                               400   2e-134   Oryza sativa Japonica Group [Japonica rice]
gb|AIU99485.1|  catalase                                                399   2e-134   Saccharum spontaneum [fodder cane]
ref|XP_001784759.1|  predicted protein                                  398   7e-134   
dbj|BAA05494.1|  catalase                                               397   9e-134   Oryza sativa Japonica Group [Japonica rice]
gb|ABM47415.1|  catalase                                                397   2e-133   Prunus avium [gean]
gb|AAR14052.2|  catalase                                                396   2e-133   Solanum tuberosum [potatoes]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 397   2e-133   Vitis vinifera
ref|NP_001268098.1|  catalase                                           397   2e-133   Vitis vinifera
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               395   5e-133   Hordeum vulgare [barley]
gb|EMT05040.1|  Catalase-1                                              397   6e-133   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             395   1e-132   
ref|XP_001752315.1|  predicted protein                                  395   1e-132   
gb|AAF79625.1|AC027665_26  F5M15.5                                      410   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 393   2e-132   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 393   2e-132   
dbj|BAC79443.1|  catalase                                               394   2e-132   Acacia ampliceps
ref|XP_002510677.1|  catalase, putative                                 408   3e-132   
gb|AAP80622.1|AF475100_1  catalase isozyme                              385   3e-132   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002890395.1|  F5M15.5                                            408   4e-132   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         393   6e-132   Triticum aestivum [Canadian hard winter wheat]
gb|AII23739.1|  catalase                                                392   1e-131   Zostera marina
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 392   2e-131   Prunus mume [ume]
emb|CAD42909.1|  catalase                                               392   2e-131   Prunus persica
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             392   2e-131   Prunus persica
gb|AHF21552.1|  catalase                                                391   3e-131   Hylocereus undatus [dragon fruit]
gb|ADN94253.1|  catalase                                                390   5e-131   Puccinellia chinampoensis
dbj|BAQ21275.1|  catalase                                               390   5e-131   Citrus tamurana
gb|EMS61345.1|  Catalase isozyme 1                                      395   5e-131   Triticum urartu
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 390   1e-130   Eucalyptus grandis [rose gum]
emb|CDP07288.1|  unnamed protein product                                389   2e-130   Coffea canephora [robusta coffee]
gb|AIX10947.1|  putative catalase                                       389   2e-130   Gardenia jasminoides
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             389   2e-130   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          388   6e-130   Amborella trichopoda
gb|AAF61734.1|AF243519_1  catalase 4                                    388   6e-130   Helianthus annuus
ref|XP_005645077.1|  catalase                                           387   1e-129   Coccomyxa subellipsoidea C-169
gb|AAB70006.1|  catalase                                                387   1e-129   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                387   1e-129   Chlamydomonas reinhardtii
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     383   2e-129   Eucalyptus grandis [rose gum]
gb|AAF61733.1|AF243518_1  catalase 3                                    386   3e-129   Helianthus annuus
ref|XP_011396830.1|  Catalase isozyme 2                                 386   4e-129   Auxenochlorella protothecoides
emb|CAE82295.1|  catalase                                               385   6e-129   Homogyne alpina
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      385   1e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      384   2e-128   Eucalyptus grandis [rose gum]
gb|ACJ22771.1|  catalase 1                                              384   3e-128   Jatropha curcas
gb|AAD50974.1|AF170272_1  catalase CAT1                                 383   4e-128   Manihot esculenta [manioc]
gb|ABV55108.1|  catalase 2                                              383   5e-128   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      383   5e-128   
emb|CAA73663.1|  catalase                                               383   7e-128   Chlamydomonas reinhardtii
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      382   1e-127   Phoenix dactylifera
gb|ACJ76836.3|  catalase                                                382   2e-127   Dimocarpus longan [longan]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      381   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      381   4e-127   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 380   5e-127   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      380   5e-127   
ref|XP_002950455.1|  catalase                                           380   6e-127   
gb|ADB03784.1|  catalase                                                380   1e-126   
gb|ADU56198.1|  catalase                                                379   2e-126   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          378   3e-126   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               377   1e-125   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       374   1e-125   
gb|ABK41476.1|  catalase                                                377   1e-125   
gb|ADQ28492.1|  catalase                                                375   4e-125   
gb|AFR53082.1|  CAT                                                     375   7e-125   
gb|ABB88582.1|  catalase                                                372   1e-123   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             369   1e-123   
gb|AAC19398.1|  root catalase                                           372   1e-123   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             367   4e-123   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             370   4e-123   
gb|ABB51561.1|  truncated catalase 2                                    368   4e-123   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             370   5e-123   
gb|AEQ30070.1|  catalase                                                370   6e-123   
ref|NP_973873.1|  catalase 3                                            367   7e-123   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 370   7e-123   
gb|AAG61140.2|AF332973_1  catalase 2                                    369   2e-122   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          369   2e-122   
emb|CDY29519.1|  BnaA06g14510D                                          369   2e-122   
ref|NP_001031073.1|  catalase 3                                         368   2e-122   
dbj|BAH56915.1|  AT1G20620                                              368   3e-122   
gb|AAD30291.2|AF139538_1  catalase 2                                    368   3e-122   
gb|AHF27430.1|  catalase                                                368   3e-122   
gb|AAD30292.1|AF139539_1  catalase 3                                    368   3e-122   
ref|NP_564120.1|  catalase 3                                            368   3e-122   
gb|ADM96039.1|  catalase                                                368   3e-122   
gb|AAM65021.1|  unknown                                                 368   4e-122   
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 368   4e-122   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         368   4e-122   
emb|CDY33636.1|  BnaC08g19360D                                          368   4e-122   
ref|XP_009110221.1|  PREDICTED: catalase-3                              368   5e-122   
emb|CDY31878.1|  BnaC07g15280D                                          367   6e-122   
ref|XP_009149539.1|  PREDICTED: catalase-3                              369   6e-122   
gb|AGT16310.1|  catalase                                                367   6e-122   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      367   7e-122   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      367   8e-122   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    367   9e-122   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         367   1e-121   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    367   1e-121   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               367   1e-121   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      367   2e-121   
gb|AHF27433.1|  catalase                                                366   2e-121   
gb|ACL81498.1|  catalase                                                366   2e-121   
emb|CDY01364.1|  BnaA07g11370D                                          368   3e-121   
gb|AFW66787.1|  catalase3                                               365   3e-121   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               365   4e-121   
gb|ABK24543.1|  unknown                                                 365   6e-121   
gb|ABK24449.1|  unknown                                                 365   7e-121   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           365   7e-121   
gb|AFW66788.1|  catalase3                                               365   8e-121   
gb|ABN71233.2|  catalase                                                365   8e-121   
ref|NP_001045673.1|  Os02g0115700                                       365   8e-121   
gb|AHG98056.1|  catalase                                                357   1e-120   
gb|ADY02963.1|  catalase                                                364   1e-120   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               364   2e-120   
dbj|BAJ92414.1|  predicted protein                                      364   2e-120   
emb|CAH61266.1|  catalase                                               364   2e-120   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               363   2e-120   
ref|XP_010692544.1|  PREDICTED: catalase-like                           363   3e-120   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      363   3e-120   
gb|AHZ13843.1|  catalase                                                362   5e-120   
gb|AAC49807.1|  catalase 3                                              362   8e-120   
ref|XP_010498496.1|  PREDICTED: catalase-3                              362   1e-119   
emb|CAA43814.1|  catalase                                               362   1e-119   
gb|AFW66785.1|  catalase3 isoform 1                                     368   1e-119   
gb|AGT16203.1|  catalase                                                361   2e-119   
gb|AGT16054.1|  catalase                                                361   2e-119   
gb|AGT16188.1|  catalase                                                361   3e-119   
gb|KDD77132.1|  catalase                                                360   3e-119   
gb|AJF34884.1|  catalase                                                360   4e-119   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               359   9e-119   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               359   1e-118   
gb|AGT15888.1|  catalase                                                359   1e-118   
ref|NP_001274863.1|  catalase isozyme 1                                 358   2e-118   
ref|NP_001234827.1|  catalase isozyme 1                                 358   2e-118   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      358   2e-118   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      358   2e-118   
emb|CDY31488.1|  BnaC05g15970D                                          358   3e-118   
gb|ABC01913.1|  catalase isozyme 1-like protein                         357   5e-118   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    357   5e-118   
gb|EMS51034.1|  Catalase isozyme 2                                      358   6e-118   
gb|AAR97905.1|  catalase                                                357   7e-118   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    357   7e-118   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          357   9e-118   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          357   1e-117   
emb|CAA85470.1|  catalase                                               356   1e-117   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          356   1e-117   
gb|AAC48918.1|  salicylic acid binding catalase                         356   2e-117   
ref|XP_011022275.1|  PREDICTED: catalase-like                           354   5e-117   
dbj|BAF91369.1|  catalase                                               355   6e-117   
gb|ABB72796.1|  catalase isozyme 1-like protein                         354   9e-117   
gb|EMT06167.1|  Catalase isozyme 2                                      360   2e-116   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              353   2e-116   
ref|XP_001779509.1|  predicted protein                                  352   1e-115   
ref|NP_001105416.1|  catalase isozyme 3                                 350   3e-115   
gb|AAC84138.1|  catalase                                                339   4e-115   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               350   5e-115   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                349   6e-115   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        348   4e-114   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   351   4e-114   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 346   9e-114   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     347   2e-113   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          335   2e-109   
gb|ADI58890.1|  catalase                                                323   5e-109   
ref|XP_005708279.1|  catalase                                           332   5e-108   
gb|AAL38024.1|AF443179_1  catalase                                      319   9e-107   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          325   1e-105   
gb|AII80275.1|  catalase                                                311   1e-102   
gb|ADR01107.1|  catalase 3                                              312   8e-102   
gb|AHF27432.1|  catalase                                                314   1e-101   
dbj|BAH20307.1|  AT1G20620                                              314   2e-101   
gb|ACJ71242.1|  catalase 1                                              306   2e-101   
ref|XP_005536240.1|  catalase                                           314   5e-101   
gb|AAD37788.1|AF149283_1  catalase 1                                    311   6e-101   
gb|AHF27429.1|  catalase                                                312   8e-101   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    309   7e-100   
gb|AIR77003.1|  catalase                                                304   9e-100   
gb|KHG11966.1|  Catalase isozyme 2                                      303   4e-99    
emb|CBI29557.3|  unnamed protein product                                296   1e-98    
gb|AEG89525.1|  catalase                                                302   3e-98    
ref|XP_005644653.1|  catalase-domain-containing protein                 302   2e-95    
gb|ABR16304.1|  unknown                                                 299   2e-95    
gb|ACJ71243.1|  catalase 2                                              286   1e-93    
emb|CAB16750.1|  catalase                                               286   3e-93    
gb|AAO12509.1|  catalase                                                283   4e-93    
emb|CDP01802.1|  unnamed protein product                                291   1e-92    
emb|CAC37634.1|  catalase 1                                             283   9e-92    
ref|XP_005642928.1|  catalase                                           290   1e-91    
emb|CDW92180.1|  putative catalase                                      281   5e-91    
ref|XP_005647994.1|  catalase-domain-containing protein                 288   6e-91    
emb|CDW92181.1|  putative catalase                                      280   1e-90    
gb|AEQ94083.1|  putative catalase                                       280   4e-90    
emb|CAP74531.1|  putative Td650 protein                                 274   1e-88    
emb|CAJ00337.1|  putative catalase                                      271   4e-87    
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             268   8e-86    
ref|XP_005712277.1|  unnamed protein product                            275   9e-86    
ref|WP_028402967.1|  catalase                                           273   2e-85    
gb|ACY30463.1|  catalase                                                266   1e-84    
ref|WP_002617638.1|  catalase                                           270   1e-83    
emb|CAB56850.1|  catalase                                               267   1e-83    
ref|WP_035405433.1|  catalase                                           268   3e-83    
dbj|GAE06714.1|  catalase                                               260   3e-83    
gb|AEA86312.1|  catalase isozyme                                        258   3e-83    
ref|WP_034700019.1|  catalase                                           268   5e-83    
ref|WP_024632816.1|  MULTISPECIES: catalase                             266   1e-82    
gb|ADU56189.1|  catalase 1                                              255   2e-82    
gb|EJF09706.1|  catalase                                                266   2e-82    
ref|WP_040574212.1|  catalase                                           266   2e-82    
ref|WP_002638677.1|  catalase                                           266   2e-82    
gb|AFC35182.1|  catalase dismutase                                      259   2e-82    
ref|WP_017691823.1|  catalase                                           265   3e-82    
gb|AAN78323.1|  catalase1                                               255   4e-82    
ref|WP_036667842.1|  catalase                                           265   4e-82    
ref|WP_036612802.1|  catalase                                           265   6e-82    
ref|WP_044186614.1|  catalase                                           265   7e-82    
ref|WP_002978792.1|  catalase                                           265   9e-82    
ref|WP_011983963.1|  catalase                                           264   1e-81    
ref|WP_043068684.1|  catalase                                           263   1e-81    
ref|WP_026975362.1|  catalase                                           263   2e-81    
gb|AFE09157.1|  catalase KatB                                           264   2e-81    
ref|WP_043321484.1|  catalase                                           264   2e-81    
gb|AFC01205.1|  catalase                                                256   2e-81    
ref|WP_026798903.1|  catalase                                           263   2e-81    
ref|WP_006207005.1|  catalase                                           263   2e-81    
gb|AEB22071.1|  catalase 2                                              251   2e-81    
ref|WP_038700758.1|  catalase                                           263   3e-81    
ref|WP_036640075.1|  catalase                                           263   3e-81    
ref|XP_004366029.2|  catalase isozyme 2                                 265   3e-81    
ref|WP_006256937.1|  MULTISPECIES: catalase                             263   4e-81    
ref|WP_006266515.1|  catalase                                           263   4e-81    
ref|WP_006263075.1|  catalase                                           263   4e-81    
ref|WP_002162341.1|  catalase                                           262   5e-81    
gb|AAS40190.1|  catalase                                                261   6e-81    
ref|WP_001069185.1|  catalase                                           262   7e-81    
ref|WP_043072359.1|  catalase                                           261   8e-81    
ref|WP_001069175.1|  catalase                                           261   9e-81    
ref|WP_003211348.1|  catalase                                           261   1e-80    
ref|WP_038335781.1|  catalase                                           262   1e-80    
ref|WP_033673856.1|  catalase                                           261   1e-80    
ref|WP_038413367.1|  catalase                                           261   1e-80    
ref|WP_017674668.1|  catalase                                           261   1e-80    
ref|WP_035957730.1|  catalase                                           262   1e-80    
ref|WP_001069181.1|  MULTISPECIES: catalase                             261   1e-80    
ref|WP_026590478.1|  catalase                                           261   1e-80    
ref|WP_000184219.1|  catalase                                           261   1e-80    
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                     258   1e-80    
ref|WP_001069180.1|  MULTISPECIES: catalase                             261   1e-80    
ref|WP_035435964.1|  catalase                                           261   1e-80    
ref|WP_019973735.1|  catalase                                           261   1e-80    
ref|WP_038987770.1|  catalase                                           261   1e-80    
ref|WP_002194469.1|  catalase                                           261   1e-80    
ref|WP_012009409.1|  catalase                                           261   1e-80    
ref|WP_008359888.1|  catalase                                           261   1e-80    
ref|WP_000184218.1|  catalase                                           261   1e-80    
ref|WP_016113754.1|  catalase                                           261   1e-80    
ref|WP_034637475.1|  catalase                                           261   1e-80    
ref|WP_001069190.1|  catalase                                           261   1e-80    
ref|WP_016122096.1|  catalase                                           261   1e-80    
ref|WP_001069173.1|  catalase                                           261   1e-80    
ref|WP_002201400.1|  catalase                                           261   1e-80    
ref|WP_029279140.1|  catalase                                           261   1e-80    
ref|WP_017673056.1|  catalase                                           261   1e-80    
ref|WP_016088914.1|  catalase                                           261   1e-80    
ref|WP_034282264.1|  catalase                                           261   2e-80    
ref|WP_001069174.1|  catalase                                           261   2e-80    
ref|WP_002202803.1|  catalase                                           261   2e-80    
ref|WP_034663722.1|  catalase                                           261   2e-80    
ref|WP_016104158.1|  catalase                                           261   2e-80    
ref|WP_016103618.1|  catalase                                           261   2e-80    
ref|WP_001069169.1|  MULTISPECIES: catalase                             261   2e-80    
ref|WP_001069170.1|  catalase                                           261   2e-80    
ref|WP_001069178.1|  catalase                                           261   2e-80    
ref|WP_001069179.1|  MULTISPECIES: catalase                             261   2e-80    
ref|WP_036273058.1|  catalase                                           261   2e-80    
ref|WP_001069158.1|  MULTISPECIES: catalase                             261   2e-80    



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTH+I+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVNTYTLIN  214



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/214 (95%), Positives = 214/214 (100%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT+LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLIN  214



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+H+TCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   430 bits (1105),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FL DDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   431 bits (1109),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYN+PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMDGSGVNTYNLIN  214



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   431 bits (1109),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FL DDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   430 bits (1105),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FL DDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   431 bits (1107),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIPQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLFDDLGIPQDYRHMEGSGVNTYTLIS  214



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   430 bits (1106),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   430 bits (1106),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFF+VTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLIN  214



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   431 bits (1108),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FL DDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLLDDIGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   430 bits (1105),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMEGSGVNTYMLIN  214



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS++NSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHMEGSGVNTY L+N
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYMLVN  214



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDIGVPQDYRHMEGSGVNTYTLIN  214



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   429 bits (1103),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLIN  214



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   429 bits (1103),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPSSA+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLIN  214



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   429 bits (1103),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   429 bits (1102),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSP++TTNSGAP+WNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   426 bits (1095),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLIN  214



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   428 bits (1101),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFE THDI++LTCADFLRAPGVQTP+ILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLIN  214



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   428 bits (1100),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPS+A++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMDGSGVNTYTLIN  214



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF++TNSGAPVWNNNSSLTVG+RGPI+LEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMEGSGVNTYTLIN  214



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   427 bits (1098),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK R SSA+N+PF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   427 bits (1098),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RG  LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   427 bits (1098),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   427 bits (1097),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSS+TVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   426 bits (1096),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   426 bits (1096),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   426 bits (1096),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPS+A+NSPF+TTNSGAP+WNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTYTLI+
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYTLIS  214



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   426 bits (1096),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIG+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMDGSGVNTYTLIN  214



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   422 bits (1085),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHER SPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   426 bits (1094),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   426 bits (1094),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   426 bits (1094),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   426 bits (1094),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNS FFTTNSGAPVWNNNSSLTVGSRGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLIN  214



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   426 bits (1094),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+T NSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLIN  214



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   426 bits (1094),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSP+FTTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P DYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLFDDVGVPTDYRHMEGSGVNTYTLIS  214



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   426 bits (1094),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   426 bits (1094),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLIN  214



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPS A+NSPF TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGSGVNTYTLIN  214



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPFFTTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGVNTYTLI+
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVNTYTLID  214



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+++P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGSGVNTYTLIN  214



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+N PFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVH+LKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP DYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPMDYRHMDGFGVNTYTLIN  214



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPV+NNNSSL+VG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+GSGV+TYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGSGVHTYTLIN  214



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++SPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYVLIN  214



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   424 bits (1091),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  214



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   425 bits (1092),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DD+G+PQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLIS  214



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   424 bits (1090),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   426 bits (1094),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   424 bits (1089),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DD+G+PQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLIS  214



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   424 bits (1091),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NS FFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGAS+KGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSHIQE WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSG+NTYTLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGINTYTLIN  214



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   424 bits (1090),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLIN  214



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   424 bits (1090),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLIN  214



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   424 bits (1090),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVK YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   422 bits (1085),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLIN  214



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   424 bits (1089),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   423 bits (1088),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP+K RPSSA+N+ F+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  214



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   424 bits (1089),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 201/214 (94%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPFFTTNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFL DDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLLDDIGIPQDYRHMDGSGVNTYTLIN  214



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   424 bits (1089),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGV+TYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLIN  214



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   424 bits (1089),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLR PGVQTP+I+RFSTVIHERGSPE++RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIN  214



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   424 bits (1089),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGV+TYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLIN  214



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   424 bits (1089),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   422 bits (1085),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGV+TYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLIN  214



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   423 bits (1088),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA++SPFFTTNSGAPVWNNNSSL+VG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  214



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   423 bits (1088),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+++SPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+PQDYRHM+GSGV+TYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLIN  214



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   423 bits (1088),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   423 bits (1088),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDVGVPQDYRHMDGSGVNTYTLIN  214



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   423 bits (1088),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEG+GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLIN  214



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   423 bits (1088),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSP++TTNSGA VWNNNSSLTVGSRGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEG+GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGAGVNTYTLIN  214



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   423 bits (1088),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA NSP++TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGSGVNTYTLIN  214



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+TTNSGAPVWNNN SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLT ADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNP+SHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+GSGVNTY+LIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYSLIN  214



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA+NS ++TTNSGAPVWNNNSSLTVG+RGPILLEDY LVEK++NFDRERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLIN  214



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTN GAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   423 bits (1087),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPQDYRHMDGFGVNTYTLIN  214



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENW VLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIG+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGVPQDYRHMEGSGVNTYMLIN  214



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+++P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   422 bits (1086),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  214



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   422 bits (1084),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   422 bits (1085),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA+NSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFP FF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DD+G+PQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLLDDLGVPQDYRHMEGSGVNTYTLIS  214



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   422 bits (1085),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   423 bits (1087),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFT NSGAPVWNNNS +TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   422 bits (1084),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLIN  214



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   419 bits (1077),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTY+LIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLIN  214



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   421 bits (1083),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   421 bits (1082),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVK YT EGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   421 bits (1083),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   420 bits (1079),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +3

Query  57   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  236
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  237  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  416
            RVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  417  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPE  596
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  597  SLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            SLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  SLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  213



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   421 bits (1083),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 197/208 (95%), Positives = 207/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  72   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  251
            RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  5    RPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHA  64

Query  252  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  431
            RGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  65   RGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  124

Query  432  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMF  611
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMF
Sbjct  125  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMF  184

Query  612  TFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            +FL DDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  185  SFLLDDIGVPQDYRHMEGSGVNTYTLIN  212



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P DYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLIN  214



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   421 bits (1082),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPV++N+ SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDDIGIPQDYRHMEGSGVNTYTL+N
Sbjct  181  ESLHMFSFLFDDIGIPQDYRHMEGSGVNTYTLVN  214



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   421 bits (1082),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAP+WNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   421 bits (1081),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +3

Query  57   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  236
            DPYK RPSSA+ +P++TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  237  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  416
            RVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  417  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPE  596
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  597  SLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            SLHMF+FLFDD+G+PQDYRHMEGSGVNTY LIN
Sbjct  181  SLHMFSFLFDDLGVPQDYRHMEGSGVNTYMLIN  213



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 219/231 (95%), Gaps = 4/231 (2%)
 Frame = +3

Query  3    LILAFIFFLNSSLQLPLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLE  182
            +IL   FF ++S  L L+   + RPSS+YNSPFFTTNSGAPVWNNNSSLTVGSRGPILLE
Sbjct  7    VILPLSFFKSNSC-LCLI---QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLE  62

Query  183  DYHLVEKLSNFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRF  362
            DYHLVEKL+NFDRERIPERVVHARGASAKGFFEVT+DI+HLTCADFLRAPGVQTP+I+RF
Sbjct  63   DYHLVEKLANFDRERIPERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRF  122

Query  363  STVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPK  542
            STVIHE GSPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK
Sbjct  123  STVIHELGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPK  182

Query  543  SHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            SHIQENWR+LDFFSHHPESLHMF+FLFDDIG+PQDYRHMEGSGVNTYTLIN
Sbjct  183  SHIQENWRILDFFSHHPESLHMFSFLFDDIGVPQDYRHMEGSGVNTYTLIN  233



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA +SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+ VNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGASVNTYMLIN  214



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDF SHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLIN  214



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   420 bits (1080),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLIN  214



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   416 bits (1070),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD G+PQDYRHM+G GVNTY+L+N
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVN  214



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   420 bits (1079),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLT G+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLIN  214



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWRV+DFFS HP
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  214



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP K RPSSA+NSPF+TTNSGA VWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIPQDYRHMEG GVNTYTLI+
Sbjct  181  ESLHMFTFLFDDVGIPQDYRHMEGFGVNTYTLID  214



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/214 (93%), Positives = 210/214 (98%), Gaps = 1/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFT NSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  180  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  213



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   416 bits (1069),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD G+PQDYRHM+G GVNTY+L+N
Sbjct  181  ESLHMFSFLFDDWGVPQDYRHMDGFGVNTYSLVN  214



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   419 bits (1078),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADF+RAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRV+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P +YRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLIN  214



>prf||1906388A catalase
Length=492

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSP+FT NSGAPVWNNN+SLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP +YRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGIPANYRHMEGSGVNTYTLIN  214



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 210/213 (99%), Gaps = 0/213 (0%)
 Frame = +3

Query  57   DPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPE  236
            DPYK RPSSA+NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  237  RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRG  416
            RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  417  FAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPE  596
            FAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  597  SLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            SLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  SLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  213



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+ DGM FPDMVHALKPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTY+LIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYSLIN  214



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   419 bits (1077),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P DYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLIN  214



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   419 bits (1077),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA N+P+ TTNSGAPVWNNNSSLTV  RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADF+RAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRV+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P +YRHMEGSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDIGVPANYRHMEGSGVNTYTLIN  214



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   419 bits (1077),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVT+D++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P DYRHM+GSGVNTYT IN
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTFIN  214



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   419 bits (1076),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DDIG+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLLDDIGVPQDYRHMDGSGVNTYTLIN  214



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   419 bits (1076),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSP FTTNSGAPVWN+NSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFE THDI+HLTCADFLR+PGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP +YRHMEGSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPANYRHMEGSGVNTYTLVN  214



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   417 bits (1073),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 207/207 (100%), Gaps = 0/207 (0%)
 Frame = +3

Query  75   PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHAR  254
            PSSAY+SPF+TTNSGAPVWNNNSSLT+G+RGPILLEDYHLVEKL+NFDRERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  255  GASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  434
            GASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  435  TREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFT  614
            TREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFT
Sbjct  121  TREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFT  180

Query  615  FLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            FLFDD+GIPQDYRHMEGSGVNTYTLI+
Sbjct  181  FLFDDLGIPQDYRHMEGSGVNTYTLIS  207



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   418 bits (1075),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLIN  214



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  214



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  214



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++SP++TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEK+ NFDRERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAK FFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTYTL+N
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLVN  214



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NS F TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++NSP ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVN  214



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   418 bits (1074),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+P+DYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLIN  214



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF TTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMDGFGVNTYMLIN  214



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+P+DYRHMEGSGVNTY LIN
Sbjct  181  ESLHMFSFLFDDVGVPRDYRHMEGSGVNTYMLIN  214



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++N P ++TNSGAPVWNNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
             FA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSH+QENWR+LDFFSHHP
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA+NSPF+TTNSGAPVWNNN+SLTVG+RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGV+TYTL++
Sbjct  181  ESLHMFTFLFDDIGIPTDYRHMDGSGVHTYTLVS  214



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RG ILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIH RGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTY LIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYMLIN  214



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+GSGV+TYTL++
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVS  214



>prf||2104177A catalase
Length=492

 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK R SSAYN+PF+TTNSGAPV+NNN+SLTVGSRGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LTCADFLRAPGVQTP+I+R STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQE+WR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DDIG+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLLDDIGVPQDYRHMDGSGVNTYTLIN  214



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   417 bits (1071),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLIN  214



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 206/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  72   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  251
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  252  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  431
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  64   RGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  123

Query  432  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMF  611
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MF
Sbjct  124  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMF  183

Query  612  TFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            TFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  184  TFLFDDIGIPQDYRHMEGSGVNTYMLIN  211



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 206/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  72   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  251
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  4    RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  63

Query  252  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  431
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  64   RGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  123

Query  432  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMF  611
            YTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESL+MF
Sbjct  124  YTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLNMF  183

Query  612  TFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            TFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  184  TFLFDDIGIPQDYRHMEGSGVNTYMLIN  211



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   416 bits (1070),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+NRPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHA KPNPKSH+QENWR+ DF SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHM TFL DD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMLTFLLDDLGIPQDYRHMEGSGVNTYTLIN  214



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   416 bits (1070),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTNSGAPV NNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHE GSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DD+G+PQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLSDDLGVPQDYRHMEGSGVNTYTLIS  214



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   416 bits (1070),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCAD LRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+P +YRHM+GSGV+T+TL+N
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVN  214



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   416 bits (1070),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+N P ++TNSGAPVW+N+ SLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGP+ LEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPII+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDG+KFPDMVHALKPNPKSH+QENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+G GVNTY+LIN
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLIN  214



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   416 bits (1069),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLIN  214



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+GSGV+TYTL++
Sbjct  181  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVS  214



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   416 bits (1069),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHMEGSGVNTYTLI+
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLIS  214



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   416 bits (1069),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVN  214



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   416 bits (1068),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS++N P ++TNSGAPVWNN++SLTVG RGPILLEDYHLVEK++NFDRERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   416 bits (1068),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY+ RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+R STVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  214



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK++NFDRERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEG GVNTYTL+N
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLN  214



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA NSPF+TTNSGAPVWNNNSSLTVG+RGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFL APGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P DYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPADYRHMDGSGVNTYTLIN  214



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS YNSPF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTPII+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+P +YRHM+GSGV+T+TL+N
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLLN  214



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   413 bits (1062),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 205/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  72   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  251
            RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  44   RPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVHA  103

Query  252  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  431
            RGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  104  RGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKF  163

Query  432  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMF  611
            YTREGNFD+VGNN PVFFIRDGMKFPDMVHALKPNPKSHIQENWRV+DFFSHHPESL+MF
Sbjct  164  YTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSHHPESLNMF  223

Query  612  TFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            TFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  224  TFLFDDIGIPQDYRHMEGSGVNTYMLIN  251



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPV+NNNSSLTVG+RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHALKPNPK+HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLI+
Sbjct  181  ESLHMFSFLFDDLGVPQDYRHMDGFGVNTYTLIS  214



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTL+N
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLLN  214



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSP++TTNSGAP WNNNSSLTVG+RGPILLEDY LVE ++NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFS VIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKP+PKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPSPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DDIG+PQDYRHMEGSGVNTY+LIN
Sbjct  181  ESLHMFTFLLDDIGVPQDYRHMEGSGVNTYSLIN  214



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGVPADYRHMDGSGVNTYTLVN  214



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSPF+TTN+GAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRA GVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHM+GSGV+T+TL+N
Sbjct  181  ESLHMFTFLFDDLGIPLNYRHMDGSGVHTFTLVN  214



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   414 bits (1064),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS++N P ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA+KFYTREGN+D+ GNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSHHP
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIP DYRHM+GSGVNTYTL+N
Sbjct  181  ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVN  214



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   414 bits (1064),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKNRPSSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLR+PGVQTP+I+RFSTV +ERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVTNERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVH LK NPKS+IQE+WR LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHCLKSNPKSNIQESWRSLDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+PQDYRHM+GSGVNTYTLI+
Sbjct  181  ESLHMFTFLFDDLGVPQDYRHMDGSGVNTYTLIS  214



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   414 bits (1063),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKVVPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LI+
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIS  214



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   413 bits (1062),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS YNSPF+TTNSGAPVWNNN+S+TVGSRGPILLEDYHLVEK++ FDRERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIG+P +YRHM+GSGV+T+TLI+
Sbjct  181  ESLHMFTFLFDDIGVPLNYRHMDGSGVHTFTLIS  214



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   413 bits (1062),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYN+PF+TTN GAPV+NN+SSLTVG+RGPILLEDYH VEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVH+LKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHIQEDWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DD+G+PQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLHMFTFLQDDVGVPQDYRHMDGSGVNTYTLIN  214



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   413 bits (1062),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSAYNSPF+TTNSGAPVWNNNSSLT+GSRGPILLEDYHLVEK++ FDRER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCAD LRAPGVQTP+I+RFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQE+WR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+P +YRHM+GSGV+T+TL+N
Sbjct  181  ESLHMFSFLFDDVGVPLNYRHMDGSGVHTFTLVN  214



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   413 bits (1061),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LI+
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYLLIS  214



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   413 bits (1061),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYH++EKL+ FDRERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDG+KFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+G GVNTY+LI+
Sbjct  181  ESLHMFSFLFDDVGIPSDYRHMDGFGVNTYSLIS  214



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   413 bits (1061),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNS  FTTN+GAPVWNNN+SLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFF+RDGMKFPDMVHALKPNP++HIQENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFL DDIGIP +YRHMEG GV+T+TL+N
Sbjct  181  ESLHMFTFLLDDIGIPLNYRHMEGFGVHTFTLVN  214



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   415 bits (1067),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA++S F+TTNSGAPVWNNN+SLTVG+RGP+LLEDYHL+EK++NFDRERIP
Sbjct  93   MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  152

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  153  ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  212

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHP
Sbjct  213  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  272

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHMEG GVNTYTL+N
Sbjct  273  ESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLN  306



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   412 bits (1058),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF TTNSGAP  NNNS LTVG+RG +LLEDYHLVEKL+NFDRER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLIN  214



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSSA+N+PF+TTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKF   VH LKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFTRHVHPLKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MF+FLFDDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFSFLFDDIGIPQDYRHMDGSGVNTYTLIN  214



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 207/210 (99%), Gaps = 0/210 (0%)
 Frame = +3

Query  66   KNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVV  245
            ++RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+NFDRERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  246  HARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAV  425
            HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  426  KFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLH  605
            KFYTREGNFD+VGNNFPVFF+ DGMKFPDMVHALKPNPKSHIQENWR+LDFFSH PESLH
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185

Query  606  MFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            MF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  186  MFSFLFDDVGVPQDYRHMDGFGVNTYTLIN  215



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+NSPF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFF+ DGM FPDMVHALKPNP++HIQENWR+LDFF + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+G+PQDYRHM+G GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGVPQDYRHMDGFGVNTYTLIN  214



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 204/206 (99%), Gaps = 0/206 (0%)
 Frame = +3

Query  78   SSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHARG  257
            SSA+NSPF TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  258  ASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYT  437
            ASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  438  REGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTF  617
            REGNFD+VGNNFPVFFIRDGMKFPDMVH+LKPNPKSHIQENWRVLDFFSHHPESLHMFTF
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLHMFTF  180

Query  618  LFDDIGIPQDYRHMEGSGVNTYTLIN  695
            LFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  LFDDIGIPQDYRHMDGSGVHTFTLIN  206



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   410 bits (1055),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK  PSSA++SPFFTTNSGAPV+NNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKVIPSSAHDSPFFTTNSGAPVFNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTH I+ LTCADFLR PGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHGISQLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LI+
Sbjct  181  ESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIS  214



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPY++RPSS YN+PF+TTNSGAPVWNNNSSLTVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDIT+L+CADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDIGIPQDYRHMDGSGVNTYTLIN  214


 Score =   419 bits (1076),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 208/209 (99%), Gaps = 0/209 (0%)
 Frame = +3

Query  69   NRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVH  248
            NRPSSA+++PF+TTNSGAPVWNNNS+LT+GSRGPILLEDYHLVEKL+NFDRERIPERVVH
Sbjct  487  NRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVH  546

Query  249  ARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVK  428
            ARGASAKGFFEVTHDITHLTCADFLRAPG QTP+I+RFSTVIHERGSPETLRDPRGFAVK
Sbjct  547  ARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGFAVK  606

Query  429  FYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHM  608
            FYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESLHM
Sbjct  607  FYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHM  666

Query  609  FTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            FTFLFDD+GIPQDYRHM+GSGVNTYTLIN
Sbjct  667  FTFLFDDLGIPQDYRHMDGSGVNTYTLIN  695



>prf||1803522A catalase
Length=491

 Score =   409 bits (1052),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 211/214 (99%), Gaps = 1/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSHHP
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+GSGV+TYTL++
Sbjct  180  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVS  213



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 211/214 (99%), Gaps = 1/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+N+P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSHHP
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+GSGV+TYTL++
Sbjct  180  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVS  213



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 205/207 (99%), Gaps = 0/207 (0%)
 Frame = +3

Query  75   PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHAR  254
            PSSA+NSPF TTNSGAPV+NNNSSLTVG+RGP+LLEDYHLVEKL+NFDRER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  255  GASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFY  434
            GASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFY
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  435  TREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFT  614
            TREGNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH PESLHMFT
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLHMFT  180

Query  615  FLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            FLFDDIGIPQDYRHM+GSGV+T+TLIN
Sbjct  181  FLFDDIGIPQDYRHMDGSGVHTFTLIN  207



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 208/210 (99%), Gaps = 0/210 (0%)
 Frame = +3

Query  66   KNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVV  245
            ++RPSS++NSP ++TNSGAPVWNN++SLTVGSRGPILLEDYHLVEK+++FDRERIPERVV
Sbjct  46   QHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIPERVV  105

Query  246  HARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAV  425
            HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFA+
Sbjct  106  HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAI  165

Query  426  KFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLH  605
            KFYTREGN+D+VGNNFPVFFIRDGMKFPDMVHALKPNPK+HIQENWRVLDFFSHHPESLH
Sbjct  166  KFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHPESLH  225

Query  606  MFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            MFTFLFDDIG+P DYRHM+GSGVNTYTL+N
Sbjct  226  MFTFLFDDIGVPADYRHMDGSGVNTYTLVN  255



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   407 bits (1046),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYKN PS+AYN  F+TTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTH+++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHA KPNPKSHIQE+WR+ DF SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHIQESWRIFDFLSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHM TFLFDD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  181  ESLHMLTFLFDDLGIPQDYRHMEGSGVNTYTLIN  214



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   407 bits (1046),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 206/208 (99%), Gaps = 0/208 (0%)
 Frame = +3

Query  72   RPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHA  251
            RP+S++N+PFFTTNSGAPVWNNNSS+T+G RGPILLEDYHLVEKL+NFDRERIPERVVHA
Sbjct  27   RPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIPERVVHA  86

Query  252  RGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKF  431
            RGASAKGFFEVTHD+++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKF
Sbjct  87   RGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKF  146

Query  432  YTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMF  611
            YTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR++DFFSHHPESLHMF
Sbjct  147  YTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMF  206

Query  612  TFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            +FLFDD+G+P+DYRHMEGSGVNTY LIN
Sbjct  207  SFLFDDVGVPRDYRHMEGSGVNTYMLIN  234



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   406 bits (1043),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   406 bits (1043),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   405 bits (1042),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 209/214 (98%), Gaps = 1/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+N P++TTNSGAPVWNN+SSLTVG+RGPILLEDYH  EKL+NFDRERIP
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAV FYTREGN+D+VGNNFPVFFIRDG+KFPDMVHALKPNP++HIQ+NWR+LDFFSHHP
Sbjct  120  GFAVNFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP DYRHM+GSGV+TYTL++
Sbjct  180  ESLHMFSFLFDDVGIPADYRHMDGSGVHTYTLVS  213



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLIN  214



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 204/214 (95%), Gaps = 7/214 (3%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RP+S+YNSPFFTTNSGAPVWNNNSS+TVG RGPILLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA       GNFD+VGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP
Sbjct  121  GFA-------GNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  173

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDDIGIPQDYRHMEGSGVNTY LIN
Sbjct  174  ESLNMFTFLFDDIGIPQDYRHMEGSGVNTYMLIN  207



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLIN  214



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP + RPSSA++SPF+TTNSGAPVWNNN+SLTVG RGPILLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPERVRPSSAHDSPFWTTNSGAPVWNNNASLTVGPRGPILLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI++L+CADFLR  GVQTP+I RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRGTGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN D+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHP
Sbjct  121  GFAVKFYTREGNLDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIPQDYRHM+G GVNTY LIN
Sbjct  181  ESLHMFSFLFDDVGIPQDYRHMDGFGVNTYVLIN  214



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQ P+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQAPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   405 bits (1040),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDG+KFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGLKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>sp|P18122.1|CATA1_MAIZE RecName: Full=Catalase isozyme 1 [Zea mays]
Length=492

 Score =   405 bits (1040),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTY+LIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYSLIN  214



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTY+LIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYSLIN  214



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PV FIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVK YTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVH  KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHVFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   403 bits (1036),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+G+PQDYRHMEG GV++YTLI+
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLIS  214



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   403 bits (1036),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   403 bits (1036),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   403 bits (1035),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTN+GAPVWNNNSSLTVGSRGP+LLEDYHL+EKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+G+PQDYRHMEG GV++YTLI+
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHSYTLIS  214



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSASNSSFWTTNSGAPVWNNNSALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHM+G GVNTYT IN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMDGFGVNTYTFIN  214



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  48   PLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRER  227
            P MDPY++RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRER
Sbjct  54   PAMDPYRHRPSSGNNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRER  113

Query  228  IPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRD  407
            IPERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRD
Sbjct  114  IPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRD  173

Query  408  PRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  587
            PRGFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSH
Sbjct  174  PRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSH  233

Query  588  HPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            HPES+HMFTFLFDD+GIP +YRHMEG GVNTYTLI+
Sbjct  234  HPESMHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIS  269



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   401 bits (1031),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLED+HL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDHHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERV HARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVAHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+G+P +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGVPLNYRHMEGFGVNTYTLIN  214



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   401 bits (1031),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RP S  NS  +TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPPSGSNSILWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   401 bits (1030),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGA VWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGASVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PV FIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVLFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   401 bits (1030),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGS ETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSSETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   400 bits (1027),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  N+ F++TNSGAPVWNNN++LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGANAGFWSTNSGAPVWNNNNALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   400 bits (1027),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLR+PR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLREPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP ++RHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNHRHMEGFGVNTYTLIN  214



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   399 bits (1026),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EK + FDRERIP
Sbjct  1    MDPYKHRPSSGSNSIFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKPAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLR PR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRGPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   398 bits (1022),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS YN+PF+TTN G+PVWNNN+SLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPE +RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WR++DFFSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ES +MFTFLFDDIGIP DYRHMEG GV+T+ LIN
Sbjct  181  ESCNMFTFLFDDIGIPADYRHMEGFGVHTFKLIN  214



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   397 bits (1021),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+R SS  NS F+TTNSGAPVWNNNS+LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRASSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN P FFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPGFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMF+FLFDD+GIP +YRHMEG GVNTYTLIN
Sbjct  181  ESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLIN  214



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   397 bits (1020),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA+++PF+TTNSGAPVWNN+SSLTVGSRGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQENWR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLH F F +DD+GIPQDYRHMEGS V+ YTLI+
Sbjct  181  ESLHTFAFFYDDLGIPQDYRHMEGSSVHAYTLIS  214



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 195/197 (99%), Gaps = 0/197 (0%)
 Frame = +3

Query  105  TTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERVVHARGASAKGFFEV  284
            TTNSGAPVWNNNSSLTVG+RGP+LLEDYHLVEKL+NFDRERI ERVVHARGASAKGFFEV
Sbjct  1    TTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARGASAKGFFEV  60

Query  285  THDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVG  464
            THDI HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFAVKFYTREGNFD+VG
Sbjct  61   THDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVG  120

Query  465  NNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQ  644
            NNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR+LDFFSHHPESLHMFTFLFDDIGIPQ
Sbjct  121  NNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQ  180

Query  645  DYRHMEGSGVNTYTLIN  695
            DYRHM+GSGV+T+TLIN
Sbjct  181  DYRHMDGSGVHTFTLIN  197



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL+NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFFIRD MKFPD++HA KPNPKSHIQE WRV+DF S+HP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+G+PQDYRHMEG GV+T+TLIN
Sbjct  181  ESLSTFAFLFDDVGVPQDYRHMEGFGVHTFTLIN  214



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSAYNSP+FTTN+GAPV+NN+SSLTVGSRGP+LLEDYHLVEKL+NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNNFPVFFIRD MKFPD++HA KPNPKSHIQE WRV+DF S+HP
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+GIPQDYRHMEG GV+T+TL+N
Sbjct  181  ESLSTFAFLFDDVGIPQDYRHMEGFGVHTFTLLN  214



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   395 bits (1016),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RP+S  NS ++TTNSGAPVWNNN++LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWRV+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRVVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHM+G GVNTYTLI+
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMDGFGVNTYTLIS  214



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 210/248 (85%), Gaps = 34/248 (14%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSR-----------------------  164
            MDPYK RPSS++N+P ++TNSGAPVWNN++SLTVGSR                       
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRDSPKKSSNAYSDINQEKILEFPK  60

Query  165  -----------GPILLEDYHLVEKLSNFDRERIPERVVHARGASAKGFFEVTHDITHLTC  311
                        PILLEDYHLVEK+++FDRERIPERVVHARGASAKGFFEVTHD++HLTC
Sbjct  61   AAPITFHKNLASPILLEDYHLVEKIADFDRERIPERVVHARGASAKGFFEVTHDVSHLTC  120

Query  312  ADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIR  491
            ADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPRGFA+KFYTREGN+D+VGNNFPVFFIR
Sbjct  121  ADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIR  180

Query  492  DGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSG  671
            DGMKFPDMVHALKPNPK+HIQENWR+LDFFSHHPESLHMFTFLFDDIG+P DYRHM+GSG
Sbjct  181  DGMKFPDMVHALKPNPKTHIQENWRILDFFSHHPESLHMFTFLFDDIGVPADYRHMDGSG  240

Query  672  VNTYTLIN  695
            VNTYTL+N
Sbjct  241  VNTYTLVN  248



>ref|XP_002961779.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
 ref|XP_002964850.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ33688.1| hypothetical protein SELMODRAFT_167253 [Selaginella moellendorffii]
 gb|EFJ37039.1| hypothetical protein SELMODRAFT_140901 [Selaginella moellendorffii]
Length=492

 Score =   395 bits (1015),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+ PSSA+NS FFTTNSG PVWNNNSSLTVGSRGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHTPSSAFNSSFFTTNSGTPVWNNNSSLTVGSRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKG+FEVTHDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGYFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFF+RDG+KFPDM+HALKPNPK+H+QE WR++D FSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFVRDGIKFPDMIHALKPNPKTHVQEPWRIMDHFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ES HMFTFLFDD GIP +YRHMEG GV+T+TL+N
Sbjct  181  ESCHMFTFLFDDHGIPLNYRHMEGFGVHTFTLVN  214



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS Y++PF+TTN GAPVWNNN+SLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFDMVGNN PVFFIRDG+KFPDM+HALKPNPKSHIQE WR++DFFSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  692
            E+ +MFTF+FDDIGIP DYRHMEG GV+T+ LI
Sbjct  181  EACNMFTFVFDDIGIPADYRHMEGFGVHTFKLI  213



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   410 bits (1054),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = +3

Query  30   NSSLQLPLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLS  209
            + SL   L      RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+
Sbjct  514  DRSLGQKLASRLNVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLA  573

Query  210  NFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGS  389
            NFDRERIPERVVHARGASAKGFFEVTHDIT LT ADFLR PGVQTP+I+RFSTVIHERGS
Sbjct  574  NFDRERIPERVVHARGASAKGFFEVTHDITQLTSADFLRGPGVQTPVIVRFSTVIHERGS  633

Query  390  PETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRV  569
            PETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+
Sbjct  634  PETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRI  693

Query  570  LDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  694  LDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  735


 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 194/214 (91%), Gaps = 2/214 (1%)
 Frame = +3

Query  57   DPYKNR--PSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERI  230
            DP + R  PSSAYN+PF+TTN GAPV NN SSLT+G RGP+LLEDYHL+EK++NF RERI
Sbjct  39   DPIRKRYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERI  98

Query  231  PERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDP  410
            PERVVHARG SAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTV+HER SPET+RD 
Sbjct  99   PERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDI  158

Query  411  RGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHH  590
            RGFAVKFYTREGNFD+VGNN PVFFIRDG++FPD+VHALKPNPK++IQE WR+LD+ SH 
Sbjct  159  RGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHL  218

Query  591  PESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  692
            PESL  + ++FDD+GIPQDYRHMEG GV+TYTLI
Sbjct  219  PESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLI  252



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+G+PQDYRHMEG GV+ YTLI+
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLIS  214



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSSA+NSPF+TTN+GAPV NNNSSLTVG RGP+LLEDYHLVEKL+NFDRERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HL+CADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGN+D+VGNNFPVFF+RD MKFPD++HA KPNPKSHIQE WRVLDF SHHP
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F FLFDD+G+PQDYRHMEG GV+ YTLI+
Sbjct  181  ESLLTFAFLFDDVGVPQDYRHMEGFGVHAYTLIS  214



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   394 bits (1012),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS +N+PF+TTNSG PV+NN+S+LT+GSRGPILLEDYHLVEK++NF RER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDITHLTCADFLR PGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD++HA KPNPKSHIQE WRVLDF S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSYLP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLH F FLFDD+G+PQDYRHMEGS VNTYTLIN
Sbjct  181  ESLHTFMFLFDDVGVPQDYRHMEGSSVNTYTLIN  214



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 206/223 (92%), Gaps = 0/223 (0%)
 Frame = +3

Query  27   LNSSLQLPLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKL  206
             + SL   L     NRPSS +N+PF+TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EKL
Sbjct  474  CDKSLGQKLASRLNNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKL  533

Query  207  SNFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERG  386
            +NFDRERIPERVVHARGASAKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERG
Sbjct  534  ANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERG  593

Query  387  SPETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWR  566
            SPETLRDPRGFAVKFYTREGNFD+VGNNFPVFFIRDGMKFPD+VHA KPNPKSH+QENWR
Sbjct  594  SPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWR  653

Query  567  VLDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            + DF SH PESLHM TFL DD+GIPQDYRHMEGSGVNTYTLIN
Sbjct  654  IFDFLSHVPESLHMLTFLLDDLGIPQDYRHMEGSGVNTYTLIN  696


 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK RPSS+ ++PF+TTN+GAPV NNNSS+TVG RGPILLEDYH++EKL+NF RERIP
Sbjct  1    MDPYKFRPSSSNDTPFWTTNAGAPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARG SAKGFFEVTHD+T LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFA KFYTREGNFD+VGNNFPVFFIRDG+KFPD+VHA KPNPKSHIQE WR+ DF SHHP
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHIQEYWRIFDFCSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL  F + FDD+GIPQDYRHMEG GV+TY LIN
Sbjct  181  ESLSTFAWFFDDVGIPQDYRHMEGFGVHTYCLIN  214



>gb|AAP80622.1|AF475100_1 catalase isozyme, partial [Triticum aestivum]
Length=268

 Score =   385 bits (990),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = +3

Query  63   YKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIPERV  242
            YK+RP+S  NS ++TTNSGAPVWNNN++LTVG RGPILLEDYHL+EKL+ FDRERIPERV
Sbjct  18   YKHRPTSGANSGYWTTNSGAPVWNNNNALTVGQRGPILLEDYHLIEKLAQFDRERIPERV  77

Query  243  VHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPRGFA  422
            VHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPRGFA
Sbjct  78   VHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPRGFA  137

Query  423  VKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESL  602
            VKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+PK+++QENWR++DFFSHHPESL
Sbjct  138  VKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSPKTNMQENWRIVDFFSHHPESL  197

Query  603  HMFTFLFDDIGIPQDYRHMEGSGVNTYTL  689
            HMFTFLFDD+GIP +YRHM+G GVNTYTL
Sbjct  198  HMFTFLFDDVGIPLNYRHMDGFGVNTYTL  226



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   408 bits (1048),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = +3

Query  30   NSSLQLPLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLS  209
            + SL   L      RPSSA++SPFFTTNSGAPVWNNNSSLTVG+RGPILLEDYHL+EKL+
Sbjct  482  DRSLGQKLASRLNVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLA  541

Query  210  NFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGS  389
            NFDRERIPERVVHARGASAKGFFEVTHDIT LT ADFLR PG QTP+I+RFSTVIHERGS
Sbjct  542  NFDRERIPERVVHARGASAKGFFEVTHDITQLTSADFLRGPGAQTPVIVRFSTVIHERGS  601

Query  390  PETLRDPRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRV  569
            PETLRDPRGFAVKFYTREGNFD+VGNNFPVFF+RDGMKFPDMVHALKPNPKSHIQENWR+
Sbjct  602  PETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRI  661

Query  570  LDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            LDFFSHHPESLHMF+FLFDD+GIPQDYRHMEG+GVNTY LIN
Sbjct  662  LDFFSHHPESLHMFSFLFDDLGIPQDYRHMEGAGVNTYMLIN  703


 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +3

Query  48   PLMDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRER  227
            P  DPY  RPSSAYN+PF+TTN G PV NN SSLT+G RGP+LLEDYHL+EK++NF RER
Sbjct  8    PPGDPY--RPSSAYNAPFYTTNGGTPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRER  65

Query  228  IPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRD  407
            IPERVVHARG SAKGFFEVTHDI++LTCADFLRAPGVQTP+I+RFSTV+HER SPET+RD
Sbjct  66   IPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRD  125

Query  408  PRGFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSH  587
             RGFAVKFYTREGNFD+VGNN PVFFIRDG++FPD+VHALKPNPK++IQE WR+LD+ SH
Sbjct  126  IRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSH  185

Query  588  HPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLI  692
             PESL  + ++FDD+GIPQDYRHMEG GV+TYTL+
Sbjct  186  LPESLLTWCWMFDDVGIPQDYRHMEGFGVHTYTLV  220



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RP+S  NS ++TTNSGAPVWNNN++LTVG RGPILLEDYHL+EKL+ FDRERIP
Sbjct  1    MDPYKHRPTSGANSAYWTTNSGAPVWNNNNALTVGHRGPILLEDYHLIEKLAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHD++ LTCADFLRAPGVQTP+I+RFSTV+HERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSQLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KP+ K+++QENWRV+DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPSSKTNMQENWRVVDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLHMFTFLFDD+GIP +YRHM+G GVNTYTLI+
Sbjct  181  ESLHMFTFLFDDVGIPLNYRHMDGFGVNTYTLIS  214



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDP K RPSS +NSP++TTNSGAPVWNNNSSLTVGSRGPILLEDYHL+EK++ FDRERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+HLTCADFLRAP VQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF RDGMKFP+  HA K NPK+HIQ+NWR++DFFSHHP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFTRDGMKFPEKHHAKKTNPKTHIQDNWRIMDFFSHHP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESL+MFTFLFDD+G P +YRHM+GSGVNTYTLIN
Sbjct  181  ESLNMFTFLFDDLGNPLNYRHMDGSGVNTYTLIN  214



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  54   MDPYKNRPSSAYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLSNFDRERIP  233
            MDPYK+RPSSA++SP++TTN+GAPVWNN+SSLTVG RGP+LLEDYHLVEKL+ FDRERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  234  ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  413
            ERVVHARGASAKGFFEVTHDI+ LTCADFLRAPGVQTP+I+RFSTVIHERGSPETLRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  414  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  593
            GFAVKFYTREGNFD+VGNNFPVFF+RD MKFPD + A KPNPKSHIQE WR+LDFFSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  594  ESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLIN  695
            ESLH F F +DD+G+PQDYRHMEGS V+ YTLI+
Sbjct  181  ESLHTFAFFYDDLGVPQDYRHMEGSSVHAYTLIS  214



Lambda      K        H        a         alpha
   0.315    0.128    0.426    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160