BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020A20

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247610.1|  PREDICTED: transmembrane emp24 domain-contai...    383   9e-132   Solanum lycopersicum
ref|XP_006363461.1|  PREDICTED: transmembrane emp24 domain-contai...    381   4e-131   Solanum tuberosum [potatoes]
ref|XP_007034875.1|  Emp24/gp25L/p24 family/GOLD family protein i...    381   4e-131   Theobroma cacao [chocolate]
ref|XP_009631810.1|  PREDICTED: transmembrane emp24 domain-contai...    380   7e-131   Nicotiana tomentosiformis
ref|XP_009773202.1|  PREDICTED: transmembrane emp24 domain-contai...    380   2e-130   Nicotiana sylvestris
ref|XP_010107717.1|  Transmembrane emp24 domain-containing protein A    376   3e-129   Morus notabilis
gb|KDP40237.1|  hypothetical protein JCGZ_02235                         375   6e-129   Jatropha curcas
ref|XP_002283487.1|  PREDICTED: transmembrane emp24 domain-contai...    375   8e-129   Vitis vinifera
ref|XP_010693774.1|  PREDICTED: transmembrane emp24 domain-contai...    374   1e-128   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002517064.1|  coated vesicle membrane protein, putative          373   6e-128   Ricinus communis
ref|XP_010279262.1|  PREDICTED: transmembrane emp24 domain-contai...    372   9e-128   Nelumbo nucifera [Indian lotus]
ref|XP_011030626.1|  PREDICTED: transmembrane emp24 domain-contai...    371   4e-127   Populus euphratica
gb|KDO74439.1|  hypothetical protein CISIN_1g028009mg                   371   4e-127   Citrus sinensis [apfelsine]
ref|NP_001238453.1|  uncharacterized protein LOC100306668 precursor     370   7e-127   Glycine max [soybeans]
gb|KHN02756.1|  Transmembrane emp24 domain-containing protein A         370   9e-127   Glycine soja [wild soybean]
gb|AFK37006.1|  unknown                                                 370   9e-127   Lotus japonicus
ref|XP_006489467.1|  PREDICTED: transmembrane emp24 domain-contai...    370   1e-126   Citrus sinensis [apfelsine]
ref|XP_009145255.1|  PREDICTED: transmembrane emp24 domain-contai...    369   2e-126   Brassica rapa
ref|XP_006420043.1|  hypothetical protein CICLE_v10005664mg             370   2e-126   
emb|CDY10314.1|  BnaC05g29650D                                          368   4e-126   Brassica napus [oilseed rape]
ref|XP_010532582.1|  PREDICTED: transmembrane emp24 domain-contai...    368   6e-126   Tarenaya hassleriana [spider flower]
gb|KHG26199.1|  Transmembrane emp24 domain-containing A                 367   1e-125   Gossypium arboreum [tree cotton]
ref|XP_010511795.1|  PREDICTED: transmembrane emp24 domain-contai...    367   2e-125   Camelina sativa [gold-of-pleasure]
ref|NP_188924.3|  transmembrane emp24 domain-containing protein p...    366   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406122.1|  hypothetical protein EUTSA_v10021495mg             366   2e-125   Eutrema salsugineum [saltwater cress]
ref|XP_006299601.1|  hypothetical protein CARUB_v10015779mg             366   3e-125   Capsella rubella
ref|NP_001238171.1|  uncharacterized protein LOC100499675 precursor     366   3e-125   Glycine max [soybeans]
ref|XP_002883380.1|  hypothetical protein ARALYDRAFT_479795             365   4e-125   
gb|KFK39568.1|  hypothetical protein AALP_AA3G261200                    365   6e-125   Arabis alpina [alpine rockcress]
gb|KEH43778.1|  emp24/gp25L/p24 family protein                          365   6e-125   Medicago truncatula
ref|XP_007143318.1|  hypothetical protein PHAVU_007G062200g             365   6e-125   Phaseolus vulgaris [French bean]
ref|XP_009135831.1|  PREDICTED: transmembrane emp24 domain-contai...    364   2e-124   Brassica rapa
ref|XP_004496668.1|  PREDICTED: transmembrane emp24 domain-contai...    363   3e-124   Cicer arietinum [garbanzo]
ref|XP_007223416.1|  hypothetical protein PRUPE_ppa011292mg             363   3e-124   Prunus persica
gb|KJB38216.1|  hypothetical protein B456_006G242900                    363   3e-124   Gossypium raimondii
ref|XP_009590337.1|  PREDICTED: transmembrane emp24 domain-contai...    363   4e-124   
ref|XP_004134119.1|  PREDICTED: transmembrane emp24 domain-contai...    363   4e-124   Cucumis sativus [cucumbers]
ref|XP_008224230.1|  PREDICTED: transmembrane emp24 domain-contai...    363   6e-124   Prunus mume [ume]
ref|XP_010259153.1|  PREDICTED: transmembrane emp24 domain-contai...    362   9e-124   Nelumbo nucifera [Indian lotus]
ref|XP_009778405.1|  PREDICTED: transmembrane emp24 domain-contai...    362   2e-123   Nicotiana sylvestris
ref|XP_011090665.1|  PREDICTED: transmembrane emp24 domain-contai...    361   3e-123   Sesamum indicum [beniseed]
emb|CDY46609.1|  BnaCnng14310D                                          361   4e-123   Brassica napus [oilseed rape]
ref|XP_010466578.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    360   5e-123   Camelina sativa [gold-of-pleasure]
ref|XP_008438614.1|  PREDICTED: transmembrane emp24 domain-contai...    360   9e-123   Cucumis melo [Oriental melon]
emb|CDY34226.1|  BnaA01g24430D                                          359   1e-122   Brassica napus [oilseed rape]
ref|XP_006356044.1|  PREDICTED: transmembrane emp24 domain-contai...    359   2e-122   Solanum tuberosum [potatoes]
gb|EYU41435.1|  hypothetical protein MIMGU_mgv1a013526mg                359   2e-122   Erythranthe guttata [common monkey flower]
ref|XP_004296587.1|  PREDICTED: transmembrane emp24 domain-contai...    358   3e-122   Fragaria vesca subsp. vesca
ref|XP_009108603.1|  PREDICTED: transmembrane emp24 domain-contai...    358   5e-122   Brassica rapa
ref|XP_010317396.1|  PREDICTED: transmembrane emp24 domain-contai...    358   6e-122   Solanum lycopersicum
ref|XP_009343969.1|  PREDICTED: transmembrane emp24 domain-contai...    357   1e-121   Pyrus x bretschneideri [bai li]
emb|CDY61077.1|  BnaCnng37320D                                          356   3e-121   Brassica napus [oilseed rape]
ref|XP_009399353.1|  PREDICTED: transmembrane emp24 domain-contai...    354   1e-120   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO99114.1|  unnamed protein product                                352   9e-120   Coffea canephora [robusta coffee]
ref|XP_010034397.1|  PREDICTED: transmembrane emp24 domain-contai...    350   1e-118   Eucalyptus grandis [rose gum]
ref|XP_010551705.1|  PREDICTED: transmembrane emp24 domain-contai...    349   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_010525219.1|  PREDICTED: transmembrane emp24 domain-contai...    349   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_010923517.1|  PREDICTED: transmembrane emp24 domain-contai...    349   2e-118   Elaeis guineensis
ref|XP_009398371.1|  PREDICTED: transmembrane emp24 domain-contai...    348   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009375992.1|  PREDICTED: transmembrane emp24 domain-contai...    347   7e-118   Pyrus x bretschneideri [bai li]
ref|XP_009371933.1|  PREDICTED: transmembrane emp24 domain-contai...    347   7e-118   Pyrus x bretschneideri [bai li]
ref|XP_008776017.1|  PREDICTED: transmembrane emp24 domain-contai...    347   1e-117   Phoenix dactylifera
ref|XP_010917620.1|  PREDICTED: transmembrane emp24 domain-contai...    346   2e-117   Elaeis guineensis
ref|XP_008391009.1|  PREDICTED: transmembrane emp24 domain-contai...    345   8e-117   
ref|XP_006838935.1|  hypothetical protein AMTR_s00002p00270370          345   8e-117   Amborella trichopoda
gb|EAY91831.1|  hypothetical protein OsI_13477                          343   2e-116   Oryza sativa Indica Group [Indian rice]
ref|NP_001136501.1|  uncharacterized protein LOC100216616 precursor     342   7e-116   Zea mays [maize]
ref|XP_004981806.1|  PREDICTED: transmembrane emp24 domain-contai...    342   1e-115   Setaria italica
ref|XP_002463892.1|  hypothetical protein SORBIDRAFT_01g008390          341   2e-115   Sorghum bicolor [broomcorn]
ref|NP_001051240.1|  Os03g0744800                                       340   5e-115   
gb|EPS65381.1|  hypothetical protein M569_09395                         339   8e-115   Genlisea aurea
gb|AFP87418.1|  putative EMP24-domain containing protein                338   3e-114   Triticum turgidum subsp. durum
ref|XP_003559757.1|  PREDICTED: transmembrane emp24 domain-contai...    337   6e-114   Brachypodium distachyon [annual false brome]
ref|NP_001141300.1|  Suppressor/enhancer of lin-12 protein 9 prec...    336   1e-113   Zea mays [maize]
dbj|BAJ97536.1|  predicted protein                                      335   3e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB12566.1|  hypothetical protein B456_002G024500                    330   3e-111   Gossypium raimondii
ref|XP_004493724.1|  PREDICTED: transmembrane emp24 domain-contai...    330   3e-111   
ref|XP_003553473.1|  PREDICTED: transmembrane emp24 domain-contai...    329   1e-110   Glycine max [soybeans]
ref|XP_002274733.1|  PREDICTED: transmembrane emp24 domain-contai...    327   6e-110   Vitis vinifera
gb|KEH23828.1|  emp24/gp25L/p24 family/GOLD protein                     327   9e-110   Medicago truncatula
gb|EYU23694.1|  hypothetical protein MIMGU_mgv1a013689mg                325   2e-109   Erythranthe guttata [common monkey flower]
ref|XP_009370753.1|  PREDICTED: transmembrane emp24 domain-contai...    326   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_011073468.1|  PREDICTED: transmembrane emp24 domain-contai...    326   2e-109   Sesamum indicum [beniseed]
ref|XP_002315749.2|  emp24/gp25L/p24 family protein                     322   4e-108   
ref|XP_008235354.1|  PREDICTED: transmembrane emp24 domain-contai...    322   7e-108   Prunus mume [ume]
ref|XP_008351862.1|  PREDICTED: transmembrane emp24 domain-contai...    321   2e-107   Malus domestica [apple tree]
ref|XP_010490045.1|  PREDICTED: transmembrane emp24 domain-contai...    319   4e-107   
ref|XP_007162469.1|  hypothetical protein PHAVU_001G155000g             319   1e-106   Phaseolus vulgaris [French bean]
emb|CAN65862.1|  hypothetical protein VITISV_007728                     318   1e-106   Vitis vinifera
gb|ABK22222.1|  unknown                                                 318   2e-106   Picea sitchensis
ref|XP_009350369.1|  PREDICTED: transmembrane emp24 domain-contai...    318   2e-106   Pyrus x bretschneideri [bai li]
ref|XP_004292584.1|  PREDICTED: transmembrane emp24 domain-contai...    317   8e-106   Fragaria vesca subsp. vesca
ref|XP_007200451.1|  hypothetical protein PRUPE_ppa011262mg             317   1e-105   
ref|XP_006443971.1|  hypothetical protein CICLE_v10024247mg             316   1e-105   Citrus clementina [clementine]
emb|CBI25047.3|  unnamed protein product                                311   3e-104   Vitis vinifera
ref|XP_007034876.1|  Emp24/gp25L/p24 family/GOLD family protein i...    304   2e-101   
ref|XP_010935726.1|  PREDICTED: transmembrane emp24 domain-contai...    305   3e-101   Elaeis guineensis
gb|KJB72278.1|  hypothetical protein B456_011G168300                    298   8e-99    Gossypium raimondii
gb|KHG16537.1|  Transmembrane emp24 domain-containing 2                 296   3e-98    Gossypium arboreum [tree cotton]
ref|XP_010646131.1|  PREDICTED: transmembrane emp24 domain-contai...    295   9e-98    Vitis vinifera
ref|XP_007050472.1|  Emp24/gp25L/p24 family/GOLD family protein         295   3e-97    
ref|XP_008343630.1|  PREDICTED: transmembrane emp24 domain-contai...    289   4e-95    
emb|CAN73344.1|  hypothetical protein VITISV_007239                     288   7e-95    Vitis vinifera
ref|XP_008390949.1|  PREDICTED: transmembrane emp24 domain-contai...    285   1e-93    
ref|XP_008786160.1|  PREDICTED: transmembrane emp24 domain-contai...    280   9e-92    
ref|XP_006651809.1|  PREDICTED: transmembrane emp24 domain-contai...    276   6e-90    
gb|EEE59914.1|  hypothetical protein OsJ_12539                          273   2e-88    Oryza sativa Japonica Group [Japonica rice]
gb|KHN15723.1|  Endoplasmic reticulum vesicle protein 25                253   2e-81    Glycine soja [wild soybean]
ref|XP_002987714.1|  hypothetical protein SELMODRAFT_126578             249   2e-79    
ref|XP_002983175.1|  hypothetical protein SELMODRAFT_268686             249   2e-79    
gb|EMS56815.1|  Transmembrane emp24 domain-containing protein A         245   8e-79    Triticum urartu
ref|XP_001752961.1|  predicted protein                                  242   2e-76    
ref|XP_001771034.1|  predicted protein                                  220   2e-68    
ref|XP_010535328.1|  PREDICTED: transmembrane emp24 domain-contai...    202   6e-62    Tarenaya hassleriana [spider flower]
gb|KHG09153.1|  Transmembrane emp24 domain-containing 7                 193   3e-58    Gossypium arboreum [tree cotton]
ref|XP_008368791.1|  PREDICTED: transmembrane emp24 domain-contai...    190   3e-57    
ref|XP_008363663.1|  PREDICTED: transmembrane emp24 domain-contai...    190   4e-57    
ref|XP_010527604.1|  PREDICTED: transmembrane emp24 domain-contai...    183   5e-55    Tarenaya hassleriana [spider flower]
ref|XP_002990957.1|  hypothetical protein SELMODRAFT_132599             141   2e-37    
ref|XP_002982857.1|  hypothetical protein SELMODRAFT_116990             140   7e-37    Selaginella moellendorffii
ref|XP_004957295.1|  PREDICTED: transmembrane emp24 domain-contai...    139   2e-36    Setaria italica
ref|XP_002265305.1|  PREDICTED: transmembrane emp24 domain-contai...    138   4e-36    Vitis vinifera
ref|XP_006474870.1|  PREDICTED: transmembrane emp24 domain-contai...    138   4e-36    Citrus sinensis [apfelsine]
ref|XP_001766849.1|  predicted protein                                  138   5e-36    
dbj|BAK04640.1|  predicted protein                                      137   1e-35    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007142524.1|  hypothetical protein PHAVU_008G288000g             135   5e-35    Phaseolus vulgaris [French bean]
gb|AFK47679.1|  unknown                                                 135   6e-35    Lotus japonicus
gb|EYU42779.1|  hypothetical protein MIMGU_mgv1a013547mg                134   9e-35    Erythranthe guttata [common monkey flower]
ref|XP_010243958.1|  PREDICTED: transmembrane emp24 domain-contai...    134   9e-35    Nelumbo nucifera [Indian lotus]
ref|XP_003574832.1|  PREDICTED: transmembrane emp24 domain-contai...    134   9e-35    Brachypodium distachyon [annual false brome]
ref|XP_010238339.1|  PREDICTED: transmembrane emp24 domain-contai...    134   1e-34    Brachypodium distachyon [annual false brome]
ref|XP_006857765.1|  hypothetical protein AMTR_s00061p00199890          134   2e-34    
ref|XP_010524625.1|  PREDICTED: transmembrane emp24 domain-contai...    132   4e-34    Tarenaya hassleriana [spider flower]
dbj|BAK05986.1|  predicted protein                                      132   4e-34    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010252793.1|  PREDICTED: transmembrane emp24 domain-contai...    132   4e-34    Nelumbo nucifera [Indian lotus]
ref|XP_008219687.1|  PREDICTED: transmembrane emp24 domain-contai...    132   7e-34    Prunus mume [ume]
ref|XP_007205899.1|  hypothetical protein PRUPE_ppa011405mg             132   9e-34    Prunus persica
ref|XP_010644591.1|  PREDICTED: transmembrane emp24 domain-contai...    131   1e-33    Vitis vinifera
gb|KJB10764.1|  hypothetical protein B456_001G223000                    132   1e-33    Gossypium raimondii
gb|KHN46897.1|  Transmembrane emp24 domain-containing protein 2         131   1e-33    Glycine soja [wild soybean]
ref|XP_010061440.1|  PREDICTED: transmembrane emp24 domain-contai...    131   1e-33    Eucalyptus grandis [rose gum]
ref|NP_001062344.1|  Os08g0532900                                       131   2e-33    
ref|XP_003618034.1|  Transmembrane emp24 domain-containing protein      131   2e-33    Medicago truncatula
ref|XP_003618033.1|  Transmembrane emp24 domain-containing protein      130   2e-33    Medicago truncatula
gb|KDP39307.1|  hypothetical protein JCGZ_01064                         130   3e-33    Jatropha curcas
ref|XP_010689227.1|  PREDICTED: transmembrane emp24 domain-contai...    130   3e-33    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004144551.1|  PREDICTED: transmembrane emp24 domain-contai...    130   4e-33    Cucumis sativus [cucumbers]
ref|XP_009134990.1|  PREDICTED: transmembrane emp24 domain-contai...    130   4e-33    Brassica rapa
ref|XP_006298554.1|  hypothetical protein CARUB_v10014637mg             129   5e-33    Capsella rubella
ref|XP_009394560.1|  PREDICTED: transmembrane emp24 domain-contai...    130   5e-33    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004974010.1|  PREDICTED: transmembrane emp24 domain-contai...    129   6e-33    Setaria italica
ref|XP_006574367.1|  PREDICTED: uncharacterized protein LOC100527...    129   6e-33    
ref|XP_006407808.1|  hypothetical protein EUTSA_v10021526mg             129   7e-33    Eutrema salsugineum [saltwater cress]
ref|XP_011461874.1|  PREDICTED: transmembrane emp24 domain-contai...    129   8e-33    Fragaria vesca subsp. vesca
ref|XP_002882543.1|  hypothetical protein ARALYDRAFT_478100             129   9e-33    
gb|AAM66112.1|  putative coated vesicle membrane protein                129   9e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491612.1|  PREDICTED: transmembrane emp24 domain-contai...    129   1e-32    Cicer arietinum [garbanzo]
ref|XP_003545588.1|  PREDICTED: transmembrane emp24 domain-contai...    129   1e-32    Glycine max [soybeans]
ref|NP_001235792.1|  uncharacterized protein LOC100527418               129   1e-32    
ref|XP_006474871.1|  PREDICTED: transmembrane emp24 domain-contai...    136   1e-32    
emb|CDY28027.1|  BnaC05g44290D                                          129   1e-32    Brassica napus [oilseed rape]
ref|XP_009147043.1|  PREDICTED: transmembrane emp24 domain-contai...    128   2e-32    Brassica rapa
gb|ABB90548.1|  coated vesicle membrane protein-like                    128   2e-32    Triticum aestivum [Canadian hard winter wheat]
gb|EMS66095.1|  Transmembrane emp24 domain-containing protein           128   2e-32    Triticum urartu
ref|XP_010464406.1|  PREDICTED: transmembrane emp24 domain-contai...    128   2e-32    Camelina sativa [gold-of-pleasure]
ref|XP_010551965.1|  PREDICTED: transmembrane emp24 domain-contai...    128   2e-32    Tarenaya hassleriana [spider flower]
ref|XP_010456670.1|  PREDICTED: transmembrane emp24 domain-contai...    128   2e-32    Camelina sativa [gold-of-pleasure]
ref|XP_001780055.1|  predicted protein                                  128   2e-32    
emb|CDX74033.1|  BnaA03g30140D                                          127   3e-32    
ref|XP_010942595.1|  PREDICTED: transmembrane emp24 domain-contai...    128   3e-32    Elaeis guineensis
gb|EMT09288.1|  Transmembrane emp24 domain-containing protein 7         130   3e-32    
emb|CDY35954.1|  BnaA05g29960D                                          127   3e-32    Brassica napus [oilseed rape]
ref|NP_187425.1|  p24 subfamily beta 2                                  127   3e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486337.1|  PREDICTED: transmembrane emp24 domain-contai...    127   3e-32    Camelina sativa [gold-of-pleasure]
ref|XP_009759544.1|  PREDICTED: transmembrane emp24 domain-contai...    127   4e-32    Nicotiana sylvestris
ref|NP_001132648.1|  hypothetical protein precursor                     127   4e-32    Zea mays [maize]
ref|XP_008790745.1|  PREDICTED: transmembrane emp24 domain-contai...    127   5e-32    Phoenix dactylifera
ref|XP_010927754.1|  PREDICTED: transmembrane emp24 domain-contai...    127   5e-32    Elaeis guineensis
ref|XP_009124202.1|  PREDICTED: transmembrane emp24 domain-contai...    127   5e-32    Brassica rapa
gb|KHG15887.1|  Transmembrane emp24 domain-containing 2                 127   5e-32    Gossypium arboreum [tree cotton]
ref|XP_008349392.1|  PREDICTED: transmembrane emp24 domain-contai...    126   5e-32    
gb|KJB13907.1|  hypothetical protein B456_002G101200                    127   7e-32    Gossypium raimondii
emb|CDY22128.1|  BnaC01g39730D                                          127   7e-32    Brassica napus [oilseed rape]
ref|XP_008358798.1|  PREDICTED: transmembrane emp24 domain-contai...    126   9e-32    
ref|XP_006660817.1|  PREDICTED: transmembrane emp24 domain-contai...    126   1e-31    Oryza brachyantha
ref|XP_010675969.1|  PREDICTED: transmembrane emp24 domain-contai...    126   1e-31    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY07978.1|  BnaC03g35450D                                          126   1e-31    Brassica napus [oilseed rape]
ref|XP_008811267.1|  PREDICTED: transmembrane emp24 domain-contai...    126   2e-31    Phoenix dactylifera
ref|XP_011100513.1|  PREDICTED: transmembrane emp24 domain-contai...    126   2e-31    Sesamum indicum [beniseed]
ref|XP_006659626.1|  PREDICTED: transmembrane emp24 domain-contai...    125   2e-31    Oryza brachyantha
ref|XP_004172188.1|  PREDICTED: transmembrane emp24 domain-contai...    125   2e-31    
ref|XP_002444693.1|  hypothetical protein SORBIDRAFT_07g026110          125   3e-31    Sorghum bicolor [broomcorn]
ref|NP_001147761.1|  LOC100281371 precursor                             124   6e-31    Zea mays [maize]
ref|XP_011095562.1|  PREDICTED: transmembrane emp24 domain-contai...    124   6e-31    Sesamum indicum [beniseed]
ref|XP_010063252.1|  PREDICTED: transmembrane emp24 domain-contai...    124   6e-31    
gb|ACG35396.1|  transmembrane emp24 domain-containing protein 3 p...    124   8e-31    Zea mays [maize]
ref|XP_007049383.1|  Emp24/gp25L/p24 family/GOLD family protein i...    123   2e-30    
gb|EAZ45308.1|  hypothetical protein OsJ_29951                          123   2e-30    Oryza sativa Japonica Group [Japonica rice]
gb|AGT16036.1|  transmembrane emp24 domain-containing protein           124   2e-30    Saccharum hybrid cultivar R570
ref|XP_009408352.1|  PREDICTED: transmembrane emp24 domain-contai...    122   3e-30    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009787783.1|  PREDICTED: transmembrane emp24 domain-contai...    121   7e-30    Nicotiana sylvestris
ref|XP_010088435.1|  Transmembrane emp24 domain-containing protein      123   8e-30    
ref|XP_004295183.1|  PREDICTED: cellulose synthase-like protein E...    128   1e-29    Fragaria vesca subsp. vesca
gb|EMS53833.1|  Transmembrane emp24 domain-containing protein 7         120   3e-29    Triticum urartu
gb|EAZ09689.1|  hypothetical protein OsI_31972                          120   3e-29    Oryza sativa Indica Group [Indian rice]
ref|XP_002522778.1|  coated vesicle membrane protein, putative          126   5e-29    
ref|XP_009616557.1|  PREDICTED: transmembrane emp24 domain-contai...    119   7e-29    Nicotiana tomentosiformis
emb|CDP13706.1|  unnamed protein product                                118   1e-28    Coffea canephora [robusta coffee]
ref|XP_007020468.1|  Emp24/gp25L/p24 family/GOLD family protein         119   1e-28    
ref|XP_008380011.1|  PREDICTED: transmembrane emp24 domain-contai...    118   2e-28    
ref|XP_009361538.1|  PREDICTED: transmembrane emp24 domain-contai...    117   4e-28    Pyrus x bretschneideri [bai li]
ref|XP_003600347.1|  Transmembrane emp24 domain-containing protein      117   4e-28    
ref|XP_004252039.2|  PREDICTED: transmembrane emp24 domain-contai...    118   6e-28    
ref|XP_010063253.1|  PREDICTED: cellulose synthase-like protein E...    122   8e-28    Eucalyptus grandis [rose gum]
gb|EYU27447.1|  hypothetical protein MIMGU_mgv1a013853mg                115   1e-27    Erythranthe guttata [common monkey flower]
gb|KDO50955.1|  hypothetical protein CISIN_1g040712mg                   114   2e-27    Citrus sinensis [apfelsine]
ref|XP_006586144.1|  PREDICTED: transmembrane emp24 domain-contai...    115   2e-27    Glycine max [soybeans]
ref|XP_008229935.1|  PREDICTED: transmembrane emp24 domain-contai...    115   2e-27    Prunus mume [ume]
ref|XP_010926811.1|  PREDICTED: transmembrane emp24 domain-contai...    114   3e-27    Elaeis guineensis
ref|XP_007215846.1|  hypothetical protein PRUPE_ppa010256mg             115   3e-27    
ref|XP_004303575.1|  PREDICTED: transmembrane emp24 domain-contai...    114   3e-27    Fragaria vesca subsp. vesca
ref|XP_002300382.1|  emp24/gp25L/p24 family protein                     114   3e-27    Populus trichocarpa [western balsam poplar]
ref|XP_006352045.1|  PREDICTED: transmembrane emp24 domain-contai...    114   4e-27    
ref|XP_003552993.2|  PREDICTED: transmembrane emp24 domain-contai...    113   6e-27    
gb|KHN31673.1|  Transmembrane emp24 domain-containing protein A         113   7e-27    Glycine soja [wild soybean]
ref|XP_008362318.1|  PREDICTED: transmembrane emp24 domain-contai...    114   7e-27    
ref|XP_004516094.1|  PREDICTED: transmembrane emp24 domain-contai...    113   8e-27    
ref|XP_005839577.1|  hypothetical protein GUITHDRAFT_157078             111   1e-26    Guillardia theta CCMP2712
ref|XP_007049384.1|  Emp24/gp25L/p24 family/GOLD family protein i...    112   2e-26    
gb|ABG66965.1|  LRR resistance protein-like protein                     108   2e-26    Gossypium arboreum [tree cotton]
gb|AIA25722.1|  coated vesicle membrane protein                         108   5e-26    Phyllostachys edulis [kikko-chiku]
ref|XP_007146652.1|  hypothetical protein PHAVU_006G058200g             111   6e-26    Phaseolus vulgaris [French bean]
ref|XP_011095564.1|  PREDICTED: cellulose synthase-like protein E6      116   8e-26    Sesamum indicum [beniseed]
ref|XP_002532207.1|  coated vesicle membrane protein, putative          108   4e-25    Ricinus communis
gb|AIA25723.1|  coated vesicle membrane protein                         106   4e-25    Phyllostachys nigra var. henonis
gb|AIA25724.1|  coated vesicle membrane protein                         105   4e-25    Fargesia nitida
ref|XP_009793108.1|  PREDICTED: transmembrane emp24 domain-contai...    108   6e-25    Nicotiana sylvestris
ref|XP_010313948.1|  PREDICTED: transmembrane emp24 domain-contai...    107   1e-24    Solanum lycopersicum
ref|XP_009606341.1|  PREDICTED: transmembrane emp24 domain-contai...    107   2e-24    Nicotiana tomentosiformis
ref|XP_002676871.1|  predicted protein                                  105   4e-24    Naegleria gruberi strain NEG-M
ref|XP_006344897.1|  PREDICTED: transmembrane emp24 domain-contai...    105   7e-24    Solanum tuberosum [potatoes]
ref|XP_009624028.1|  PREDICTED: transmembrane emp24 domain-contai...    105   8e-24    Nicotiana tomentosiformis
dbj|BAM20109.1|  transmembrane emp24 domain-containing protein          104   2e-23    Papilio xuthus [Chinese swallowtail]
ref|XP_006452612.1|  hypothetical protein CICLE_v100094662mg            100   1e-22    
ref|XP_009590973.1|  PREDICTED: transmembrane emp24 domain-contai...    101   1e-22    
ref|XP_009793109.1|  PREDICTED: cellulose synthase-like protein E...    106   2e-22    Nicotiana sylvestris
dbj|GAM18347.1|  hypothetical protein SAMD00019534_015220               100   4e-22    Acytostelium subglobosum LB1
ref|XP_009606342.1|  PREDICTED: cellulose synthase-like protein E...    105   7e-22    Nicotiana tomentosiformis
ref|XP_636960.1|  hypothetical protein DDB_G0288053                     100   7e-22    Dictyostelium discoideum AX4
emb|CDP20746.1|  unnamed protein product                              97.8    2e-21    Coffea canephora [robusta coffee]
ref|XP_003286220.1|  hypothetical protein DICPUDRAFT_150161           98.6    3e-21    Dictyostelium purpureum
emb|CDS10876.1|  hypothetical protein LRAMOSA11362                    98.2    3e-21    Lichtheimia ramosa
ref|XP_007509107.1|  predicted protein                                97.8    6e-21    Bathycoccus prasinos
emb|CDH57757.1|  supernatant protein factor c-terminal domain-con...  97.1    9e-21    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010324247.1|  PREDICTED: cellulose synthase-like protein E1      102   9e-21    Solanum lycopersicum
ref|XP_006346126.1|  PREDICTED: cellulose synthase-like protein E...    102   9e-21    Solanum tuberosum [potatoes]
ref|XP_002037009.1|  GM12348                                          96.3    2e-20    Drosophila sechellia
ref|XP_002075543.1|  GK14515                                          97.8    2e-20    
emb|CEG76918.1|  hypothetical protein RMATCC62417_11745               95.9    2e-20    Rhizopus microsporus
ref|XP_002507873.1|  hypothetical protein MICPUN_60612                96.3    2e-20    Micromonas commoda
ref|XP_002737710.1|  PREDICTED: transmembrane emp24 domain-contai...  95.9    2e-20    Saccoglossus kowalevskii
ref|XP_004928888.1|  PREDICTED: transmembrane emp24 domain-contai...  95.5    3e-20    Bombyx mori [silk moth]
dbj|BAN20504.1|  copii-coated vesicle membrane protein P24            95.5    3e-20    Riptortus pedestris
ref|XP_002059491.1|  GJ14798                                          95.5    4e-20    Drosophila virilis
dbj|GAA94318.1|  hypothetical protein E5Q_00967                       95.5    4e-20    Mixia osmundae IAM 14324
ref|XP_001966179.1|  GF19355                                          95.1    5e-20    Drosophila ananassae
ref|XP_002023732.1|  GL19967                                          94.7    6e-20    Drosophila persimilis
gb|KFM70595.1|  Transmembrane emp24 domain-containing protein 2       94.7    6e-20    Stegodyphus mimosarum
ref|XP_001976884.1|  GG18710                                          94.7    6e-20    
ref|XP_004531150.1|  PREDICTED: transmembrane emp24 domain-contai...  94.7    7e-20    
gb|ESA01197.1|  hypothetical protein GLOINDRAFT_38705                 94.4    8e-20    
ref|XP_005183552.1|  PREDICTED: transmembrane emp24 domain-contai...  94.4    8e-20    Musca domestica
ref|XP_001354670.1|  GA28584                                          94.4    1e-19    Drosophila pseudoobscura pseudoobscura
ref|XP_002737711.1|  PREDICTED: transmembrane emp24 domain-contai...  94.0    1e-19    Saccoglossus kowalevskii
ref|XP_004531149.1|  PREDICTED: transmembrane emp24 domain-contai...  94.7    1e-19    
ref|XP_008462127.1|  PREDICTED: transmembrane emp24 domain-contai...  93.2    1e-19    Cucumis melo [Oriental melon]
ref|XP_002100096.1|  GE16348                                          94.0    1e-19    Drosophila yakuba
dbj|BAA75463.1|  COP-coated vesicle membrane protein P24 homolog      94.0    1e-19    Heterostelium pallidum
ref|XP_010088434.1|  RPM1-interacting protein 4                       94.7    1e-19    
gb|EMS24745.1|  COPII-coated vesicle protein                          93.6    2e-19    
ref|XP_010033500.1|  PREDICTED: transmembrane emp24 domain-contai...  92.0    2e-19    
gb|EXX57732.1|  Emp24p                                                94.0    2e-19    
ref|XP_002612119.1|  hypothetical protein BRAFLDRAFT_127851           93.2    2e-19    
ref|NP_572165.1|  CHOp24, isoform A                                   93.2    2e-19    
gb|EHJ79123.1|  hypothetical protein KGM_15587                        93.2    2e-19    
gb|EAY91832.1|  hypothetical protein OsI_13478                        90.1    3e-19    
dbj|BAK05139.1|  predicted protein                                    92.4    3e-19    
ref|XP_008357987.1|  PREDICTED: transmembrane emp24 domain-contai...  91.7    3e-19    
emb|CCG82900.1|  Endosomal protein P24B                               92.8    3e-19    
ref|NP_001039241.1|  transmembrane emp24 domain trafficking prote...  92.4    4e-19    
ref|XP_002009519.1|  GI15191                                          92.4    4e-19    
ref|XP_001992720.1|  GH24063                                          92.4    5e-19    
ref|XP_005988996.1|  PREDICTED: transmembrane emp24 domain-contai...  92.0    5e-19    
ref|XP_009054024.1|  hypothetical protein LOTGIDRAFT_203874           92.0    6e-19    
gb|KDR20117.1|  Transmembrane emp24 domain-containing protein         91.7    8e-19    
gb|KCW85245.1|  hypothetical protein EUGRSUZ_B02092                   90.1    8e-19    
emb|CDJ84137.1|  emp24 gp25L p24 domain containing protein            91.7    8e-19    
emb|CEI89044.1|  hypothetical protein RMCBS344292_03417               91.3    8e-19    
ref|XP_004345536.1|  transmembrane emp24 domain-containing protein    91.7    9e-19    
gb|KCW77065.1|  hypothetical protein EUGRSUZ_D01406                   90.1    1e-18    
ref|XP_003385187.1|  PREDICTED: transmembrane emp24 domain-contai...  90.9    1e-18    
dbj|GAN05424.1|  supeRNAtant protein factor C-terminal domain-con...  90.5    1e-18    
ref|XP_003745531.1|  PREDICTED: transmembrane emp24 domain-contai...  90.9    1e-18    
ref|XP_003222786.2|  PREDICTED: transmembrane emp24 domain-contai...  92.0    1e-18    
ref|XP_010052924.1|  PREDICTED: transmembrane emp24 domain-contai...  90.1    1e-18    
gb|KDE02371.1|  hypothetical protein MVLG_07073                       90.5    2e-18    
ref|NP_955842.1|  transmembrane emp24 domain-containing protein 2...  90.5    2e-18    
ref|XP_005491563.1|  PREDICTED: transmembrane emp24 domain-contai...  90.5    2e-18    
ref|XP_011183078.1|  PREDICTED: transmembrane emp24 domain-contai...  90.5    2e-18    
ref|XP_002156614.1|  PREDICTED: transmembrane emp24 domain-contai...  90.1    2e-18    
ref|XP_004360412.1|  emp24/gp25L/p24 family protein                   90.5    2e-18    
emb|CEG73085.1|  hypothetical protein RMATCC62417_08531               90.1    2e-18    
ref|NP_001080619.1|  transmembrane emp24 domain trafficking prote...  90.1    2e-18    
ref|XP_007905987.1|  PREDICTED: transmembrane emp24 domain-contai...  90.1    2e-18    
gb|ABQ42005.1|  putative cop-coated vesicle membrane protein          86.3    3e-18    
ref|XP_001264618.1|  endosomal cargo receptor (P24), putative         90.1    3e-18    
emb|CDJ89798.1|  emp24 gp25L p24 domain containing protein            90.5    3e-18    
ref|XP_002559296.1|  Pc13g08710                                       90.1    3e-18    
ref|XP_006894695.1|  PREDICTED: transmembrane emp24 domain-contai...  89.7    3e-18    
ref|XP_010039587.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    4e-18    
ref|XP_007646592.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    4e-18    
ref|XP_006640298.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    5e-18    
ref|XP_006123002.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    5e-18    
emb|CEP14534.1|  hypothetical protein                                 89.0    5e-18    
ref|XP_003965392.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    5e-18    
ref|XP_006209543.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    6e-18    
ref|XP_003462952.1|  PREDICTED: transmembrane emp24 domain-contai...  89.0    7e-18    
dbj|BAG60439.1|  unnamed protein product                              88.2    7e-18    
ref|XP_004385048.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    7e-18    
gb|EFX80363.1|  hypothetical protein DAPPUDRAFT_304000                89.0    7e-18    
gb|EPB90773.1|  hypothetical protein HMPREF1544_02351                 89.0    8e-18    
gb|EYE95378.1|  hypothetical protein EURHEDRAFT_412193                89.0    8e-18    
ref|XP_006865431.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    8e-18    
ref|XP_008837511.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    8e-18    
emb|CDQ74942.1|  unnamed protein product                              88.6    8e-18    
ref|XP_001364919.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    8e-18    
ref|XP_006209542.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    8e-18    
ref|NP_113910.1|  transmembrane emp24 domain-containing protein 2...  88.6    9e-18    
ref|NP_006806.1|  transmembrane emp24 domain-containing protein 2...  88.6    9e-18    
ref|XP_003420330.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    9e-18    
gb|AAX37039.1|  coated vesicle membrane protein                       88.6    9e-18    
ref|XP_005403088.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    9e-18    
ref|NP_062744.1|  transmembrane emp24 domain-containing protein 2...  88.6    9e-18    
ref|XP_011354010.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    9e-18    
gb|AIA25725.1|  coated vesicle membrane protein                       85.9    9e-18    
sp|P49020.1|TMED2_CRIGR  RecName: Full=Transmembrane emp24 domain...  88.6    9e-18    
ref|XP_008155442.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    9e-18    
ref|XP_004595402.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    1e-17    
gb|EFA82777.1|  emp24/gp25L/p24 family protein                        87.0    1e-17    
gb|KGO67798.1|  Uncharacterized protein PITC_048840                   88.2    1e-17    
ref|XP_010748994.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_011506255.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
gb|EKC18010.1|  Transmembrane emp24 domain-containing protein 2       87.4    1e-17    
ref|XP_009569586.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005145179.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  88.2    1e-17    
ref|NP_001006186.1|  transmembrane emp24 domain-containing protei...  88.2    1e-17    
ref|XP_004284089.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_006266671.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_006015176.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005298778.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005524293.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
gb|EKV17382.1|  Endosomal cargo receptor (P24), putative              88.2    1e-17    
gb|KFO95756.1|  hypothetical protein N300_10241                       87.0    1e-17    
gb|KGL89388.1|  hypothetical protein N301_08401                       87.8    1e-17    
ref|XP_007238328.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_010795826.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
emb|CCA74063.1|  related to EMP24 protein precursor                   88.2    1e-17    
emb|CDM30485.1|  Endosomal protein P24B                               87.8    2e-17    
ref|XP_005812072.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_008323850.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
gb|KFH64814.1|  hypothetical protein MVEG_09544                       87.8    2e-17    
gb|ERE76026.1|  transmembrane emp24 domain-containing protein 2       87.4    2e-17    
ref|XP_005714632.1|  unnamed protein product                          87.8    2e-17    
gb|KFD57524.1|  hypothetical protein M513_01627                       88.6    2e-17    
gb|EMT23391.1|  hypothetical protein F775_32193                       87.0    2e-17    
ref|XP_004668547.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_011414195.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_006910125.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    2e-17    
ref|XP_004753164.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    2e-17    
ref|XP_003455198.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    2e-17    
ref|XP_011209479.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_004074497.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    2e-17    
gb|EPB82387.1|  hypothetical protein HMPREF1544_10888                 87.0    2e-17    
ref|XP_007577369.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    2e-17    
ref|XP_010060577.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    2e-17    
ref|XP_658758.1|  hypothetical protein AN1154.2                       87.4    2e-17    
ref|XP_002405324.1|  cargo transport protein EMP24, putative          87.0    3e-17    
ref|XP_005988995.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    3e-17    
ref|XP_009796258.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    3e-17    
gb|KGO36873.1|  Uncharacterized protein PEXP_006720                   87.0    3e-17    
emb|CBY21054.1|  unnamed protein product                              87.0    3e-17    
ref|XP_008481507.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    3e-17    
dbj|GAN03151.1|  copii-coated vesicle protein                         87.0    3e-17    
ref|XP_005231235.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    4e-17    
tpg|DAA33463.1|  TPA: coated vesicle membrane protein-like            86.7    4e-17    
ref|XP_005904546.1|  PREDICTED: transmembrane emp24 domain-contai...  86.7    4e-17    
ref|XP_001269129.1|  endosomal cargo receptor (P24), putative         86.7    4e-17    
gb|AIA25726.1|  coated vesicle membrane protein                       84.0    4e-17    
ref|XP_003174373.1|  lin-12 protein 9 suppressor/enhancer             86.7    4e-17    
ref|XP_752512.1|  endosomal cargo receptor (P24)                      86.7    5e-17    
dbj|GAA89435.1|  suppressor/enhancer of lin-12 protein 9 precursor    86.7    5e-17    
ref|XP_002151458.1|  endosomal cargo receptor (P24), putative         86.7    5e-17    
ref|XP_007414390.1|  hypothetical protein MELLADRAFT_57165            86.3    5e-17    
ref|XP_001220865.1|  conserved hypothetical protein                   86.7    5e-17    
emb|CDQ79100.1|  unnamed protein product                              86.3    5e-17    
ref|NP_001290614.1|  transmembrane emp24 domain trafficking prote...  86.3    5e-17    
gb|EPZ36590.1|  GOLD domain-containing protein                        87.4    5e-17    
ref|XP_971914.1|  PREDICTED: transmembrane emp24 domain-containin...  86.3    5e-17    
ref|XP_002151457.1|  endosomal cargo receptor (P24), putative         86.3    6e-17    
ref|XP_791284.2|  PREDICTED: transmembrane emp24 domain-containin...  86.3    6e-17    
gb|KFV02427.1|  hypothetical protein N340_00145                       85.1    6e-17    
ref|XP_010718385.1|  PREDICTED: transmembrane emp24 domain-contai...  86.7    7e-17    
ref|XP_008687187.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    7e-17    
ref|XP_001507202.2|  PREDICTED: transmembrane emp24 domain-contai...  84.7    7e-17    
ref|XP_005603321.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    8e-17    
ref|XP_008111893.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    8e-17    
gb|KFP38893.1|  Transmembrane emp24 domain-containing protein 2       84.7    8e-17    
ref|XP_005434642.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
ref|XP_004017616.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
gb|KFP97602.1|  Transmembrane emp24 domain-containing protein 2       84.7    8e-17    
gb|KFM10700.1|  Transmembrane emp24 domain-containing protein 2       84.7    8e-17    
gb|EHH21305.1|  hypothetical protein EGK_04326                        84.7    9e-17    
gb|KFO59400.1|  Transmembrane emp24 domain-containing protein 2       84.3    9e-17    
ref|XP_006178280.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    9e-17    
gb|EOB03713.1|  Transmembrane emp24 domain-containing protein 2       84.7    9e-17    
ref|XP_005955356.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    9e-17    
ref|XP_002618026.1|  hypothetical protein CLUG_01485                  85.5    9e-17    
gb|KFO04223.1|  hypothetical protein N312_08485                       84.3    9e-17    
emb|CAG05307.1|  unnamed protein product                              88.6    1e-16    
gb|KFU89559.1|  hypothetical protein M959_10146                       84.3    1e-16    
ref|XP_008556582.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
gb|AHD24743.1|  EMP24                                                 85.5    1e-16    
gb|AFR92202.2|  COPII-coated vesicle protein                          85.5    1e-16    
ref|XP_008516732.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    1e-16    
gb|KHJ35369.1|  putative endosomal p24b protein                       85.5    1e-16    
ref|XP_009694827.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    1e-16    
ref|XP_005491562.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
dbj|GAM87761.1|  hypothetical protein ANO11243_057880                 85.5    1e-16    
ref|XP_001825219.2|  suppressor/enhancer of lin-12 protein 9 prec...  85.5    1e-16    
emb|CDQ76905.1|  unnamed protein product                              85.5    1e-16    
ref|XP_010895612.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|NP_001134180.1|  transmembrane emp24 domain-containing protei...  85.1    1e-16    
ref|XP_010345963.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    1e-16    
ref|XP_005691415.1|  PREDICTED: transmembrane emp24 domain-contai...  85.1    1e-16    
ref|XP_007905986.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_003329764.2|  hypothetical protein PGTG_11514                  85.5    1e-16    
ref|XP_001210423.1|  suppressor/enhancer of lin-12 protein 9 prec...  85.1    1e-16    
ref|XP_001392476.1|  suppressor/enhancer of lin-12 protein 9 prec...  85.1    1e-16    
gb|EHH66821.1|  hypothetical protein EGM_03877                        85.1    1e-16    
gb|KDN42297.1|  supernatant protein factor, C-terminal domain-con...  85.5    1e-16    
dbj|GAM41510.1|  endosomal cargo receptor                             85.1    2e-16    
ref|XP_003023954.1|  endosomal cargo receptor (Erv25), putative       85.1    2e-16    
ref|XP_001623647.1|  predicted protein                                84.7    2e-16    
ref|XP_004317416.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    2e-16    
ref|XP_003733921.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  84.7    2e-16    
ref|XP_001393858.2|  endosomal cargo receptor (Erp3)                  84.7    2e-16    
ref|XP_009930828.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    2e-16    
ref|XP_007773423.1|  COPII-coated vesicle protein                     84.7    2e-16    
ref|XP_011388967.1|  hypothetical protein UMAG_02560                  84.7    2e-16    
ref|XP_009878561.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    3e-16    
ref|XP_009801860.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    3e-16    
ref|XP_002491556.1|  Integral membrane component of endoplasmic r...  84.3    3e-16    
gb|EMG50101.1|  Endosomal P24B protein                                84.3    3e-16    
gb|KFH44997.1|  Endosomal protein-like protein                        84.3    3e-16    
tpg|DAA34063.1|  TPA: putative cargo transport protein EMP24          84.0    3e-16    
ref|XP_006626920.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    3e-16    
emb|CAL00825.1|  unnamed protein product                              84.7    3e-16    
gb|KIM29619.1|  hypothetical protein M408DRAFT_328836                 83.2    3e-16    
ref|XP_003378465.1|  suppressor/enhancer of lin-12 protein 9          84.7    4e-16    
gb|EGE03189.1|  endosomal cargo receptor                              84.3    4e-16    
ref|XP_006768845.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    4e-16    
emb|CDW55684.1|  Suppressor                                           84.3    4e-16    
ref|XP_003231662.1|  Emp24/gp25L/p24 membrane trafficking protein     84.0    4e-16    
ref|XP_006108599.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    4e-16    
ref|XP_003070158.1|  emp24/gp25L/p24 family protein                   84.0    5e-16    
ref|XP_007489989.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    5e-16    
ref|XP_001604135.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    5e-16    
ref|XP_005344433.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    5e-16    
gb|ACO09937.1|  Transmembrane emp24 domain-containing protein 2 p...  83.6    5e-16    
ref|XP_002125525.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
ref|XP_005403087.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
ref|XP_010046023.1|  PREDICTED: transmembrane emp24 domain-contai...  82.4    5e-16    
gb|EYE98523.1|  hypothetical protein EURHEDRAFT_545106                84.0    5e-16    
emb|CEI88039.1|  hypothetical protein RMCBS344292_02440               83.6    5e-16    
ref|XP_010795825.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
gb|EMD95596.1|  hypothetical protein COCHEDRAFT_1019296               83.6    5e-16    
ref|XP_003359136.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
ref|XP_005253601.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
ref|XP_008323849.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_007694926.1|  hypothetical protein COCSADRAFT_166637           83.6    6e-16    
ref|XP_002341575.1|  endosomal cargo receptor (P24), putative         83.6    6e-16    
ref|XP_004547317.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_003446109.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_008627658.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_004566996.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_002341576.1|  endosomal cargo receptor (P24), putative         83.2    6e-16    
ref|XP_003745530.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_005794935.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    7e-16    
ref|XP_007238327.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_005722082.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    7e-16    



>ref|XP_004247610.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Solanum lycopersicum]
Length=218

 Score =   383 bits (983),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 198/211 (94%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIR---AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN  177
            GIR    +AL+ ++LFSFV ++SALSVTVND ECVYEYVLYE DTISGNFVVVDHDIFW+
Sbjct  8    GIRRSKVFALVAILLFSFVNDISALSVTVNDEECVYEYVLYENDTISGNFVVVDHDIFWS  67

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            SDHPGIDFTVT+PG+NVVH+MKGTSG+KF+FKAPRSGMYKFCF NPYSTPETVSFYIH+G
Sbjct  68   SDHPGIDFTVTAPGENVVHTMKGTSGNKFEFKAPRSGMYKFCFKNPYSTPETVSFYIHIG  127

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            HIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARDARHRHTNESTR RVIFYT
Sbjct  128  HIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDARHRHTNESTRNRVIFYT  187

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            +GEY+LL LAS LQVVYIRRLFSKSV YNRV
Sbjct  188  IGEYMLLILASGLQVVYIRRLFSKSVGYNRV  218



>ref|XP_006363461.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Solanum tuberosum]
Length=218

 Score =   381 bits (979),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIR---AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN  177
            GIR    +AL+ ++LFSFV ++SALSVTVND ECVYEYVLYE DTISGNFVVVDHDIFW+
Sbjct  8    GIRRSKVFALVAILLFSFVNDISALSVTVNDEECVYEYVLYENDTISGNFVVVDHDIFWS  67

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            SDHPGIDFTVT+PG+NVVH+MKGTSG+KF+FKAPRSGMYKFCF NPYSTPETVSFYIH+G
Sbjct  68   SDHPGIDFTVTAPGENVVHTMKGTSGNKFEFKAPRSGMYKFCFKNPYSTPETVSFYIHIG  127

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            HIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARD+RHRHTNESTR RVIFYT
Sbjct  128  HIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDSRHRHTNESTRNRVIFYT  187

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            +GEY+LL LAS LQVVYIRRLFSKSV YNRV
Sbjct  188  IGEYLLLILASGLQVVYIRRLFSKSVGYNRV  218



>ref|XP_007034875.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05801.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
Length=212

 Score =   381 bits (978),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL++++L ++V+N+S+LSVTVN+VECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  7    KMWALMVLLLLNWVSNVSSLSVTVNEVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP E
Sbjct  67   IDFTVTSPGGNTVQNLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPTE  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHR+TNESTRKRVI YTVGEY+
Sbjct  127  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRNTNESTRKRVIGYTVGEYV  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLALAS+LQV+YIR+LFSKSVAYNRV
Sbjct  187  LLALASALQVIYIRQLFSKSVAYNRV  212



>ref|XP_009631810.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana tomentosiformis]
Length=218

 Score =   380 bits (977),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 196/211 (93%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIR---AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN  177
            GIR     AL+ ++LFSFV +L+ALSVTVND ECVYEYVLYE DTISGNFVVVDHDIFW+
Sbjct  8    GIRRSKVLALVAILLFSFVNDLTALSVTVNDEECVYEYVLYENDTISGNFVVVDHDIFWS  67

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            SDHPGIDF VT+PG+NVVH+MKGTSGDKF+FKAPRSGMYKFCF NPYSTPETVSFYIH+G
Sbjct  68   SDHPGIDFVVTAPGENVVHTMKGTSGDKFEFKAPRSGMYKFCFKNPYSTPETVSFYIHIG  127

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            HIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARD RHRHTNESTRKRVIFYT
Sbjct  128  HIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDVRHRHTNESTRKRVIFYT  187

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            +GEY+LL LAS LQVVYIR+LFSKSV YNRV
Sbjct  188  IGEYLLLILASGLQVVYIRQLFSKSVGYNRV  218



>ref|XP_009773202.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana sylvestris]
Length=218

 Score =   380 bits (975),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 197/211 (93%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIR---AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN  177
            GIR    +AL+ ++LFSFV +++ALSVTVND ECVYEYVLYE D ISGNFVVVDHDIFW+
Sbjct  8    GIRRSKVFALVAILLFSFVNDITALSVTVNDEECVYEYVLYENDMISGNFVVVDHDIFWS  67

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            SDHPGIDF VT+PG+NVVH+MKGTSGDKF+FKAPRSGMYKFCF NPYSTPETVSFYIH+G
Sbjct  68   SDHPGIDFVVTAPGENVVHTMKGTSGDKFEFKAPRSGMYKFCFKNPYSTPETVSFYIHIG  127

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            HIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARDARHRHTNESTRKRVIFYT
Sbjct  128  HIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDARHRHTNESTRKRVIFYT  187

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            +GEY+LL LAS LQV+YIR+LFSKSV YNRV
Sbjct  188  IGEYLLLILASGLQVLYIRQLFSKSVGYNRV  218



>ref|XP_010107717.1| Transmembrane emp24 domain-containing protein A [Morus notabilis]
 gb|EXC16752.1| Transmembrane emp24 domain-containing protein A [Morus notabilis]
Length=217

 Score =   376 bits (966),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = +1

Query  19   YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            + + L++L SFV  +++LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFWNSDHPGID
Sbjct  14   FLMGLLLLTSFVGRIASLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWNSDHPGID  73

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
             TVTSPG N VH++KGTSGDKF+FKAP SGMYKFCFHNPYSTPETVSFYIHVGHIPNEH+
Sbjct  74   LTVTSPGGNTVHTLKGTSGDKFEFKAPHSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHD  133

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
            LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHRHTNESTRKRVIFYTVGEY LL
Sbjct  134  LAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRHTNESTRKRVIFYTVGEYFLL  193

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
            A  S+LQV+YIRRLFSKSVAYNRV
Sbjct  194  AAVSALQVIYIRRLFSKSVAYNRV  217



>gb|KDP40237.1| hypothetical protein JCGZ_02235 [Jatropha curcas]
Length=209

 Score =   375 bits (963),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
             +LFS +  +S+LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPGID TVTS
Sbjct  11   FLLFSLIGRISSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTS  70

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P DNVVH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH+LAKDE
Sbjct  71   PADNVVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDE  130

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            HL+PINVKIAELREALESVT+EQKYLKARDARHR TNESTRKRVI YTVGEYILLAL S+
Sbjct  131  HLNPINVKIAELREALESVTAEQKYLKARDARHRLTNESTRKRVIGYTVGEYILLALISA  190

Query  574  LQVVYIRRLFSKSVAYNRV  630
            LQVVYIRRLFSKSVAYNRV
Sbjct  191  LQVVYIRRLFSKSVAYNRV  209



>ref|XP_002283487.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Vitis vinifera]
 emb|CBI26315.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   375 bits (963),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            + + + FSF+  +SALSVTVN+VECVYEYV+YEGDT+SGNFVVVDHDIFW SDHPGIDFT
Sbjct  14   IFIALFFSFIHRISALSVTVNEVECVYEYVIYEGDTVSGNFVVVDHDIFWGSDHPGIDFT  73

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSP  N VH++KGTSGDKF+FKAPRSGMYKFCF N Y+TPETVSFYIHVGHIPNEHNLA
Sbjct  74   VTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFQNSYATPETVSFYIHVGHIPNEHNLA  133

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNESTRKRVIFYT+GEY+LLAL
Sbjct  134  KDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNESTRKRVIFYTLGEYLLLAL  193

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQVVYIRRLFSKSVAYNRV
Sbjct  194  ASGLQVVYIRRLFSKSVAYNRV  215



>ref|XP_010693774.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   374 bits (961),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + Y +L ++L  +V+ LSALSVTVNDVECVYEYVLYEGD++SGNFVVVDHDIFW+SDHPG
Sbjct  12   QIYMVLALLLSCYVSELSALSVTVNDVECVYEYVLYEGDSVSGNFVVVDHDIFWSSDHPG  71

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSP  NVVH++KGT+GDKF+ KAPRSGMYKFCFHNPYS PETVSFYIHVGHIP+E
Sbjct  72   IDFTVTSPAGNVVHTLKGTAGDKFELKAPRSGMYKFCFHNPYSAPETVSFYIHVGHIPSE  131

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT+ EY+
Sbjct  132  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTLAEYM  191

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            +L +AS LQVVYIR+LFSKSV YNRV
Sbjct  192  MLIVASGLQVVYIRKLFSKSVGYNRV  217



>ref|XP_002517064.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF45227.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=210

 Score =   373 bits (957),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + Y + +++L + +  +S+LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  5    QIYVVGILLLMNLIGRISSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            ID TVTSP DNVVH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN 
Sbjct  65   IDLTVTSPADNVVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNA  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARDARHR TNESTRKRVI YTVGEYI
Sbjct  125  HDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDARHRRTNESTRKRVIGYTVGEYI  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LL L S+LQVVYIRRLFSKSVAYNRV
Sbjct  185  LLGLVSTLQVVYIRRLFSKSVAYNRV  210



>ref|XP_010279262.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Nelumbo nucifera]
Length=214

 Score =   372 bits (956),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            L+L  LFSF+ +LSALS+TVNDVECVYEYVLYEGD++SGNFVVVDHDIFW+SDHPGID T
Sbjct  13   LVLGFLFSFLRHLSALSITVNDVECVYEYVLYEGDSVSGNFVVVDHDIFWSSDHPGIDLT  72

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSP  N VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA
Sbjct  73   VTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  132

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESV +EQKYLKARDARHRHTNEST++RVIFYT+ EY++L  
Sbjct  133  KDEHLDPINVKIAELREALESVMAEQKYLKARDARHRHTNESTQRRVIFYTLAEYLMLFC  192

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQVVYIRRLFSKSVAYNRV
Sbjct  193  ASGLQVVYIRRLFSKSVAYNRV  214



>ref|XP_011030626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Populus euphratica]
Length=211

 Score =   371 bits (952),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++  +L SFV+ + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPGIDFT
Sbjct  10   VVAALLMSFVSRIYSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGIDFT  69

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
             TSPGDN VH++KGTSGDKF+FKAPRSGMYKFCFHNPY+TPETVSFYIHVGHIP+EH+LA
Sbjct  70   ATSPGDNTVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYATPETVSFYIHVGHIPSEHDLA  129

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHL+P+NVKIAELREALESVT+EQ+YLKARD RHRHTNESTR+RVI YTVGEY+LLA 
Sbjct  130  KDEHLNPVNVKIAELREALESVTAEQRYLKARDIRHRHTNESTRRRVIAYTVGEYLLLAA  189

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQVVYIRRLFSKSVAYNRV
Sbjct  190  ASTLQVVYIRRLFSKSVAYNRV  211



>gb|KDO74439.1| hypothetical protein CISIN_1g028009mg [Citrus sinensis]
Length=215

 Score =   371 bits (952),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L +L S +  LS+LSVTVNDVECVYEYV+YEGDT++GNFVVVDHDIFW++DHPGIDFT
Sbjct  14   MILALLMSLIGRLSSLSVTVNDVECVYEYVIYEGDTVAGNFVVVDHDIFWSTDHPGIDFT  73

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPETVSFYIHVGHIPNEHNLA
Sbjct  74   VTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPETVSFYIHVGHIPNEHNLA  133

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNESTRKR++ YT+GEY+LLA+
Sbjct  134  KDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNESTRKRLLGYTIGEYVLLAM  193

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV+YIR+LFSKSVAYNRV
Sbjct  194  ASALQVLYIRKLFSKSVAYNRV  215



>ref|NP_001238453.1| uncharacterized protein LOC100306668 precursor [Glycine max]
 gb|ACU14958.1| unknown [Glycine max]
Length=210

 Score =   370 bits (950),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + +L+ ++ SF   + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFWNSDHPG
Sbjct  5    KMWTVLMCLMVSFFARIESLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWNSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTS   N VH++KGTSGDKF FKAP  GMYKFCFHNPYSTPETVSFYIHVGHIP+E
Sbjct  65   IDFTVTSAAGNTVHNIKGTSGDKFSFKAPTHGMYKFCFHNPYSTPETVSFYIHVGHIPSE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNESTRKRV+FYTVGEY+
Sbjct  125  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNESTRKRVVFYTVGEYL  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  185  LLAAVSALQVIYIRRLFSKSVAYNRV  210



>gb|KHN02756.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=210

 Score =   370 bits (949),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + +L+ ++ SF   + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFWNSDHPG
Sbjct  5    KIWTVLMCLMVSFFARIESLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWNSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTS   N VH++KGTSGDKF FKAP  GMYKFCFHNPYSTPETVSFYIHVGHIP+E
Sbjct  65   IDFTVTSAAGNTVHNIKGTSGDKFSFKAPTHGMYKFCFHNPYSTPETVSFYIHVGHIPSE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNESTRKRV+FYTVGEY+
Sbjct  125  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNESTRKRVVFYTVGEYL  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  185  LLAAVSALQVIYIRRLFSKSVAYNRV  210



>gb|AFK37006.1| unknown [Lotus japonicus]
Length=215

 Score =   370 bits (950),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + +L+ ++ SFV  + +LSVTV++VEC+YEYVLYEGDT+SGNFVVVDHDIFW SDHPG
Sbjct  10   KMWMVLMCLMLSFVARIESLSVTVHEVECIYEYVLYEGDTVSGNFVVVDHDIFWGSDHPG  69

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            ID TVTSP  N VH +KGTSGDKF FKAP SGMYKFCFHNPYSTPETVSFYIHVGHIPNE
Sbjct  70   IDLTVTSPAGNTVHDIKGTSGDKFQFKAPASGMYKFCFHNPYSTPETVSFYIHVGHIPNE  129

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HNLAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNESTR RVIFYTVGEY+
Sbjct  130  HNLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNESTRSRVIFYTVGEYL  189

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  190  LLAAVSTLQVIYIRRLFSKSVAYNRV  215



>ref|XP_006489467.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Citrus sinensis]
Length=215

 Score =   370 bits (949),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L +L S +  LS+LSVTVNDVECVYEYV+YEGDT++GNFVVVDHDIFW++DHPGIDFT
Sbjct  14   MILALLMSLIGRLSSLSVTVNDVECVYEYVIYEGDTVAGNFVVVDHDIFWSTDHPGIDFT  73

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPETVSFYIHVGHIPNEHNLA
Sbjct  74   VTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPETVSFYIHVGHIPNEHNLA  133

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNESTRKR++ YT+GEY+LLA+
Sbjct  134  KDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNESTRKRLLGYTIGEYVLLAM  193

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQ++YIR+LFSKSVAYNRV
Sbjct  194  ASALQMLYIRKLFSKSVAYNRV  215



>ref|XP_009145255.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brassica rapa]
 emb|CDY10677.1| BnaA05g16850D [Brassica napus]
Length=217

 Score =   369 bits (948),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            ++ I  + L+ ++LFS +  +S+LSVTV+D ECV EYVLYEGD +SGNFVVVDHDIFW S
Sbjct  8    SSKIHVFVLVCLILFSSIERISSLSVTVSDDECVQEYVLYEGDNVSGNFVVVDHDIFWGS  67

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPG+DFTVTSP  N+VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGH
Sbjct  68   DHPGLDFTVTSPAGNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  127

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEH+LAKDEHLDP+NVKIAELREALESV SEQKYLKARD RHRHTNESTRKRVIFYTV
Sbjct  128  IPNEHDLAKDEHLDPVNVKIAELREALESVVSEQKYLKARDTRHRHTNESTRKRVIFYTV  187

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            GEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  188  GEYIFLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_006420043.1| hypothetical protein CICLE_v10005664mg [Citrus clementina]
 gb|ESR33283.1| hypothetical protein CICLE_v10005664mg [Citrus clementina]
Length=261

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L +L S +  LS+LSVTVNDVECVYEYV+YEGDT++GNFVVVDHDIFW++DHPGIDFT
Sbjct  60   MILALLMSLIGRLSSLSVTVNDVECVYEYVIYEGDTVAGNFVVVDHDIFWSTDHPGIDFT  119

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPETVSFYIHVGHIPNEHNLA
Sbjct  120  VTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPETVSFYIHVGHIPNEHNLA  179

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNESTRKR++ YT+GEY+LLA+
Sbjct  180  KDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNESTRKRLLGYTIGEYVLLAM  239

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV+YIR+LFSKSVAYNRV
Sbjct  240  ASALQVLYIRKLFSKSVAYNRV  261



>emb|CDY10314.1| BnaC05g29650D [Brassica napus]
Length=217

 Score =   368 bits (945),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            ++ I  + L+ ++LFS +  +S+LSVTV+D ECV EYVLYEGD +SGNFVVVDHDIFW S
Sbjct  8    SSKIHVFVLVGLILFSSIERISSLSVTVSDDECVQEYVLYEGDNVSGNFVVVDHDIFWGS  67

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPG+DFTVTSP  N+VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGH
Sbjct  68   DHPGLDFTVTSPAGNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  127

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEH+LAKDEHLDP+NVKIAELREALESV SEQKYLKARD RHRHTNESTRKRVIFYTV
Sbjct  128  IPNEHDLAKDEHLDPVNVKIAELREALESVVSEQKYLKARDTRHRHTNESTRKRVIFYTV  187

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            GEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  188  GEYIFLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_010532582.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Tarenaya hassleriana]
Length=217

 Score =   368 bits (944),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
            ++L S +  +S+LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPG+DF V+S
Sbjct  19   LLLLSSIGQISSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGLDFDVSS  78

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P  N+VHS+KGTSGDKF+FKAPRSGMYKFCFHNP+STPETVSFYIHVGHIPNEH++AKDE
Sbjct  79   PAGNIVHSLKGTSGDKFEFKAPRSGMYKFCFHNPHSTPETVSFYIHVGHIPNEHDVAKDE  138

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            HLDPINVKIAELREALESV SEQKYLKARD RHRHTNESTRKRVIFYTVGEY+LLA AS 
Sbjct  139  HLDPINVKIAELREALESVISEQKYLKARDTRHRHTNESTRKRVIFYTVGEYLLLAAASG  198

Query  574  LQVVYIRRLFSKSVAYNRV  630
            LQV+YIR+LFSKSVAYNRV
Sbjct  199  LQVLYIRKLFSKSVAYNRV  217



>gb|KHG26199.1| Transmembrane emp24 domain-containing A [Gossypium arboreum]
Length=212

 Score =   367 bits (942),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL+ ++LF+ V N+S+LSV VN++ECVYEYVLYEGDTISGNFVVVDHDIFW SDHPG
Sbjct  7    KMWALMGLLLFNSVCNVSSLSVNVNNIECVYEYVLYEGDTISGNFVVVDHDIFWGSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSP  N VH +KGTSGDKF+FKAPRSGMYKFCFHNP+S PETVSF+IH+GHIP E
Sbjct  67   IDFTVTSPAGNTVHELKGTSGDKFEFKAPRSGMYKFCFHNPHSAPETVSFHIHIGHIPTE  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNESTRKRVI YTVGEYI
Sbjct  127  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNESTRKRVIGYTVGEYI  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  187  LLTLVSALQVIYIRQLFSKSVAYNRV  212



>ref|XP_010511795.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Camelina sativa]
Length=214

 Score =   367 bits (941),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L + +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVG  185

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            EY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  EYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>ref|NP_188924.3| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis 
thaliana]
 sp|Q9LIL4.1|P24B3_ARATH RecName: Full=Transmembrane emp24 domain-containing protein p24beta3; 
AltName: Full=p24 family protein beta2; Short=p24beta2; 
AltName: Full=p24 family protein beta3; Short=p24beta3; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03029.1| coated vesicle membrane protein-like [Arabidopsis thaliana]
 gb|AAL50082.1| AT3g22845/MWI23_22 [Arabidopsis thaliana]
 gb|AAM10366.1| AT3g22845/MWI23_22 [Arabidopsis thaliana]
 gb|AEE76683.1| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis 
thaliana]
Length=214

 Score =   366 bits (940),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L + +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAP+SGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVG  185

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            EYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  EYIFLAAASGLQVLYIRKLFSKSVAYNRV  214



>ref|XP_006406122.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum]
 gb|ESQ47575.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum]
Length=217

 Score =   366 bits (940),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            I  + L+ ++L S +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SDHP
Sbjct  11   IHVFVLVGLILLSSIERISSLSVTVNDDECVQEYVLYEGDTVSGNFVVVDHDIFWGSDHP  70

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN
Sbjct  71   GLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  130

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            EH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEY
Sbjct  131  EHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEY  190

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            I LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  191  IFLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_006299601.1| hypothetical protein CARUB_v10015779mg [Capsella rubella]
 gb|EOA32499.1| hypothetical protein CARUB_v10015779mg [Capsella rubella]
Length=214

 Score =   366 bits (939),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L + +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVG  185

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            EY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  EYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>ref|NP_001238171.1| uncharacterized protein LOC100499675 precursor [Glycine max]
 ref|XP_006605302.1| PREDICTED: uncharacterized protein LOC100499675 isoform X1 [Glycine 
max]
 gb|ACU13193.1| unknown [Glycine max]
Length=210

 Score =   366 bits (939),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + + + +  SF   + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  5    KMWMVFMCLTVSFFARIESLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVT+   N VHS+KGTSGDKF FKAP  GMYKFCFHNPYSTPETVSFYIHVGHIP+E
Sbjct  65   IDFTVTTAAGNTVHSIKGTSGDKFSFKAPSHGMYKFCFHNPYSTPETVSFYIHVGHIPSE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNESTRKRV+FYTVGEY+
Sbjct  125  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNESTRKRVVFYTVGEYL  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  185  LLAAVSALQVIYIRRLFSKSVAYNRV  210



>ref|XP_002883380.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59639.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   365 bits (938),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L + +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVI YTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVILYTVG  185

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            EYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  EYIFLAAASGLQVLYIRKLFSKSVAYNRV  214



>gb|KFK39568.1| hypothetical protein AALP_AA3G261200 [Arabis alpina]
Length=214

 Score =   365 bits (938),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L S +  +S+LSVTVN+ ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLSSIERISSLSVTVNEDECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVG  185

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            EY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  EYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>gb|KEH43778.1| emp24/gp25L/p24 family protein [Medicago truncatula]
Length=213

 Score =   365 bits (937),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +  L+ ++F FV  + +LSVTV DVEC+YEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  8    KMWMALMCLVFIFVDRIESLSVTVQDVECLYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  67

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG NVV  +KGTSGDKF FKAP  GMYKFCFHNPYSTPETVSFYIHVGHIP+E
Sbjct  68   IDFTVTSPGGNVVQDIKGTSGDKFQFKAPVHGMYKFCFHNPYSTPETVSFYIHVGHIPSE  127

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYL+ARDARHRHTNEST KRVIFYTVGEY+
Sbjct  128  HDLAKDEHLDPINVKIAELREALESVTAEQKYLRARDARHRHTNESTHKRVIFYTVGEYL  187

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  188  LLAAVSALQVIYIRRLFSKSVAYNRV  213



>ref|XP_007143318.1| hypothetical protein PHAVU_007G062200g [Phaseolus vulgaris]
 gb|ESW15312.1| hypothetical protein PHAVU_007G062200g [Phaseolus vulgaris]
Length=210

 Score =   365 bits (937),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + +L+ ++  F   + +LSVTVNDVECVYEYVLYEGDT++GNFVVVDHDIFW+SDHPG
Sbjct  5    KMWTVLMCLILIFFARIESLSVTVNDVECVYEYVLYEGDTVTGNFVVVDHDIFWSSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N V ++KGTSGDKFDFKAP+ GMYKFCFHNP STPETVSFYIHVGHIP+E
Sbjct  65   IDFTVTSPGGNTVTNIKGTSGDKFDFKAPKHGMYKFCFHNPQSTPETVSFYIHVGHIPSE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDP+NVKIAELREALESVT+EQKYLKARDARHRHTNESTRKRV+FYTVGEY 
Sbjct  125  HDLAKDEHLDPVNVKIAELREALESVTAEQKYLKARDARHRHTNESTRKRVVFYTVGEYF  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  185  LLAAVSALQVLYIRRLFSKSVAYNRV  210



>ref|XP_009135831.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Brassica rapa]
 emb|CDX92961.1| BnaA03g36830D [Brassica napus]
Length=219

 Score =   364 bits (935),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = +1

Query  19   YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            + LL + L S +  +S+LSVTV+D ECV EYVLYEGDT+SGNFVVVDH+IFW SDHPG+D
Sbjct  16   FVLLALTLLSSIERISSLSVTVSDDECVQEYVLYEGDTVSGNFVVVDHEIFWGSDHPGLD  75

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
            FTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH+
Sbjct  76   FTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHD  135

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
            LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEYI L
Sbjct  136  LAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEYIFL  195

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
            A AS LQV+YIR+LFSKSVAYNRV
Sbjct  196  AAASGLQVLYIRKLFSKSVAYNRV  219



>ref|XP_004496668.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cicer arietinum]
Length=216

 Score =   363 bits (933),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            +L+ ++F FV  + +LSVTVNDVEC+YEYVLYEGDT+SGNFVVVDHDIFW+SDHPGIDFT
Sbjct  15   VLMCLMFIFVDRIESLSVTVNDVECIYEYVLYEGDTVSGNFVVVDHDIFWSSDHPGIDFT  74

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
             TSPG NVV  +KGTSGDKF FKAP  GMYKFCFHNPYSTPETVSFYIHVGHIP+EH+LA
Sbjct  75   ATSPGGNVVQDIKGTSGDKFQFKAPVHGMYKFCFHNPYSTPETVSFYIHVGHIPSEHDLA  134

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESVT+EQKYL+ARDARHRHTNEST  RVIFYTVGEY+LLA 
Sbjct  135  KDEHLDPINVKIAELREALESVTAEQKYLRARDARHRHTNESTHTRVIFYTVGEYLLLAA  194

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
             S LQV+YIRRLFSKSVAYNRV
Sbjct  195  VSVLQVIYIRRLFSKSVAYNRV  216



>ref|XP_007223416.1| hypothetical protein PRUPE_ppa011292mg [Prunus persica]
 gb|EMJ24615.1| hypothetical protein PRUPE_ppa011292mg [Prunus persica]
Length=216

 Score =   363 bits (933),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 187/210 (89%), Gaps = 2/210 (1%)
 Frame = +1

Query  7    GIRAYALLLM--MLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            G    AL+LM  +L SFV  +++LSVTVND+ECVYEYVLYE DT+SGNFVVVDHDIFW S
Sbjct  7    GWSGNALMLMGLLLVSFVGKIASLSVTVNDIECVYEYVLYEDDTVSGNFVVVDHDIFWGS  66

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGH
Sbjct  67   DHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGH  126

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTV
Sbjct  127  IPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVMYTV  186

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            GEYI LA AS+LQVVYIR+LFSKSV YNRV
Sbjct  187  GEYIALAAASALQVVYIRKLFSKSVGYNRV  216



>gb|KJB38216.1| hypothetical protein B456_006G242900 [Gossypium raimondii]
Length=212

 Score =   363 bits (932),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL+ ++LF+ V N+S+LSV VN++ECVYEYVLYEGDTISGNFVVVDHDIFW SDHPG
Sbjct  7    KMWALMGLLLFNSVCNVSSLSVNVNNIECVYEYVLYEGDTISGNFVVVDHDIFWGSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSP  N VH +KGTSGDKF+ KAPRSGMYKFCFHNP+S PETVSF+IHVGHIP E
Sbjct  67   IDFTVTSPLGNTVHELKGTSGDKFEVKAPRSGMYKFCFHNPHSAPETVSFHIHVGHIPTE  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNESTRKRVI YTVGEYI
Sbjct  127  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNESTRKRVIGYTVGEYI  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  187  LLTLVSALQVIYIRQLFSKSVAYNRV  212



>ref|XP_009590337.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana tomentosiformis]
Length=218

 Score =   363 bits (933),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 193/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  1    AAGIRA---YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIF  171
             AG++    +AL+ +++FSFV NL+ALSVTVND ECVYEYVL EGDTISGNFVVVDH+IF
Sbjct  6    GAGVKCSKVFALVAILVFSFVGNLTALSVTVNDEECVYEYVLNEGDTISGNFVVVDHEIF  65

Query  172  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  351
            W+SDHPGIDFTVTSP  NVVH+MKGT+ DKF+ KAPRSGM+KFCFHNP+STPETVSFYIH
Sbjct  66   WSSDHPGIDFTVTSPAGNVVHTMKGTAEDKFELKAPRSGMFKFCFHNPHSTPETVSFYIH  125

Query  352  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  531
            VGHIPNEH+LAKDEHLDPINVKIAEL EALESVT+EQKYL+ARDARHRHTNEST KRV+F
Sbjct  126  VGHIPNEHDLAKDEHLDPINVKIAELGEALESVTAEQKYLRARDARHRHTNESTSKRVLF  185

Query  532  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            YTV EY+LL LAS LQV+YIR LFSKS+ YNR+
Sbjct  186  YTVAEYVLLILASGLQVLYIRSLFSKSIGYNRI  218



>ref|XP_004134119.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cucumis sativus]
 ref|XP_004162266.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cucumis sativus]
 gb|KGN56940.1| hypothetical protein Csa_3G145770 [Cucumis sativus]
Length=215

 Score =   363 bits (932),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            S +  + ++SVTVN+VECVYEYVLYEGD++SGNFVVVDHDIFW +DHPGI+FTVTSP  N
Sbjct  21   SLIAGIDSISVTVNEVECVYEYVLYEGDSVSGNFVVVDHDIFWGADHPGIEFTVTSPAGN  80

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
            VVHS+K TSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH+ AKDEHLDP
Sbjct  81   VVHSLKETSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDHAKDEHLDP  140

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            INVKIAELREALESV SEQKYLKARDARHRHTNESTRKRVIFYTVGEY+LLA+AS LQV+
Sbjct  141  INVKIAELREALESVISEQKYLKARDARHRHTNESTRKRVIFYTVGEYLLLAVASGLQVI  200

Query  586  YIRRLFSKSVAYNRV  630
            YIRRLFSKSVAYNRV
Sbjct  201  YIRRLFSKSVAYNRV  215



>ref|XP_008224230.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Prunus mume]
Length=216

 Score =   363 bits (931),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +A  L+ ++L SFV  +++LSVTVND+EC+YEYVLYE DT+SGNFVVVDHDIFW SDHPG
Sbjct  11   KALMLMGLLLVSFVGKIASLSVTVNDIECIYEYVLYEDDTVSGNFVVVDHDIFWGSDHPG  70

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNE
Sbjct  71   LDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNE  130

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTVGEYI
Sbjct  131  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVMYTVGEYI  190

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             LA AS+LQVVYIR+LFSKSV YNRV
Sbjct  191  ALAAASALQVVYIRKLFSKSVGYNRV  216



>ref|XP_010259153.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nelumbo nucifera]
Length=214

 Score =   362 bits (930),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +1

Query  58   NLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHS  237
            +LSALS+TVNDVECVYEYVLYEGD++SGNFVVVDH+IFW+SDHPGIDFTVT+PG NVVH+
Sbjct  24   HLSALSITVNDVECVYEYVLYEGDSVSGNFVVVDHEIFWSSDHPGIDFTVTAPGGNVVHT  83

Query  238  MKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  417
            +KGTSGDKF+FKAPR+GM+KFCFHNPYSTPETVSF+IHVGHIPNEH+LAKDEHLDPINVK
Sbjct  84   LKGTSGDKFEFKAPRNGMFKFCFHNPYSTPETVSFHIHVGHIPNEHDLAKDEHLDPINVK  143

Query  418  IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRR  597
            IAELREALE+VT+EQKYLKARDARHRHTNESTR+RVIFYT+ EY+LL  AS LQVVYIRR
Sbjct  144  IAELREALEAVTAEQKYLKARDARHRHTNESTRRRVIFYTLAEYLLLICASGLQVVYIRR  203

Query  598  LFSKSVAYNRV  630
            LFSKSVAYNRV
Sbjct  204  LFSKSVAYNRV  214



>ref|XP_009778405.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana sylvestris]
Length=220

 Score =   362 bits (928),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  1    AAGIRA---YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIF  171
             AG++    + L+ +++FSFV NL+ALSVTVND EC+YEYVL EGDTISGNFVVVDH+IF
Sbjct  8    GAGVKCSKVFTLVAILVFSFVGNLTALSVTVNDEECIYEYVLNEGDTISGNFVVVDHEIF  67

Query  172  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  351
            W+SDHPGIDFTVTSP  NVVH+MKGT+ DKF+ KAPRSGM+KFCFHNP+STPETVSFYIH
Sbjct  68   WSSDHPGIDFTVTSPAGNVVHTMKGTAEDKFELKAPRSGMFKFCFHNPHSTPETVSFYIH  127

Query  352  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  531
            VGHIPNEH+LAKDEHLDPINVKIAEL EALESVT+EQKYL+ARDARHRHTNEST KRV+F
Sbjct  128  VGHIPNEHDLAKDEHLDPINVKIAELGEALESVTAEQKYLRARDARHRHTNESTSKRVLF  187

Query  532  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            YTV EY+LL LAS LQV+YIR LFSKS+ YNRV
Sbjct  188  YTVAEYVLLILASGLQVLYIRSLFSKSIGYNRV  220



>ref|XP_011090665.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Sesamum indicum]
Length=218

 Score =   361 bits (926),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  76   VTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSG  255
            VTVND+ECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPGIDFTVTSP  N VH++KGTSG
Sbjct  34   VTVNDIECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPGIDFTVTSPAGNTVHTLKGTSG  93

Query  256  DKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELRE  435
            DKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP EH+LAKDEHLDPINVKIAELRE
Sbjct  94   DKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPTEHDLAKDEHLDPINVKIAELRE  153

Query  436  ALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSV  615
            ALESVT+EQKYLKARDARHRHTNESTR+RVIFYTV EYILLAL S LQVVYIR+LFSKSV
Sbjct  154  ALESVTAEQKYLKARDARHRHTNESTRRRVIFYTVAEYILLALVSGLQVVYIRKLFSKSV  213

Query  616  AYNRV  630
            AYNRV
Sbjct  214  AYNRV  218



>emb|CDY46609.1| BnaCnng14310D [Brassica napus]
Length=218

 Score =   361 bits (926),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            I  +AL+ ++L   +  +S+LSVTV + ECV EYVLYEGDT+SGNFVVVDHD+FW  DHP
Sbjct  12   INVFALVGLILLKSINPISSLSVTVEEDECVQEYVLYEGDTVSGNFVVVDHDVFWGPDHP  71

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            GIDFTVTSP  N+V +MKGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN
Sbjct  72   GIDFTVTSPAGNIVQTMKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  131

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            EH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEY
Sbjct  132  EHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEY  191

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            I LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  192  IFLAAASGLQILYIRKLFSKSVAYNRV  218



>ref|XP_010466578.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane emp24 domain-containing 
protein p24beta3 [Camelina sativa]
Length=218

 Score =   360 bits (925),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 189/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVND----VECVYEYVLYEGDTISGNFVVVDHDIF  171
            A I  + L+ ++L + +  +S+LSVTVND     ECV EYVLYEGDT+SGNFVVVDHDIF
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDRMCXEECVQEYVLYEGDTVSGNFVVVDHDIF  65

Query  172  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  351
            W SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIH
Sbjct  66   WGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIH  125

Query  352  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  531
            VGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIF
Sbjct  126  VGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIF  185

Query  532  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            YTVGEY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  186  YTVGEYMFLAAASGLQVLYIRKLFSKSVAYNRV  218



>ref|XP_008438614.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Cucumis melo]
Length=215

 Score =   360 bits (923),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            + ++SVTVN++ECVYEYVLYEGD++SGNFVVVDHDIFW +DHPGIDFTVTSP  NVVHS+
Sbjct  26   IDSISVTVNEIECVYEYVLYEGDSVSGNFVVVDHDIFWGADHPGIDFTVTSPAGNVVHSL  85

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKI  420
            K TSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE++ AKDEHLDPINVKI
Sbjct  86   KETSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNENDHAKDEHLDPINVKI  145

Query  421  AELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRL  600
            AELREALESVT+EQKYLKARDARHRHTNESTRKRVIFYTVGEY+LLA+AS LQV+YIRRL
Sbjct  146  AELREALESVTAEQKYLKARDARHRHTNESTRKRVIFYTVGEYLLLAVASGLQVIYIRRL  205

Query  601  FSKSVAYNRV  630
            FSKSVAYNRV
Sbjct  206  FSKSVAYNRV  215



>emb|CDY34226.1| BnaA01g24430D [Brassica napus]
Length=218

 Score =   359 bits (922),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            I  +AL+ ++L + +  +S+LSVTV + ECV EYVLYEGDT+SGNFVVVDHD+FW  DHP
Sbjct  12   INVFALVGLILLNSINPISSLSVTVEEDECVQEYVLYEGDTVSGNFVVVDHDVFWGPDHP  71

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            GIDFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN
Sbjct  72   GIDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  131

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            EH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEY
Sbjct  132  EHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEY  191

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            I LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  192  IFLAAASGLQILYIRKLFSKSVAYNRV  218



>ref|XP_006356044.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Solanum tuberosum]
Length=216

 Score =   359 bits (921),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +  AL+ ++LFSFV +LSALSVTVNDVECV EYVLYEGDTISGNFVVVDHDIFW+SDHPG
Sbjct  11   KVIALVAILLFSFVGDLSALSVTVNDVECVQEYVLYEGDTISGNFVVVDHDIFWSSDHPG  70

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSP  NVVH+MKGT+GDKF+FKAPRSGM+ FCFHNP+S+PETVSFYIH+GHI NE
Sbjct  71   IDFTVTSPSGNVVHTMKGTAGDKFEFKAPRSGMFNFCFHNPHSSPETVSFYIHIGHISNE  130

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDP+NVKIAELREALES+T+EQ YLKARD+RHR TN+STR RVIFYTV EY+
Sbjct  131  HDLAKDEHLDPVNVKIAELREALESITTEQHYLKARDSRHRRTNQSTRDRVIFYTVAEYL  190

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LL LAS LQ +YIR LFSKS+ YNR+
Sbjct  191  LLILASGLQAMYIRSLFSKSIGYNRI  216



>gb|EYU41435.1| hypothetical protein MIMGU_mgv1a013526mg [Erythranthe guttata]
Length=218

 Score =   359 bits (921),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            S V+ + ALSVTVND EC+Y+YVLYEGDT+SGNFVVVDHDIFWNSDHPGIDFTVTSP  +
Sbjct  24   STVSRVPALSVTVNDEECIYDYVLYEGDTVSGNFVVVDHDIFWNSDHPGIDFTVTSPAGD  83

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
             VH+MKGT+GDKF+FKAP+SGMYKFCFHNP+STPETVSFYIHVGHIP EH+LAKDEHLDP
Sbjct  84   TVHNMKGTAGDKFEFKAPKSGMYKFCFHNPFSTPETVSFYIHVGHIPTEHDLAKDEHLDP  143

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            INVKIAELREALESVT+EQ YLKARD RHRHTNESTRKRVIFYTV EYILLAL S LQV 
Sbjct  144  INVKIAELREALESVTAEQNYLKARDTRHRHTNESTRKRVIFYTVAEYILLALVSGLQVA  203

Query  586  YIRRLFSKSVAYNRV  630
            YIRRLFSKSVAYNRV
Sbjct  204  YIRRLFSKSVAYNRV  218



>ref|XP_004296587.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Fragaria vesca subsp. vesca]
Length=217

 Score =   358 bits (920),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = +1

Query  22   ALLLMM---LFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            A++LMM   L S V  + +LSVTVND+ECVYEYVLYE DT+SGNFVVVDHDIFW++DHPG
Sbjct  12   AVILMMGVLLVSLVGRIESLSVTVNDIECVYEYVLYEDDTVSGNFVVVDHDIFWSNDHPG  71

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF+IHVGHIP+E
Sbjct  72   LDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFHIHVGHIPSE  131

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTRKRV+FYT+GEY+
Sbjct  132  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDTRHRHTNESTRKRVVFYTLGEYL  191

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            +L  AS LQ+VYIRRLFSKS+ YNRV
Sbjct  192  MLVAASGLQIVYIRRLFSKSIGYNRV  217



>ref|XP_009108603.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brassica rapa]
Length=218

 Score =   358 bits (918),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            I   AL+ ++L + +  +S+LSVTV + ECV EYVLYEGDT+SGNFVVVDHD+FW  DHP
Sbjct  12   INVLALVGLILLNSINPISSLSVTVEEDECVQEYVLYEGDTVSGNFVVVDHDVFWGPDHP  71

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            GIDFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN
Sbjct  72   GIDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  131

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            EH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEY
Sbjct  132  EHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEY  191

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            I LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  192  IFLAAASGLQILYIRKLFSKSVAYNRV  218



>ref|XP_010317396.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Solanum lycopersicum]
Length=216

 Score =   358 bits (918),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +  AL+ ++LFSFV +LSALSVTVNDVECV +YVLYEGDTISGNFVVVDHDIFWNSDHPG
Sbjct  11   KVLALVAILLFSFVGDLSALSVTVNDVECVQDYVLYEGDTISGNFVVVDHDIFWNSDHPG  70

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTV SP  NVVH+MKGT+GDKF+ KAPRSGMY FCFHNP+S+PETVSFYIH+GHI NE
Sbjct  71   IDFTVASPSGNVVHTMKGTAGDKFELKAPRSGMYNFCFHNPHSSPETVSFYIHIGHISNE  130

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDP+NVKIAELREALESVT+EQ YLKARD+RHR TN+STR RVIFYTV EY+
Sbjct  131  HDLAKDEHLDPVNVKIAELREALESVTAEQHYLKARDSRHRRTNQSTRDRVIFYTVAEYL  190

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LL LAS LQ +YIR LFSKS+ YNR+
Sbjct  191  LLILASGLQAMYIRSLFSKSIGYNRI  216



>ref|XP_009343969.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   357 bits (915),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R   L+ ++L SFV  +++LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW +DHPG
Sbjct  6    RGLTLIGLLLVSFVGKIASLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGADHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPGDN VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNE
Sbjct  66   LDLIVTSPGDNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTVGEY+
Sbjct  126  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVLYTVGEYL  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  186  ALAAASALQVVYIRKLFSKSVAYNRV  211



>emb|CDY61077.1| BnaCnng37320D [Brassica napus]
Length=219

 Score =   356 bits (913),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            +S+LSVTV+D ECV EYVLYEGDT+SGNFVVVDH+IFW SDHPG+DFTVTSP  N+V ++
Sbjct  30   ISSLSVTVSDDECVQEYVLYEGDTVSGNFVVVDHEIFWGSDHPGLDFTVTSPAGNIVQTL  89

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKI  420
            KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH+LAKDEHLDP+NVKI
Sbjct  90   KGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDEHLDPVNVKI  149

Query  421  AELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRL  600
            AELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVGEYI LA AS LQV+YIR+L
Sbjct  150  AELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAASGLQVLYIRKL  209

Query  601  FSKSVAYNRV  630
            FSKSVAYNRV
Sbjct  210  FSKSVAYNRV  219



>ref|XP_009399353.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Musa acuminata subsp. malaccensis]
Length=216

 Score =   354 bits (909),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            + G+    L+L +L +    LSALSVTVNDVECVYE+VLYEGDT+SGNFVVVDHDIFWNS
Sbjct  7    SVGLAEVFLILGLLATVPCRLSALSVTVNDVECVYEFVLYEGDTVSGNFVVVDHDIFWNS  66

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPGID  VTSP  N VHS+KGTSGDKF+FKAPR GMYKFCFHNP  TPETVSFYIHVGH
Sbjct  67   DHPGIDLVVTSPAGNTVHSLKGTSGDKFEFKAPRGGMYKFCFHNPNRTPETVSFYIHVGH  126

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEH+LAKDEHL+PINVKIAELREALESVT+EQ+YLKAR+ARHRHTNESTR+R+  YT+
Sbjct  127  IPNEHDLAKDEHLNPINVKIAELREALESVTAEQRYLKAREARHRHTNESTRRRLTVYTL  186

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             EY++LA AS LQVVYIRRLF+KSVAYNRV
Sbjct  187  TEYLVLACASGLQVVYIRRLFNKSVAYNRV  216



>emb|CDO99114.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   352 bits (904),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/191 (91%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +1

Query  58   NLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHS  237
            ++SALSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPGID TVT+PG N VHS
Sbjct  29   SVSALSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTAPGGNQVHS  88

Query  238  MKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  417
            ++GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP EH+LAKDEHLDPINVK
Sbjct  89   VRGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPTEHDLAKDEHLDPINVK  148

Query  418  IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRR  597
            IAELREALESVT+EQKYLKARDARHRHTNESTRKRVIFYT  EY+LLALASSLQV+YIRR
Sbjct  149  IAELREALESVTAEQKYLKARDARHRHTNESTRKRVIFYTATEYLLLALASSLQVLYIRR  208

Query  598  LFSKSVAYNRV  630
            LFSKSVAYNRV
Sbjct  209  LFSKSVAYNRV  219



>ref|XP_010034397.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Eucalyptus grandis]
 gb|KCW84120.1| hypothetical protein EUGRSUZ_B01001 [Eucalyptus grandis]
Length=216

 Score =   350 bits (897),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  76   VTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSG  255
            VTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPGIDF VTSPG NVV ++KGTSG
Sbjct  32   VTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPGIDFIVTSPGGNVVQTLKGTSG  91

Query  256  DKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELRE  435
            DKF FKAPRSGMYKFCFHNPYSTPETVSF IH GHIPN+H+LAKDEHLDPINVKIAELRE
Sbjct  92   DKFKFKAPRSGMYKFCFHNPYSTPETVSFNIHAGHIPNDHDLAKDEHLDPINVKIAELRE  151

Query  436  ALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSV  615
            ALESVT EQKYLKARD+RHRHTNESTRKRVI+YTV EY+LLA  S+LQVVYIRRLFSKSV
Sbjct  152  ALESVTLEQKYLKARDSRHRHTNESTRKRVIYYTVAEYLLLACVSTLQVVYIRRLFSKSV  211

Query  616  AYNRV  630
             YNRV
Sbjct  212  GYNRV  216



>ref|XP_010551705.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010551706.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
isoform X2 [Tarenaya hassleriana]
Length=217

 Score =   349 bits (896),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            S +  +S+LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW +DHPG+DF V+SP  N
Sbjct  23   SSIGRISSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGADHPGLDFEVSSPAGN  82

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
            VVHS+KGTSGDKF+FKAP+SGMYKFCFHNPYS+PETVSFYIHVGHIPNEH++AKDEHLDP
Sbjct  83   VVHSLKGTSGDKFEFKAPKSGMYKFCFHNPYSSPETVSFYIHVGHIPNEHDIAKDEHLDP  142

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            INVKIAELREALESV SEQKYLKARDARHRHTNESTRKRVIFYTVGEY+LLA AS+LQV+
Sbjct  143  INVKIAELREALESVISEQKYLKARDARHRHTNESTRKRVIFYTVGEYLLLAAASALQVL  202

Query  586  YIRRLFSKSVAYNRV  630
            YIR+LFSKSVAYNRV
Sbjct  203  YIRKLFSKSVAYNRV  217



>ref|XP_010525219.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Tarenaya hassleriana]
Length=214

 Score =   349 bits (895),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            +S+LSVTVN+VECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPG+DF V+SP  NVVHS+
Sbjct  25   ISSLSVTVNNVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGLDFEVSSPAGNVVHSL  84

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKI  420
            KGTSGDKF+FKAP+SGMYKFCFHNPYSTPETVSFYIHVGHIPNEH++AKDEHLDPINVKI
Sbjct  85   KGTSGDKFEFKAPKSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDVAKDEHLDPINVKI  144

Query  421  AELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRL  600
            AELREALESV SEQKYLKARDARHRHTNESTRKRVIFYTVGEY+LLA AS+LQV+YIR+L
Sbjct  145  AELREALESVISEQKYLKARDARHRHTNESTRKRVIFYTVGEYLLLAAASALQVLYIRKL  204

Query  601  FSKSVAYNRV  630
            FSKSVAYNRV
Sbjct  205  FSKSVAYNRV  214



>ref|XP_010923517.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=216

 Score =   349 bits (895),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            LSALS+TVNDVECVY+YVLYEGDT+SGNFVVVDHD+FW+SDHPGID  VTSPG N VHSM
Sbjct  27   LSALSITVNDVECVYDYVLYEGDTVSGNFVVVDHDLFWSSDHPGIDLVVTSPGGNTVHSM  86

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKI  420
            KGTSGDKF+FKAP++GMYKFCFHNP  TPETVSFY+HVGHIPNEH+LAKDEHLDPINVKI
Sbjct  87   KGTSGDKFEFKAPQAGMYKFCFHNPDRTPETVSFYVHVGHIPNEHDLAKDEHLDPINVKI  146

Query  421  AELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRL  600
            A+LREALESVT+EQ+YL+AR+ARHRHTNESTR+R+IFYT+ EY++LA AS LQVVYI RL
Sbjct  147  AQLREALESVTAEQRYLRAREARHRHTNESTRRRLIFYTIMEYLVLACASGLQVVYIHRL  206

Query  601  FSKSVAYNRV  630
            F+KSVAYNRV
Sbjct  207  FNKSVAYNRV  216



>ref|XP_009398371.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Musa acuminata subsp. malaccensis]
Length=216

 Score =   348 bits (893),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            G+    L++ +L S    LSALSVTVND+ECVYE+V YEGDT+SGNFVVVDHDIFW SDH
Sbjct  9    GLVEVFLIVGLLLSCPRRLSALSVTVNDLECVYEFVPYEGDTVSGNFVVVDHDIFWGSDH  68

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
            PGID  VTSP  N VH+MKGTSGDKFDFKAPR+GMYKFCFHN    PETVSFYIHVGHIP
Sbjct  69   PGIDLIVTSPAGNTVHTMKGTSGDKFDFKAPRAGMYKFCFHNANRAPETVSFYIHVGHIP  128

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
            NEH+LAKDEHLDPINVKIA+LREALESVT+EQ+YLKAR+ARHRHTNESTRKR+ FYTV E
Sbjct  129  NEHDLAKDEHLDPINVKIAQLREALESVTAEQRYLKAREARHRHTNESTRKRLTFYTVME  188

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
            Y++LA AS LQVVYIRRLF++SVAYNRV
Sbjct  189  YLVLACASGLQVVYIRRLFNRSVAYNRV  216



>ref|XP_009375992.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   347 bits (890),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +   L+ ++L SF   +++LSVTVNDVEC+YEYVLYEGDT+SGNFVVVDHDIFW +DHPG
Sbjct  6    KGLMLIGLLLVSFFGKIASLSVTVNDVECLYEYVLYEGDTVSGNFVVVDHDIFWGADHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNE
Sbjct  66   LDLVVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTV EY+
Sbjct  126  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVLYTVAEYL  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  186  ALAAASALQVVYIRKLFSKSVAYNRV  211



>ref|XP_009371933.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   347 bits (890),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +   L+ ++L SF   +++LSVTVNDVEC+YEYVLYEGDT+SGNFVVVDHDIFW +DHPG
Sbjct  6    KGLMLIGLLLVSFFGKIASLSVTVNDVECLYEYVLYEGDTVSGNFVVVDHDIFWGADHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNE
Sbjct  66   LDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTV EY+
Sbjct  126  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVLYTVAEYL  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  186  ALAAASALQVVYIRKLFSKSVAYNRV  211



>ref|XP_008776017.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Phoenix dactylifera]
Length=218

 Score =   347 bits (889),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            LLL +L       +ALSVTV DVECVYEY+LYEGDT+SGNFVVVDHD+FW+SDHPGID  
Sbjct  16   LLLALLAGCFRRPAALSVTVTDVECVYEYILYEGDTVSGNFVVVDHDVFWSSDHPGIDLV  75

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSPG N+VHS++GTSGDKF+FK P +GMYKFCFHNP  TPETVSFYIHVGHIPNEHNLA
Sbjct  76   VTSPGGNIVHSLQGTSGDKFEFKVPGAGMYKFCFHNPQGTPETVSFYIHVGHIPNEHNLA  135

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH+DPINVKIAELREALESVT EQ+YLKAR+ARHRHTNESTR+R++FYTV EY+ L  
Sbjct  136  KDEHVDPINVKIAELREALESVTGEQRYLKAREARHRHTNESTRRRLVFYTVLEYLTLVC  195

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQVVYIRRLFSK+VAYNR+
Sbjct  196  ASVLQVVYIRRLFSKTVAYNRL  217



>ref|XP_010917620.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=217

 Score =   346 bits (888),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            LLL++L S   +  ALSVTV D ECVYEY+LY+GDT+SGNFVVVDHDIFW SDHPGID  
Sbjct  16   LLLVLLASCFRHPDALSVTVTDEECVYEYILYDGDTVSGNFVVVDHDIFWGSDHPGIDLV  75

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSPG N VH++KGTSGDKF+FKAPR+GMYKFCFHNP  TPETVSFYIHVGHIPNEHNLA
Sbjct  76   VTSPGGNTVHTLKGTSGDKFEFKAPRAGMYKFCFHNPQRTPETVSFYIHVGHIPNEHNLA  135

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHLDPINVKIAELREALESVT EQ+YLKAR++RHR TNESTR R+IFYTV EY+ L  
Sbjct  136  KDEHLDPINVKIAELREALESVTGEQRYLKARESRHRRTNESTRSRLIFYTVVEYLTLVC  195

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQVVYIRRLFSK+VAYNRV
Sbjct  196  ASVLQVVYIRRLFSKTVAYNRV  217



>ref|XP_008391009.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=211

 Score =   345 bits (884),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            SFV  +++LSVTV DVECVYEYVLYEGDT+SGNFVVVDHDIFW +DHPG+D  VTSPGDN
Sbjct  17   SFVGKIASLSVTVXDVECVYEYVLYEGDTVSGNFVVVDHDIFWGADHPGLDLIVTSPGDN  76

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
             VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNEHN+AKDEHLDP
Sbjct  77   TVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNEHNIAKDEHLDP  136

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            INVKIAELREALESVT EQKYLKARD RHRHTNESTR+RV+ YTV EY+ LA AS+LQVV
Sbjct  137  INVKIAELREALESVTLEQKYLKARDVRHRHTNESTRRRVVLYTVAEYLALAAASALQVV  196

Query  586  YIRRLFSKSVAYNRV  630
            YIR+LFSKSVAYNRV
Sbjct  197  YIRKLFSKSVAYNRV  211



>ref|XP_006838935.1| hypothetical protein AMTR_s00002p00270370 [Amborella trichopoda]
 gb|ERN01504.1| hypothetical protein AMTR_s00002p00270370 [Amborella trichopoda]
Length=222

 Score =   345 bits (884),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +1

Query  58   NLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHS  237
            ++SALSVTVNDVECVYEYV+YEGD++SGNFVVVDHDIFW+SDHPGIDFTVT+P  NVV++
Sbjct  32   HVSALSVTVNDVECVYEYVVYEGDSVSGNFVVVDHDIFWSSDHPGIDFTVTAPAGNVVYT  91

Query  238  MKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  417
            +KGTSGDKF FKAPRSGMYKFCFHN YSTPETVSFYIHVGHIPNEH+LAKDEHL+P+NVK
Sbjct  92   LKGTSGDKFGFKAPRSGMYKFCFHNSYSTPETVSFYIHVGHIPNEHDLAKDEHLNPVNVK  151

Query  418  IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRR  597
            IA+LREALESVT+EQ+YLKARDARHRHTNEST +R+IFYT+GEY  L  AS LQ+ YIRR
Sbjct  152  IAQLREALESVTAEQRYLKARDARHRHTNESTHRRLIFYTLGEYAALLAASGLQIYYIRR  211

Query  598  LFSKSVAYNRV  630
            LF+KSVAYNRV
Sbjct  212  LFNKSVAYNRV  222



>gb|EAY91831.1| hypothetical protein OsI_13477 [Oryza sativa Indica Group]
Length=210

 Score =   343 bits (881),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            A G R  A+LL+++        ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+S
Sbjct  2    AVGWRP-AMLLLVVAVAAWRGEALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSS  60

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVGH
Sbjct  61   DHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGH  120

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNESTR+RV+FYT+
Sbjct  121  IPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRRRVMFYTI  180

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  181  AEYLAFMGASALQVVYIRRLFSKNVAYNRV  210



>ref|NP_001136501.1| uncharacterized protein LOC100216616 precursor [Zea mays]
 gb|ACF82060.1| unknown [Zea mays]
 tpg|DAA51293.1| TPA: hypothetical protein ZEAMMB73_334057 [Zea mays]
Length=213

 Score =   342 bits (877),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 180/212 (85%), Gaps = 3/212 (1%)
 Frame = +1

Query  4    AGIRAYALLLMML---FSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFW  174
            A  R  ALL++ L    S      ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW
Sbjct  2    ARWRPAALLVVALTAVLSAARRADALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFW  61

Query  175  NSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHV  354
            +SDHPGID TVTSPG N VH++KG SGDKF+FKAP+ GMYKFCFHNPY  PETVSFYIHV
Sbjct  62   SSDHPGIDLTVTSPGGNTVHTLKGKSGDKFEFKAPKGGMYKFCFHNPYGAPETVSFYIHV  121

Query  355  GHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFY  534
            GHIPNEHNLAKDEHLDPINVKIAEL+E LESVT+EQKYLKAR+ARHRHTNESTRKRV+FY
Sbjct  122  GHIPNEHNLAKDEHLDPINVKIAELKEVLESVTAEQKYLKAREARHRHTNESTRKRVMFY  181

Query  535  TVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            T+ EYI    AS+LQV+YIRR+FSK+V YNRV
Sbjct  182  TMAEYIAFVAASTLQVLYIRRMFSKNVGYNRV  213



>ref|XP_004981806.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Setaria italica]
Length=215

 Score =   342 bits (876),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N VH++KG
Sbjct  28   ALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVHTLKG  87

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             SG+KF+FKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE
Sbjct  88   KSGEKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  147

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L+EALESVT+EQKYLKAR+ARHRHTNESTRKRV+FYT+ EY+    AS+LQVVYIRRLFS
Sbjct  148  LKEALESVTAEQKYLKAREARHRHTNESTRKRVMFYTMAEYLAFMAASALQVVYIRRLFS  207

Query  607  KSVAYNRV  630
            K+VAYNRV
Sbjct  208  KNVAYNRV  215



>ref|XP_002463892.1| hypothetical protein SORBIDRAFT_01g008390 [Sorghum bicolor]
 gb|EER90890.1| hypothetical protein SORBIDRAFT_01g008390 [Sorghum bicolor]
Length=213

 Score =   341 bits (874),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N VH++KG
Sbjct  26   ALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVHTLKG  85

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE
Sbjct  86   KSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  145

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L+EALESVT+EQKYLKAR+ARHRHTNESTRKRV+FYT+ EYI    AS+LQV+YIRRLFS
Sbjct  146  LKEALESVTAEQKYLKAREARHRHTNESTRKRVMFYTMAEYIAFMAASALQVLYIRRLFS  205

Query  607  KSVAYNRV  630
            K+V YNRV
Sbjct  206  KNVGYNRV  213



>ref|NP_001051240.1| Os03g0744800 [Oryza sativa Japonica Group]
 gb|AAP13000.1| putative cop-coated vesicle membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF98827.1| emp24/gp25L/p24 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13154.1| Os03g0744800 [Oryza sativa Japonica Group]
 dbj|BAG87251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   340 bits (872),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 183/210 (87%), Gaps = 1/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            A G R  A+L++++        ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+S
Sbjct  2    AVGWRP-AMLVVVVAVAAWRGEALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSS  60

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
            DHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVGH
Sbjct  61   DHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGH  120

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
            IPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNESTR+RV+FYT+
Sbjct  121  IPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRRRVMFYTI  180

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  181  AEYLAFMGASALQVVYIRRLFSKNVAYNRV  210



>gb|EPS65381.1| hypothetical protein M569_09395, partial [Genlisea aurea]
Length=203

 Score =   339 bits (870),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            AL  + +  ++ N+SALSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPGI+F
Sbjct  1    ALFWLFILRWIGNVSALSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGIEF  60

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             VTSP  N V S+KGTSG+KF+FKAPRSGMYKFCFHNPYSTPETVSF+IHVGHIP+E++L
Sbjct  61   IVTSPAGNNVQSLKGTSGEKFEFKAPRSGMYKFCFHNPYSTPETVSFHIHVGHIPSENDL  120

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEHLDPINVKIA LREALESV SEQKYLKARDARHR TNEST  RV+ Y++ EY+LLA
Sbjct  121  AKDEHLDPINVKIARLREALESVISEQKYLKARDARHRLTNESTASRVLGYSIFEYVLLA  180

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S+LQ VYIR LFSKS+AYNRV
Sbjct  181  GLSTLQAVYIRHLFSKSIAYNRV  203



>gb|AFP87418.1| putative EMP24-domain containing protein [Triticum turgidum subsp. 
durum]
Length=213

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = +1

Query  70   LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGT  249
            LSVTV D EC++E+V YEGD++SGNFVVVDHDIFW+SDHPGID TVTSPG N V++MKG 
Sbjct  27   LSVTVTDTECIHEFVPYEGDSVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGK  86

Query  250  SGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL  429
            SGDKFDFKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL
Sbjct  87   SGDKFDFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL  146

Query  430  REALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSK  609
            +EALESVT+EQKYLKARDARHRHTNESTR+RV+FYT+ EY     AS+LQVVYIRRLFSK
Sbjct  147  KEALESVTAEQKYLKARDARHRHTNESTRRRVMFYTMAEYAAFMAASALQVVYIRRLFSK  206

Query  610  SVAYNRV  630
            +V YNRV
Sbjct  207  NVGYNRV  213



>ref|XP_003559757.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brachypodium distachyon]
Length=213

 Score =   337 bits (865),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +1

Query  70   LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGT  249
            LSVTV D EC++E+V YEGD+++GNFVVVDHDIFW+SDHPGID TVTSPG N V+S+KG 
Sbjct  27   LSVTVTDTECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYSLKGK  86

Query  250  SGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL  429
            SGDKFDFKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEH+LAKDEHLDPINVKIAEL
Sbjct  87   SGDKFDFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHDLAKDEHLDPINVKIAEL  146

Query  430  REALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSK  609
            +EALESVTSEQKYLKAR+ARHRHTNESTR+RV+FYT+ EY+    AS+LQVVYIRRLFSK
Sbjct  147  KEALESVTSEQKYLKAREARHRHTNESTRRRVMFYTMAEYLAFMAASALQVVYIRRLFSK  206

Query  610  SVAYNRV  630
            +VAYNRV
Sbjct  207  NVAYNRV  213



>ref|NP_001141300.1| Suppressor/enhancer of lin-12 protein 9 precursor [Zea mays]
 gb|ACF86022.1| unknown [Zea mays]
 gb|ACG34453.1| suppressor/enhancer of lin-12 protein 9 precursor [Zea mays]
 gb|ACN34583.1| unknown [Zea mays]
 gb|AFW67650.1| Suppressor/enhancer of lin-12 protein 9 [Zea mays]
Length=213

 Score =   336 bits (862),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N V+++KG
Sbjct  26   ALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTLKG  85

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             SG+KF+FKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE
Sbjct  86   KSGEKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  145

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L+EALESVT+EQKYLKAR+ARHRHTNESTRKRV+FYT+ EY+    AS+LQV+YIRRLFS
Sbjct  146  LKEALESVTAEQKYLKAREARHRHTNESTRKRVMFYTMAEYLAFMAASALQVLYIRRLFS  205

Query  607  KSVAYNRV  630
            K+V YNRV
Sbjct  206  KNVGYNRV  213



>dbj|BAJ97536.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = +1

Query  70   LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGT  249
            LSVTV D EC++E+V YEGD+++GNFVVVDHDIFW+SDHPGID TVTSPG N V++MKG 
Sbjct  27   LSVTVTDTECIHEFVPYEGDSVTGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGK  86

Query  250  SGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL  429
            SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL
Sbjct  87   SGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL  146

Query  430  REALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSK  609
            +EALESVT+EQKYLKARDARHRHTNESTR+RV+FYT+ EY     AS+LQVVYIRRLFSK
Sbjct  147  KEALESVTAEQKYLKARDARHRHTNESTRRRVMFYTMAEYAAFMAASALQVVYIRRLFSK  206

Query  610  SVAYNRV  630
            +V YNRV
Sbjct  207  NVGYNRV  213



>gb|KJB12566.1| hypothetical protein B456_002G024500 [Gossypium raimondii]
Length=212

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            +FV N+S+LS+T+  V+CVYE V  EGD +SGNFVVVDH IFW+SDHPGIDF++TSPG +
Sbjct  18   NFVNNVSSLSLTITKVDCVYEIVRSEGDIVSGNFVVVDHHIFWSSDHPGIDFSITSPGGD  77

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
            ++H++KGTSGDKF FKAPRSG+Y+FCFHNP STPET++FYIH+GHIPNEHNLAK+EHLDP
Sbjct  78   ILHNLKGTSGDKFSFKAPRSGLYQFCFHNPLSTPETIAFYIHIGHIPNEHNLAKNEHLDP  137

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            INVKIAELREALE+VT+EQKYLKARDA HR TNEST+ RVI YTVG+YILL +AS LQ+V
Sbjct  138  INVKIAELREALEAVTTEQKYLKARDAVHRRTNESTKTRVIGYTVGQYILLTIASVLQIV  197

Query  586  YIRRLFSKSVAYNRV  630
            YIRRLFSKSV YNR+
Sbjct  198  YIRRLFSKSVGYNRI  212



>ref|XP_004493724.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cicer arietinum]
Length=211

 Score =   330 bits (846),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             + ++   + + +  ALS++++DVECV E+V YEGD ISGNFVV+DHDIFW+SDHPGIDF
Sbjct  9    TIAIIFFGTIICHAFALSISLHDVECVSEHVPYEGDIISGNFVVMDHDIFWSSDHPGIDF  68

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
            TVTSPG NV+ S+KGTSGDKF+FKA +SG++KFCFHNP+STPETVSFY+HVGHIPNEH+L
Sbjct  69   TVTSPGGNVIQSLKGTSGDKFEFKATQSGIHKFCFHNPFSTPETVSFYVHVGHIPNEHDL  128

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEHLDPINVKIAELREALES+ +EQKYLKARDARHRHTNESTRKRV+ YT+ EYIL  
Sbjct  129  AKDEHLDPINVKIAELREALESIITEQKYLKARDARHRHTNESTRKRVVVYTLLEYILFV  188

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQVVYIRRLFSKS AYNRV
Sbjct  189  TTSILQVVYIRRLFSKSFAYNRV  211



>ref|XP_003553473.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Glycine max]
 gb|KHN02550.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=211

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + Y +++  L   + +  ALS+++ D ECV E+VL++GDTISGNFVV+D+DIFW+SDHPG
Sbjct  6    KNYTIVISFLGFIICHGLALSISLYDQECVSEHVLHDGDTISGNFVVIDYDIFWSSDHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N+ +S+ GTSGDKF FKA ++G+YKFCFHNP STPETVSFYIHVGHIPNE
Sbjct  66   IDFTVTSPGGNLAYSLNGTSGDKFQFKASQNGIYKFCFHNPASTPETVSFYIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDPINVKIAELREALES+ SEQKYLKARDARHRHTNESTRKRV+FYT+ EY+
Sbjct  126  HDLAKDEHLDPINVKIAELREALESIISEQKYLKARDARHRHTNESTRKRVVFYTILEYV  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            L A  S LQVVYIRRLFSKS AYNRV
Sbjct  186  LFAATSLLQVVYIRRLFSKSFAYNRV  211



>ref|XP_002274733.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
isoform X1 [Vitis vinifera]
Length=210

 Score =   327 bits (838),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R++   L  + SF +   +LS+TV+++ECV E V +EGDT+SG FVV+DHDIFWNSDHPG
Sbjct  5    RSFFTALGFVLSFFSRGCSLSITVSNMECVSEAVHFEGDTVSGYFVVIDHDIFWNSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            I+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPETVSFYIHVGHIPNE
Sbjct  65   IEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPETVSFYIHVGHIPNE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            ++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNESTR+RV+FYT+ EYI
Sbjct  125  YDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNESTRRRVVFYTLAEYI  184

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S LQVVYIRRLFSKSVAYNRV
Sbjct  185  LLAATSGLQVVYIRRLFSKSVAYNRV  210



>gb|KEH23828.1| emp24/gp25L/p24 family/GOLD protein [Medicago truncatula]
Length=211

 Score =   327 bits (837),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +   ++L+ L + + ++ ALS++++DVECV EYV + GDTISGNFVV+DHDIFW+SDHPG
Sbjct  6    KICTIVLIFLGTTICHVIALSISLHDVECVSEYVEHGGDTISGNFVVMDHDIFWSSDHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG NVVHS+KGTSGDKF+ KA   G+YKFCFHNP STPETVSFY+HVGHIPN 
Sbjct  66   IDFTVTSPGGNVVHSLKGTSGDKFELKAIHGGIYKFCFHNPISTPETVSFYVHVGHIPNV  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            HNLAKDEH DPINVKIAELREALES+ +EQKYLKARD RHR+TNESTRKRVIFYT+ EYI
Sbjct  126  HNLAKDEHFDPINVKIAELREALESIITEQKYLKARDTRHRNTNESTRKRVIFYTLLEYI  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            L    S LQVVYIRRLFSKS AYNRV
Sbjct  186  LFVGTSLLQVVYIRRLFSKSFAYNRV  211



>gb|EYU23694.1| hypothetical protein MIMGU_mgv1a013689mg [Erythranthe guttata]
Length=213

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            AL  ++L S V+ +SALSVTV+DVEC+YEYV YEGDT+SGNFVV D+   WNSD PG+DF
Sbjct  13   ALSAVLLLSVVSRVSALSVTVSDVECLYEYVFYEGDTVSGNFVVEDYH--WNSDPPGVDF  70

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
            TVTSPG +VVH +KG+SGDKF+FKA + GMYKFCFHN +STPETVSF IH GHIP EH+L
Sbjct  71   TVTSPGGSVVHDLKGSSGDKFEFKATKLGMYKFCFHNTHSTPETVSFNIHTGHIPTEHDL  130

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEHLDP+NVKIAELREALESVT EQKYL+ARDARHRHTNESTR+RVI+YTV EY+LLA
Sbjct  131  AKDEHLDPVNVKIAELREALESVTLEQKYLRARDARHRHTNESTRRRVIYYTVAEYLLLA  190

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQV YIRRLFSKSVAY RV
Sbjct  191  AVSGLQVFYIRRLFSKSVAYGRV  213



>ref|XP_009370753.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=218

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = +1

Query  37   MLFSFVTN---LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
            +L SF+ N    +ALS+TV ++ECV E VLYEGDT+SGNFV +DHDIFW+SDHPGIDFT 
Sbjct  18   VLMSFIGNGNVATALSITVMELECVLEQVLYEGDTVSGNFVAIDHDIFWSSDHPGIDFTA  77

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
            T+PG   V S+KGTSGDKF FKAP+SG+YKFCF NP STPETVSFYIHVGHIPNEH LAK
Sbjct  78   TAPGGTTVFSLKGTSGDKFAFKAPKSGLYKFCFRNPVSTPETVSFYIHVGHIPNEHGLAK  137

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH+DP+N+KIAELREALE+VT+EQKYLKARDARHR+TN ST KRVI++T+ EY++ A A
Sbjct  138  DEHMDPLNIKIAELREALEAVTTEQKYLKARDARHRYTNVSTNKRVIYFTLAEYLVFAGA  197

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S+LQV+YIR LFSKSVAYNRV
Sbjct  198  SALQVLYIRNLFSKSVAYNRV  218



>ref|XP_011073468.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Sesamum indicum]
Length=216

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = +1

Query  55   TNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVH  234
            + +SALSVTV+DVECVYEYV Y+GDT+SGNFVV   D +W+SDH G+DFTVT+PG + VH
Sbjct  27   SRMSALSVTVSDVECVYEYVFYDGDTVSGNFVV--DDAYWSSDHSGVDFTVTAPGGSTVH  84

Query  235  SMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINV  414
            ++KGTS DKF+FKAP +GMYKFCFHNP STPETVSF IH GHIP EH+LAKDEHLDPINV
Sbjct  85   TLKGTSEDKFEFKAPTNGMYKFCFHNPSSTPETVSFNIHTGHIPREHDLAKDEHLDPINV  144

Query  415  KIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIR  594
            KIAELREALE+VT EQ+YLKARDARHRHTNESTR+RVIFYTVGEY+LL L S LQVV+IR
Sbjct  145  KIAELREALETVTLEQRYLKARDARHRHTNESTRRRVIFYTVGEYLLLGLVSGLQVVFIR  204

Query  595  RLFSKSVAYNRV  630
            RLFSKSVAYNRV
Sbjct  205  RLFSKSVAYNRV  216



>ref|XP_002315749.2| emp24/gp25L/p24 family protein [Populus trichocarpa]
 gb|EEF01920.2| emp24/gp25L/p24 family protein [Populus trichocarpa]
Length=194

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 5/187 (3%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++  +L SF++ + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPGIDFT
Sbjct  10   VVAALLMSFISRIYSLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGIDFT  69

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
             TSPGDN VH++KGTSGDKF+FKAPRSGMYKFCFHNPY+TPETVSFYIHVGHIP+EH+LA
Sbjct  70   ATSPGDNTVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYATPETVSFYIHVGHIPSEHDLA  129

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHL+P+NVKIAELREALESVT+EQ+YLKARD RHRHTNESTR+RVI YTVG Y     
Sbjct  130  KDEHLNPVNVKIAELREALESVTAEQRYLKARDIRHRHTNESTRRRVIAYTVGVY-----  184

Query  565  ASSLQVV  585
             SSLQ V
Sbjct  185  PSSLQQV  191



>ref|XP_008235354.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Prunus mume]
Length=218

 Score =   322 bits (825),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
             LM L       +ALS+TV D+ECV E VLYEGDT+SGNFV +DHDIFW+SDHPGIDFT 
Sbjct  18   FLMSLIGNGNFATALSITVTDLECVSEQVLYEGDTVSGNFVAIDHDIFWSSDHPGIDFTA  77

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
             +P   +V S+KGTSGDKF+FKAP+SG+YKFCF NP STPETVSFYIHVGHIPNEH+LA+
Sbjct  78   MTPRGTIVFSLKGTSGDKFEFKAPQSGIYKFCFRNPVSTPETVSFYIHVGHIPNEHDLAR  137

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN ST+KRVI++T+ EYI+ A A
Sbjct  138  DEHIDPLNIKIAELREALESITTEQKYLKARDARHRYTNVSTKKRVIYFTLAEYIVFAAA  197

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S+LQVVYIR LFSK+V YNRV
Sbjct  198  SALQVVYIRNLFSKTVGYNRV  218



>ref|XP_008351862.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=218

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            AY  LL ++ +  +  +ALS+TV + ECV E VL+EGDT+SGNFV +DHDIFW+SDHPGI
Sbjct  15   AYGFLLSLIGN-GSVATALSITVTEFECVSEQVLHEGDTVSGNFVAIDHDIFWSSDHPGI  73

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            DFT T+PG ++V S+KGTSGDKF FKAP+SG+YKFCF NP STPETVSFYIHVGHIPNEH
Sbjct  74   DFTATAPGGSIVSSLKGTSGDKFKFKAPKSGIYKFCFRNPASTPETVSFYIHVGHIPNEH  133

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
             LAKDEH+DP+N+KIAELREALE++T+EQK+LKARDARHR+TN ST KRVI++T+ EY++
Sbjct  134  ELAKDEHMDPLNIKIAELREALEAITTEQKFLKARDARHRYTNVSTNKRVIYFTLAEYLV  193

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
             A AS+LQV+YIR LFSKSVAYNRV
Sbjct  194  FAGASALQVLYIRNLFSKSVAYNRV  218



>ref|XP_010490045.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Camelina sativa]
Length=196

 Score =   319 bits (818),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            A I  + L+ ++L + +  +S+LSVTVND ECV EYVLYEGDT+SGNFVVVDHDIFW SD
Sbjct  6    AKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSD  65

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
            HPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI
Sbjct  66   HPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  125

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
            PNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNESTRKRVIFYTVG
Sbjct  126  PNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVG  185



>ref|XP_007162469.1| hypothetical protein PHAVU_001G155000g [Phaseolus vulgaris]
 gb|ESW34463.1| hypothetical protein PHAVU_001G155000g [Phaseolus vulgaris]
Length=211

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + Y +++  L   + +  ALS+++ DVECV E+VL++GDT+SGNFVV+D+DIFWNSDHPG
Sbjct  6    KIYTVVISFLGFIICHGCALSISLYDVECVSEHVLHDGDTVSGNFVVIDYDIFWNSDHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDF+VTSPG ++V+S+KGTSGDKF FKA   G+YKFCF NP STPETVSFYIHVGHIPNE
Sbjct  66   IDFSVTSPGGSLVYSLKGTSGDKFQFKAALHGIYKFCFQNPASTPETVSFYIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            H+LAKDEHLDP+NVKIAELREALES+  EQKYLKARD RHRHTNESTRKRV+ YT+ EY+
Sbjct  126  HDLAKDEHLDPVNVKIAELREALESIIIEQKYLKARDTRHRHTNESTRKRVVLYTILEYV  185

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            L A  S  QVVYIRRLFSKS AYNRV
Sbjct  186  LFAATSISQVVYIRRLFSKSFAYNRV  211



>emb|CAN65862.1| hypothetical protein VITISV_007728 [Vitis vinifera]
Length=195

 Score =   318 bits (814),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            +LS+TV+++ECV E V +EGDT+SG FVV+DHDIFWNSDHPGI+FTVTSP   +VH++KG
Sbjct  8    SLSITVSNMECVSEAVHFEGDTVSGYFVVIDHDIFWNSDHPGIEFTVTSPEGAIVHALKG  67

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
            TSG+KF+FKAP+SG YKFCF+NP +TPETVSFYIHVGHIPNE++LAKDEHLDP+NV+I E
Sbjct  68   TSGEKFEFKAPQSGTYKFCFNNPVATPETVSFYIHVGHIPNEYDLAKDEHLDPVNVRITE  127

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            LREAL SV +EQKYLKARDARHR TNESTR+RV+FYT+ EYILLA  S LQVVYIRRLFS
Sbjct  128  LREALLSVAAEQKYLKARDARHRATNESTRRRVVFYTLAEYILLAATSGLQVVYIRRLFS  187

Query  607  KSVAYNRV  630
            KSVAYNRV
Sbjct  188  KSVAYNRV  195



>gb|ABK22222.1| unknown [Picea sitchensis]
Length=208

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
            + LS TVN+ ECVYE V YEGD +SGNFVVVDHDIFW SDHPGID TVT+P  NVV+S+K
Sbjct  20   AGLSFTVNEQECVYENVEYEGDNVSGNFVVVDHDIFWASDHPGIDLTVTAPAGNVVYSLK  79

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
            GTSGDKF F APRSGMYKFCFHN +S PET+SFY+HVGHIPNEH+LAKDEHL+P+NV+IA
Sbjct  80   GTSGDKFQFVAPRSGMYKFCFHNSFSAPETISFYVHVGHIPNEHDLAKDEHLNPVNVRIA  139

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            ELREA+ESVT+EQ+YLKARDARHR TNESTR+R+I YT+ EY+ L +AS LQV +IRRLF
Sbjct  140  ELREAMESVTAEQQYLKARDARHRRTNESTRRRLIGYTLAEYLALIVASGLQVYFIRRLF  199

Query  604  SKSVAYNRV  630
            S+SVAYNRV
Sbjct  200  SRSVAYNRV  208



>ref|XP_009350369.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=218

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 178/208 (86%), Gaps = 7/208 (3%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLS---ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            AY  LL    S + N S   ALS+TV + ECV E VL+EGDT+SGNFV +DHDIFW+SDH
Sbjct  15   AYGFLL----SLIDNGSVATALSITVTEFECVSEQVLHEGDTVSGNFVAIDHDIFWSSDH  70

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
            PGIDFT T+PG ++V S+KGTSGDKF FKA +SG+YKFCF NP STPETVSFYIHVGHIP
Sbjct  71   PGIDFTATAPGGSIVSSLKGTSGDKFKFKAQKSGIYKFCFRNPASTPETVSFYIHVGHIP  130

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
            NEH+LAKDEH+DP+N+KIAELREALE++T+EQK+LKARDARHR+TN ST KRVI++T+ E
Sbjct  131  NEHDLAKDEHMDPLNIKIAELREALEAITTEQKFLKARDARHRYTNVSTNKRVIYFTLAE  190

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
            Y++ A AS+LQV+YIR LFSKSVAYNRV
Sbjct  191  YLVFAGASALQVLYIRNLFSKSVAYNRV  218



>ref|XP_004292584.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Fragaria vesca subsp. vesca]
Length=217

 Score =   317 bits (812),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVT-NLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            R Y +   ML+     N++ALS+TV ++ECV E VLYEGDTISGNFV +DHDIFW+ DHP
Sbjct  11   RFYVVCSCMLWLIGNRNVAALSITVTELECVSEQVLYEGDTISGNFVAIDHDIFWSHDHP  70

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            GI+FTVTSPG + V S+KGTSGDKF+ KAP+ G+YKFCF NP S+PETVSFYIHVGHIPN
Sbjct  71   GIEFTVTSPGGSTVFSLKGTSGDKFELKAPQKGIYKFCFRNPSSSPETVSFYIHVGHIPN  130

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            E +LA+DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN  T+KRVI++T+ EY
Sbjct  131  ELDLAQDEHMDPLNIKIAELREALESITAEQKYLKARDARHRYTNVGTKKRVIYFTLAEY  190

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            +L A+AS+LQVVYIR LFSK+V YNRV
Sbjct  191  LLFAVASALQVVYIRNLFSKTVGYNRV  217



>ref|XP_007200451.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica]
 gb|EMJ01650.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica]
Length=217

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
             LM L       +ALS+TV D+ECV E VLYEGDT+SGNFV +DHDIFW+SDHPGIDFTV
Sbjct  18   FLMSLIGNGNFATALSITVTDLECVSEQVLYEGDTVSGNFVAIDHDIFWSSDHPGIDFTV  77

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
            +  G  +V S+KGTSGDKF+FKAP+SG+YKFCF NP STPETVSFYIHVGHIPNEH+LA+
Sbjct  78   SFLGI-IVFSLKGTSGDKFEFKAPQSGIYKFCFRNPVSTPETVSFYIHVGHIPNEHDLAR  136

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN ST+KRVI++T+ EYI+ A A
Sbjct  137  DEHMDPLNIKIAELREALESITTEQKYLKARDARHRYTNVSTKKRVIYFTLAEYIVFAAA  196

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S+LQVVYIR LFSK+V YNRV
Sbjct  197  SALQVVYIRNLFSKTVGYNRV  217



>ref|XP_006443971.1| hypothetical protein CICLE_v10024247mg [Citrus clementina]
 ref|XP_006479641.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Citrus sinensis]
 gb|ESR57211.1| hypothetical protein CICLE_v10024247mg [Citrus clementina]
 gb|KDO68622.1| hypothetical protein CISIN_1g028178mg [Citrus sinensis]
Length=212

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGN-FVVVDHDIFWNSDHPGID  198
             L++  + SF+ ++S LS+TV D ECVYE+V+Y+ DTI+GN FV  DH++FWNSDHPGID
Sbjct  9    CLVIGFILSFIRHVSTLSITVTDTECVYEHVIYKEDTITGNVFVTTDHELFWNSDHPGID  68

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
            FTVT P  ++V ++KGTSGDKF FKAPRSGMY+FCFHNP STPE VSFYIH+GHIPNEH+
Sbjct  69   FTVTCPDGSIVRALKGTSGDKFVFKAPRSGMYQFCFHNPTSTPEEVSFYIHIGHIPNEHD  128

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
            LAKDEHLDPI V+IAELREALE+V++EQ+YLKA ++RHR TNESTRKRV+FYTV EY+LL
Sbjct  129  LAKDEHLDPIYVRIAELREALETVSAEQRYLKALESRHRSTNESTRKRVVFYTVSEYLLL  188

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
            A A +LQV+YIRRLF K+ AY RV
Sbjct  189  AGAGALQVMYIRRLFGKTAAYGRV  212



>emb|CBI25047.3| unnamed protein product [Vitis vinifera]
Length=180

 Score =   311 bits (798),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   VECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDF  270
            +ECV E V +EGDT+SG FVV+DHDIFWNSDHPGI+FTVTSPG  +VH++KGTSG+KF+F
Sbjct  1    MECVSEAVHFEGDTVSGYFVVIDHDIFWNSDHPGIEFTVTSPGGAIVHALKGTSGEKFEF  60

Query  271  KAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESV  450
            KAP+SG YKFCF+NP +TPETVSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV
Sbjct  61   KAPQSGTYKFCFNNPVATPETVSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSV  120

Query  451  TSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             +EQKYLKARDARHR TNESTR+RV+FYT+ EYILLA  S LQVVYIRRLFSKSVAYNRV
Sbjct  121  AAEQKYLKARDARHRATNESTRRRVVFYTLAEYILLAATSGLQVVYIRRLFSKSVAYNRV  180



>ref|XP_007034876.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05802.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2 [Theobroma 
cacao]
Length=171

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL++++L ++V+N+S+LSVTVN+VECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  7    KMWALMVLLLLNWVSNVSSLSVTVNEVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP E
Sbjct  67   IDFTVTSPGGNTVQNLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPTE  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNE  507
            H+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHR++N+
Sbjct  127  HDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRNSNK  171



>ref|XP_010935726.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=214

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 170/201 (85%), Gaps = 2/201 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
            +L +L S    LSALS+TVNDVECV E+VL +GDTISGNFVVVD     +SDHPGID  V
Sbjct  16   ILGLLLSCPRRLSALSITVNDVECVSEFVLSDGDTISGNFVVVDRS--RSSDHPGIDMVV  73

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
             +   + VHS+KGTSGDKF+FKAPR+GMYKFCFHNP  TPETVSFYIHVGHIPNEH+LAK
Sbjct  74   QTSRGDTVHSLKGTSGDKFEFKAPRAGMYKFCFHNPSRTPETVSFYIHVGHIPNEHDLAK  133

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEHLDP+ V++A+LREALESVTSEQ+YLKAR+ARHR T+E TRKR+IF T+ EY++L  A
Sbjct  134  DEHLDPVKVRVAQLREALESVTSEQRYLKAREARHRWTSEGTRKRLIFCTMMEYLVLVCA  193

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S LQVVYIRRLF+KSVAYN +
Sbjct  194  SGLQVVYIRRLFNKSVAYNTI  214



>gb|KJB72278.1| hypothetical protein B456_011G168300 [Gossypium raimondii]
Length=180

 Score =   298 bits (762),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL+ + LF++  N+S+LSVTV+D+ECVYEYVLYEGDTISGNFVVVDHDIFW+SDHPG
Sbjct  7    KKWALICLFLFNWARNVSSLSVTVSDMECVYEYVLYEGDTISGNFVVVDHDIFWSSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N VHS+KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET++FYIHVGHIP +
Sbjct  67   IDFTVTSPGGNTVHSLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETIAFYIHVGHIPTD  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTN  504
            H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHRH+ 
Sbjct  127  HDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRHSK  170



>gb|KHG16537.1| Transmembrane emp24 domain-containing 2 [Gossypium arboreum]
Length=180

 Score =   296 bits (758),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + +AL+ + LF++  N+S+LSVTV+D+ECVYEYVLYEGDTISGNFVVVDHDIFW+SDHPG
Sbjct  7    KKWALICLFLFNWARNVSSLSVTVSDIECVYEYVLYEGDTISGNFVVVDHDIFWSSDHPG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVTSPG N VHS+KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET++FYIHVGHIP +
Sbjct  67   IDFTVTSPGGNTVHSLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETIAFYIHVGHIPTD  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTN  504
            H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHR + 
Sbjct  127  HDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRQSK  170



>ref|XP_010646131.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
isoform X2 [Vitis vinifera]
Length=195

 Score =   295 bits (756),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R++   L  + SF +   +LS+TV+++ECV E V +EGDT+SG FVV+DHDIFWNSDHPG
Sbjct  5    RSFFTALGFVLSFFSRGCSLSITVSNMECVSEAVHFEGDTVSGYFVVIDHDIFWNSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            I+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPETVSFYIHVGHIPNE
Sbjct  65   IEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPETVSFYIHVGHIPNE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            ++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNESTR+RV+FYT+ EYI
Sbjct  125  YDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNESTRRRVVFYTLAEYI  184

Query  553  LLALASSLQV  582
            LLA  S LQV
Sbjct  185  LLAATSGLQV  194



>ref|XP_007050472.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
 gb|EOX94629.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
Length=217

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            +L  ++   V ++ +LS+TV + ECV E V+ EGDTISGNFVV+DH+IFWNS+HPGI+FT
Sbjct  16   VLGCLVSCCVHHVFSLSITVAEFECVSELVVSEGDTISGNFVVMDHEIFWNSEHPGIEFT  75

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            VTSPG  +V+ +KGTSGDKF+FKAPR G+YKFCFHNP +TPETV+FY+HVGHIP  +++A
Sbjct  76   VTSPGGKLVYFLKGTSGDKFEFKAPRRGIYKFCFHNPLTTPETVAFYLHVGHIPETNDVA  135

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
             +EH  P +VKIAELRE LESVT+EQKYLKARDARHR+T+ESTRKRV+FYT+ EY  LA 
Sbjct  136  INEHFHPTHVKIAELREVLESVTAEQKYLKARDARHRYTSESTRKRVVFYTLVEYFALAA  195

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            +S LQ+VYIRRLFS S AYNRV
Sbjct  196  SSVLQIVYIRRLFSSSPAYNRV  217



>ref|XP_008343630.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
 ref|XP_008362011.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=199

 Score =   289 bits (739),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            +   L+ ++L SFV  +++LSVTVNDVEC+YEYVLYEGDT+SGNFVVVDHDIFW +DHPG
Sbjct  6    KGLMLIGLLLVSFVRKIASLSVTVNDVECLYEYVLYEGDTVSGNFVVVDHDIFWGADHPG  65

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNE
Sbjct  66   LDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNE  125

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTN  504
            HN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRH+ 
Sbjct  126  HNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHSK  169



>emb|CAN73344.1| hypothetical protein VITISV_007239 [Vitis vinifera]
Length=203

 Score =   288 bits (738),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R++   L  + SF +   +LS+TV+++ECV E V +EGDT+SG FVV+DHDIFWNSDHPG
Sbjct  5    RSFFTALGFVLSFFSRGCSLSITVSNMECVSEAVHFEGDTVSGYFVVIDHDIFWNSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            I+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPETVSFYIHVGHIPNE
Sbjct  65   IEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPETVSFYIHVGHIPNE  124

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
            ++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNESTR+RV+FYT+ EYI
Sbjct  125  YDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNESTRRRVVFYTLAEYI  184

Query  553  LLA  561
            LLA
Sbjct  185  LLA  187



>ref|XP_008390949.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Malus domestica]
Length=200

 Score =   285 bits (729),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            SFV  +++LSVTV DVECVYEYVLYEGDT+SGNFVVVDHDIFW +DHPG+D  VTSPGDN
Sbjct  17   SFVGKIASLSVTVXDVECVYEYVLYEGDTVSGNFVVVDHDIFWGADHPGLDLIVTSPGDN  76

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
             VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPETVSF IHVGHIPNEHN+AKDEHLDP
Sbjct  77   TVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFNIHVGHIPNEHNIAKDEHLDP  136

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNES  510
            INVKIAELREALESVT EQKYLKARD RHRH+  S
Sbjct  137  INVKIAELREALESVTLEQKYLKARDVRHRHSKFS  171



>ref|XP_008786160.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Phoenix dactylifera]
Length=184

 Score =   280 bits (715),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            LSALSVTVNDVECVYEYVLYEGDT+SGNFVVVDHD+FW+SDHPGID  VTSPG N VHS+
Sbjct  27   LSALSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDLFWSSDHPGIDLVVTSPGGNTVHSL  86

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKI  420
            KGTSGDKF+F+APR+GMYKFCFHNP  TPETVSFYIHVGHIPNEH+LAKDEHLDPINVKI
Sbjct  87   KGTSGDKFEFQAPRAGMYKFCFHNPNRTPETVSFYIHVGHIPNEHDLAKDEHLDPINVKI  146

Query  421  AELREALESVTSEQKYLKARDARHRHTNESTRKRVIFY  534
            A+LREALESVTSEQ+YLKAR+ RHRH       R + Y
Sbjct  147  AQLREALESVTSEQRYLKAREVRHRHKYRLAGVRPLHY  184



>ref|XP_006651809.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Oryza brachyantha]
Length=217

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +1

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            SDHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVG
Sbjct  67   SDHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVG  126

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            HIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNESTR+RV+FYT
Sbjct  127  HIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRRRVMFYT  186

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            + EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  187  IAEYLAFMGASALQVVYIRRLFSKNVAYNRV  217



>gb|EEE59914.1| hypothetical protein OsJ_12539 [Oryza sativa Japonica Group]
Length=221

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 161/221 (73%), Gaps = 12/221 (5%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDT-ISGNFVVVDHDIFWN  177
            A G R  A+L++++        ALSVTV D EC++E+V   G T   G            
Sbjct  2    AVGWRP-AMLVVVVAVAAWRGEALSVTVTDTECIHEFVPLRGGTPCRGTSSSSTTTSSGA  60

Query  178  SDHPG----------IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTP  327
               P           + F VTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  P
Sbjct  61   PTTPASTSRCPPPILLVFVVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAP  120

Query  328  ETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNE  507
            ETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNE
Sbjct  121  ETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNE  180

Query  508  STRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            STR+RV+FYT+ EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  181  STRRRVMFYTIAEYLAFMGASALQVVYIRRLFSKNVAYNRV  221



>gb|KHN15723.1| Endoplasmic reticulum vesicle protein 25 [Glycine soja]
Length=164

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 144/206 (70%), Gaps = 46/206 (22%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + + + +  SF   + +LSVTVNDVECVYEYVLYEGDT+SGNFVVVDHDIFW+SDHPG
Sbjct  5    KMWMVFMCLTVSFFARIESLSVTVNDVECVYEYVLYEGDTVSGNFVVVDHDIFWSSDHPG  64

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            IDFTVT+   N VHS+KGTS                                        
Sbjct  65   IDFTVTTAAGNTVHSIKGTS----------------------------------------  84

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
                  EHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNESTRKRV+FYTVGEY+
Sbjct  85   ------EHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNESTRKRVVFYTVGEYL  138

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
            LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  139  LLAAVSALQVIYIRRLFSKSVAYNRV  164



>ref|XP_002987714.1| hypothetical protein SELMODRAFT_126578 [Selaginella moellendorffii]
 gb|EFJ11289.1| hypothetical protein SELMODRAFT_126578 [Selaginella moellendorffii]
Length=211

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALS+TV   ECV E+V Y  D ++GNFVVVDH+IFW SDHPGIDF  TSP   +V S++G
Sbjct  24   ALSMTVYRTECVQEHVEYANDIVTGNFVVVDHEIFWASDHPGIDFVATSPAGVIVSSIRG  83

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
            ++GDKF F A   G+YKFCFHN   +PETV FYIHVGHI NEHNLAKDEHL+P++VKI++
Sbjct  84   SAGDKFSFTAAMPGLYKFCFHNTAPSPETVDFYIHVGHILNEHNLAKDEHLNPVHVKISQ  143

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L+EALES+ ++Q YL++R  RH +TN ST+KR++FYT+GEY+ LA AS  QV+ ++ LF+
Sbjct  144  LKEALESLMADQHYLRSRVERHHNTNRSTQKRLLFYTIGEYLALAAASVTQVLVLKHLFN  203

Query  607  KSVAYNRV  630
            + + Y ++
Sbjct  204  RKIGYTKL  211



>ref|XP_002983175.1| hypothetical protein SELMODRAFT_268686 [Selaginella moellendorffii]
 gb|EFJ15517.1| hypothetical protein SELMODRAFT_268686 [Selaginella moellendorffii]
Length=209

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALS+TV   ECV E+V Y  D ++GNFVVVDH+IFW SDHPGIDF  TSP   +V S++G
Sbjct  22   ALSMTVYRTECVQEHVEYANDIVTGNFVVVDHEIFWASDHPGIDFVATSPAGVIVSSIRG  81

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
            ++GDKF F A   G+YKFCFHN   +PETV FYIHVGHI NEHNLAKDEHL+P++VKI++
Sbjct  82   SAGDKFSFTAAMPGLYKFCFHNTAPSPETVDFYIHVGHILNEHNLAKDEHLNPVHVKISQ  141

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L+EALES+ ++Q YL++R  RH +TN ST+KR++FYT+GEY+ LA AS  QV+ ++ LF+
Sbjct  142  LKEALESLMADQHYLRSRVERHHNTNRSTQKRLLFYTIGEYLALAAASVTQVLVLKHLFN  201

Query  607  KSVAYNRV  630
            + + Y ++
Sbjct  202  RKIGYTKL  209



>gb|EMS56815.1| Transmembrane emp24 domain-containing protein A [Triticum urartu]
Length=131

 Score =   245 bits (625),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  238  MKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  417
            MKG SGDKFDFKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVK
Sbjct  1    MKGKSGDKFDFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  60

Query  418  IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRR  597
            IAEL+EALESVT+EQKYLKARDARHRHTNESTR+RV+FYT+ EY     AS+LQVVYIRR
Sbjct  61   IAELKEALESVTAEQKYLKARDARHRHTNESTRRRVMFYTMAEYAAFMAASALQVVYIRR  120

Query  598  LFSKSVAYNRV  630
            LFSK+V YNRV
Sbjct  121  LFSKNVGYNRV  131



>ref|XP_001752961.1| predicted protein [Physcomitrella patens]
 gb|EDQ82002.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 149/207 (72%), Gaps = 0/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            +R +  +L  L   V +  AL +TV++ ECV+E V ++GD +SGNFVV+D ++FW S+HP
Sbjct  3    LRPWITVLFALAVVVAHSHALLMTVHNTECVWEDVEFDGDVVSGNFVVLDQEVFWGSEHP  62

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            GI+  VT P    VH+     G+KF+F A R G YKFCFHNP S PE ++FYIHVGH+  
Sbjct  63   GIELIVTGPDGRAVHTTNTIDGEKFEFIAHRRGRYKFCFHNPLSAPEQLTFYIHVGHVIG  122

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
               LA+DEHL P++VKI++L EALE V++E +YL+ RD RHR TNEST++R++FYTV EY
Sbjct  123  VEELARDEHLKPVDVKISQLSEALELVSAEIRYLQNRDLRHRKTNESTQRRLLFYTVSEY  182

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            +LL  AS  QVV IR LFSK + YNRV
Sbjct  183  LLLIAASVGQVVMIRHLFSKRIGYNRV  209



>ref|XP_001771034.1| predicted protein [Physcomitrella patens]
 gb|EDQ64189.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 133/184 (72%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   TVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGD  258
            T+   ECVYE V YEGDT+SG+FVV+DH + W +D PG++  VTSP    V  +    G+
Sbjct  3    TITHQECVYEEVDYEGDTVSGSFVVIDHGLAW-ADEPGVELVVTSPIGAKVIGITAKEGE  61

Query  259  KFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREA  438
            KF+F A + GMYKFCF+NP  TPET+SFYIHVGHI    +LAKDEHL P+NV IA +REA
Sbjct  62   KFEFVAHQRGMYKFCFNNPGPTPETISFYIHVGHIYGLMDLAKDEHLKPLNVNIARVREA  121

Query  439  LESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVA  618
            L +V+ E  YLKARD RHR TNEST++R+I YTVGEYI L   S  QV  IR+LF K + 
Sbjct  122  LAAVSGELIYLKARDRRHRITNESTQRRLISYTVGEYICLIGVSLGQVYLIRKLFDKRLG  181

Query  619  YNRV  630
            YNRV
Sbjct  182  YNRV  185



>ref|XP_010535328.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like, 
partial [Tarenaya hassleriana]
Length=128

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  61   LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSM  240
            +S+LSVTVN+VECVYEYVLYEGDT+SGNFVVVDHDIFW SDHPG+DF V+SP  NVVHS+
Sbjct  25   ISSLSVTVNNVECVYEYVLYEGDTVSGNFVVVDHDIFWGSDHPGLDFEVSSPAGNVVHSL  84

Query  241  KGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            KGTSGDKF+FKAP+SGMYKFCFHNPYSTPETVSFYIHVGHIPNE
Sbjct  85   KGTSGDKFEFKAPKSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  128



>gb|KHG09153.1| Transmembrane emp24 domain-containing 7 [Gossypium arboreum]
 gb|KHG24118.1| Transmembrane emp24 domain-containing 7 [Gossypium arboreum]
Length=146

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  46   SFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDN  225
            +FV N+S+LS+T+  VECVYE V  EGD +SGNFVVVDH IFW+SDHPGIDF++TSPG +
Sbjct  18   NFVNNVSSLSLTITKVECVYEIVRSEGDIVSGNFVVVDHHIFWSSDHPGIDFSITSPGGD  77

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHL  399
            ++H++KGTSGDKF FKAPRSG+Y+FCFHNP STPET++ YIH+GHIPNEHNLAK+  L
Sbjct  78   ILHNLKGTSGDKFSFKAPRSGLYQFCFHNPLSTPETIALYIHIGHIPNEHNLAKNGSL  135



>ref|XP_008368791.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=139

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +1

Query  16   AYALLLMMLFSFVTN---LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            AY  L+    SF+ N    +ALS+TV ++ECV E VLYEGDT+SGNFV +DHDIFW+SDH
Sbjct  15   AYGFLM----SFIGNGNVATALSITVTELECVSEQVLYEGDTVSGNFVAIDHDIFWSSDH  70

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
            PGIDFT T+PG  +V S+KGTSGDKF FKAP+SGMYKFCF NP ST ETVSFYIHVGHIP
Sbjct  71   PGIDFTATAPGGXIVFSLKGTSGDKFAFKAPKSGMYKFCFRNPVSTHETVSFYIHVGHIP  130

Query  367  NEHNLAKD  390
            N H+LAKD
Sbjct  131  NXHDLAKD  138



>ref|XP_008363663.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=139

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +1

Query  16   AYALLLMMLFSFVTN---LSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            AY  L+    SF+ N    +ALS+TV ++ECV E VL+EGDT+SGNFVV+DHDIFW+SDH
Sbjct  15   AYGFLM----SFIGNGNVATALSITVTELECVSEQVLHEGDTVSGNFVVIDHDIFWSSDH  70

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
            PGIDFT T+PG  +V S+KGTSGDKF FKAP+SGMYKFCF NP ST ETVSFYIHVGHIP
Sbjct  71   PGIDFTATAPGGGIVFSLKGTSGDKFAFKAPKSGMYKFCFRNPVSTHETVSFYIHVGHIP  130

Query  367  NEHNLAKD  390
            N H+LAKD
Sbjct  131  NXHDLAKD  138



>ref|XP_010527604.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3, 
partial [Tarenaya hassleriana]
Length=103

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  322  TPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHT  501
            TPETVSFYIHVGHIPNEH++AKDEHLDPINVKIAELREALESV SEQKYLKARDARHRHT
Sbjct  1    TPETVSFYIHVGHIPNEHDVAKDEHLDPINVKIAELREALESVISEQKYLKARDARHRHT  60

Query  502  NESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            NESTRKRVIFYTVGEY+LLA AS+LQV+YIR+LFSKSVAYNRV
Sbjct  61   NESTRKRVIFYTVGEYLLLAAASALQVLYIRKLFSKSVAYNRV  103



>ref|XP_002990957.1| hypothetical protein SELMODRAFT_132599 [Selaginella moellendorffii]
 gb|EFJ08001.1| hypothetical protein SELMODRAFT_132599 [Selaginella moellendorffii]
Length=209

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 108/192 (56%), Gaps = 0/192 (0%)
 Frame = +1

Query  55   TNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVH  234
            T+  AL   ++  EC    V Y+GD +  ++VVV  D  W  +  G+D  V  PG    +
Sbjct  18   TSAQALRFVIDRKECFAHPVEYDGDLVHVSYVVVKSDSTWAFEQAGVDLVVEGPGGIQAY  77

Query  235  SMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINV  414
             ++    +K  F A   G+YKFCFHN     ET++F ++VGH P   + AKD+H+DP+  
Sbjct  78   DVRNKPEEKGQFVAHSKGLYKFCFHNLSPVHETIAFDVYVGHFPPPDDHAKDDHIDPLMG  137

Query  415  KIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIR  594
            +IA L EAL SV+ EQ +L+A+  R    N +  KRV++  V E   L  AS LQV  +R
Sbjct  138  QIARLEEALYSVSFEQHWLQAQTERQSVLNNAMSKRVVYKAVVESAALISASLLQVYLLR  197

Query  595  RLFSKSVAYNRV  630
            RLF K  A +RV
Sbjct  198  RLFEKRFASSRV  209



>ref|XP_002982857.1| hypothetical protein SELMODRAFT_116990 [Selaginella moellendorffii]
 gb|EFJ16102.1| hypothetical protein SELMODRAFT_116990 [Selaginella moellendorffii]
Length=209

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 106/189 (56%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
             AL   ++  EC    V Y+GD +  ++VVV  D  W  +  G+D  V  PG    + ++
Sbjct  21   QALRFVIDRKECFAHPVEYDGDLVHVSYVVVKSDSTWGFEQAGVDLVVEGPGGIQAYDVR  80

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
                +K  F A   G+YKFCFHN     ET++F ++VGH P   + AKD+H+DP+  +IA
Sbjct  81   NKPEEKSQFVAHSKGLYKFCFHNLSPVHETIAFDVYVGHFPPPDDHAKDDHIDPLMGQIA  140

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
             L EAL SV+ EQ +L+A+  R    N +  KRV++  V E   L  AS LQV  +RRLF
Sbjct  141  RLEEALYSVSFEQHWLQAQTERQSVLNNAMSKRVVYKAVVESAALISASLLQVYLLRRLF  200

Query  604  SKSVAYNRV  630
             K  A +RV
Sbjct  201  EKRFASSRV  209



>ref|XP_004957295.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Setaria italica]
 ref|XP_004957296.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Setaria italica]
Length=216

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 114/202 (56%), Gaps = 0/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            L+L+ L +F+ + +A+   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  
Sbjct  15   LVLLWLVAFLRDAAAIRFVIDREECFSHNVDYEGDTVHVSFVVIKADTPWHYTQDGVDLV  74

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P  + +H  +G + DKF+F   + G+++FCF N     ETV F +H+GH       A
Sbjct  75   VKDPRGDQIHDSRGKTSDKFEFVVHKRGVHRFCFTNKSPYHETVDFDVHIGHFSYFDQHA  134

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L  
Sbjct  135  KDEHFGPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAGLVA  194

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS +QV  +RRLF + +  +RV
Sbjct  195  ASVVQVYLMRRLFERKLGSSRV  216



>ref|XP_002265305.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Vitis vinifera]
 emb|CBI28463.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 113/203 (56%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             +++M+L S +  +  +   V+  +C    V YEGDT+  +FVV+  D  W+    G+D 
Sbjct  12   GIVVMLLLSDLQGVVGIRFVVDREDCFSHDVQYEGDTVHVSFVVIKADASWHYAEDGVDL  71

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             +  P  + +H  +  + +KF+F A + G+++FCF N     ET+ F +HVGH       
Sbjct  72   VIKGPSGDQIHDFRDKTSEKFEFVAQKKGLHRFCFTNKSPYQETIDFDVHVGHFTYYDQH  131

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH +P+  +IA+L EAL ++  EQ +L+A+  R    NE   +R +   + E + L 
Sbjct  132  AKDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSQRAVHKAMFESVALV  191

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS LQ+  ++RLF + +  +RV
Sbjct  192  GASVLQIYLLQRLFERKLGISRV  214



>ref|XP_006474870.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Citrus sinensis]
Length=212

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 110/203 (54%), Gaps = 1/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            A +L  +FS    +  +   ++  EC    V YEGDT+  +FVV+  D  W S H G+D 
Sbjct  11   AAILAFIFS-PQAVYGIRFVIDREECFSHNVQYEGDTVHASFVVIKADSSWYSSHDGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P  + +H  +    +KF+F A   G+++FCF N     ET+ F +HVGH       
Sbjct  70   VVKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFSYYDEH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R ++    E   L 
Sbjct  130  AKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAVYKAFWESTALV  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS LQV  +RRLF + +  +RV
Sbjct  190  GASVLQVYLLRRLFERKLGMSRV  212



>ref|XP_001766849.1| predicted protein [Physcomitrella patens]
 gb|EDQ68251.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 116/212 (55%), Gaps = 8/212 (4%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP-  189
            R   L++ M          +   ++  EC    V ++GD +  ++VV+  +  W+ +H  
Sbjct  10   RQVLLIVGMWLVLARRAQGIRFVIDKKECFQHEVPFDGDHVRVSYVVIKSESSWSFEHTP  69

Query  190  -GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG-HI  363
             G+D  V  P  + VHS K    DKFDF A R G+YKFCF N  S  ETV F +HVG HI
Sbjct  70   VGLDLIVEGPAGHQVHSSKALVEDKFDFTAARKGLYKFCFFNRNSMHETVDFDVHVGYHI  129

Query  364  PN---EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFY  534
             N   EH   KDEH++P+ ++I  L E+L S+  EQ +L A+  +    N++  +RV++ 
Sbjct  130  LNADEEH--VKDEHIEPLMMQIESLEESLYSIQFEQHWLLAQTDQQEIVNKAMSRRVVYK  187

Query  535  TVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             + E + L   S LQVV +RRLF K +  +RV
Sbjct  188  AMLEALALMGCSVLQVVLLRRLFEKKLGQSRV  219



>dbj|BAK04640.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 7/104 (7%)
 Frame = +1

Query  94   ECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP--GIDFTVTSPGDNVVHSMKGTSGDKFD  267
            +C++E V YEG+ +SG+FVVVDHDIFW+SD P  GIDFTVTS G N V+++KG SG+KF+
Sbjct  26   DCIHELVPYEGNFVSGDFVVVDHDIFWSSDRPDPGIDFTVTSRGGNTVYTLKGISGEKFE  85

Query  268  FKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHL  399
            F APR G YKFCFH+PY  PETVSFY+H G      NL ++E L
Sbjct  86   FNAPRGGTYKFCFHSPYGAPETVSFYVHDG-----RNLVREEAL  124



>ref|XP_007142524.1| hypothetical protein PHAVU_008G288000g [Phaseolus vulgaris]
 gb|ESW14518.1| hypothetical protein PHAVU_008G288000g [Phaseolus vulgaris]
Length=213

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 109/205 (53%), Gaps = 0/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A  L+L+     +     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+
Sbjct  9    ALVLVLIGALGKLQRSEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGV  68

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P    +H  +  + DKFDF A +SG++KFCF N     ETV F +HVGH     
Sbjct  69   DLVVKGPSGEQIHDFRDKTSDKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFE  128

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R I   + E   
Sbjct  129  QHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIHKAIFESAA  188

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS+LQV  ++RLF + +  +RV
Sbjct  189  LIGASALQVYLLQRLFERKLGTSRV  213



>gb|AFK47679.1| unknown [Lotus japonicus]
Length=212

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 113/211 (54%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSA---LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN  177
            G+    +LL  L     NL A   +   ++  EC    V YEGDT+  +FVV+  D  W+
Sbjct  2    GLSLIHVLLFALIGVFWNLKASEGIRFVIDRDECFSHDVKYEGDTVHISFVVIKADSPWH  61

Query  178  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
                G+D  V  P    +H  +  + +KF+F A +SG++KFCF N     ET+ F +HVG
Sbjct  62   YGDEGVDLVVKGPAGEQIHDFRDKTSEKFEFVAHKSGVHKFCFTNKSPYHETIDFDVHVG  121

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            H       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    N++  +R I   
Sbjct  122  HFSYYEQHAKDEHFTPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIHKA  181

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  182  LFESAALIGASALQVYLLQRLFERKLGTSRV  212



>gb|EYU42779.1| hypothetical protein MIMGU_mgv1a013547mg [Erythranthe guttata]
Length=217

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 112/206 (54%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            + + ++++ L         +   ++  EC+   V YE DT+  +FVV+  D+ W+    G
Sbjct  12   KGFLMMIIWLMLEFRGGFGIRFVIDKEECLSHNVQYEADTVRLSFVVIKADVSWHYADDG  71

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  +  P    +H     + DK++F A   G+Y+FCF N     ET+ F IHVGH  + 
Sbjct  72   VDLLIKGPDGKKIHEFHDKTSDKYEFMAQMRGVYRFCFTNKSPFHETIDFDIHVGHFMHF  131

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R I+  + E +
Sbjct  132  DQHAKDEHFNPMLEQISKLEEALYNIQFEQHWLEAQTDRQALVNEAMSQRAIYKAIFESL  191

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L   SSLQV  ++RLF + +  +RV
Sbjct  192  ALVGVSSLQVYLLQRLFDRKLGTSRV  217



>ref|XP_010243958.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nelumbo nucifera]
Length=212

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 113/205 (55%), Gaps = 1/205 (0%)
 Frame = +1

Query  19   YALLL-MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            +AL++ ++L S +     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+
Sbjct  8    FALIVPLVLLSSLQPAVGIRFVIDREECFSHNVQYEGDTVHVSFVVIKADTPWSYGEDGV  67

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P  + +H  +  + +KFDF   + G+++FCF N     ET+ F +HVGH  +  
Sbjct  68   DLVVKGPSGDQIHDSRDKTSEKFDFIVRKKGLHQFCFTNKSPYHETIDFDVHVGHFAHFD  127

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH +P+  +IA+L E+L ++  EQ +L+A+  R    NE   +R I   + E   
Sbjct  128  QHAKDEHFNPLMEQIAKLEESLYNIQFEQHWLEAQTDRQALVNEGMSRRAIHKAMFESAA  187

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  +RRLF + +  +RV
Sbjct  188  LIGASVLQVYLLRRLFERKLGTSRV  212



>ref|XP_003574832.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brachypodium distachyon]
Length=213

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 110/210 (52%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            A   R   L+++ +  F+   + +   ++  EC    V YEGDT+  +FVV+  D  W+ 
Sbjct  4    ALSWRTACLVVLCVLPFLRPAAGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHY  63

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
               G+D  V  P    V   +  + DKFDF   + G+++FCF N     ET+ F +HVGH
Sbjct  64   SEDGVDLVVKDPNGGQVRDSRDKTSDKFDFIVQKRGVHRFCFTNKSPYHETIDFDVHVGH  123

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
                   AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  KR +   +
Sbjct  124  FSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSKRAVHKAL  183

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             E   L  AS +QV  +RRLF + +  +RV
Sbjct  184  IESAALIAASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_010238339.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brachypodium distachyon]
Length=212

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 110/208 (53%), Gaps = 0/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
             +R    L++ L   + +  A+   ++  EC    V YEGDT+  +FVV+  +  W+   
Sbjct  5    SLRLIYFLVLCLMPLLRHAVAIRFVMDREECFSHNVDYEGDTVHVSFVVIKAETPWHYSE  64

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  V  P  N +H  +  + DKF+F   + G+++FCF N     ETV F +HVGH  
Sbjct  65   DGVDLVVKDPNGNQIHDSRAKTSDKFEFVVQKRGVHRFCFTNKSPYHETVDFDVHVGHFS  124

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  +I +L EAL S+  EQ +L+A+  R    NE+  KR +   + E
Sbjct  125  YFDQHAKDEHFSPLFAQILKLDEALYSIQFEQHWLEAQTDRQAILNENMSKRAVHKALFE  184

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS +Q+  +RRLF + +  +RV
Sbjct  185  SAALIAASVVQIYLLRRLFERKLGSSRV  212



>ref|XP_006857765.1| hypothetical protein AMTR_s00061p00199890 [Amborella trichopoda]
 gb|ERN19232.1| hypothetical protein AMTR_s00061p00199890 [Amborella trichopoda]
Length=229

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 109/204 (53%), Gaps = 0/204 (0%)
 Frame = +1

Query  19   YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            +AL L ++ S +     +   ++  EC    V YEGDT+  +FVV+  +  W+    G+D
Sbjct  26   HALTLCLVLSSLQPTLGIRFVIDREECFSHSVQYEGDTVHVSFVVIKTENAWHYGDDGVD  85

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P  + +H  +  + +KF+F A   G+++FCF N     ET+ F IHVGH      
Sbjct  86   LVVKGPSGDQIHDARDKTSEKFEFVAHHKGLHRFCFTNKSPYHETIDFDIHVGHFAYFEQ  145

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH +P+  +IA+L EAL +V  EQ +L+A+  R    NE   +R I   + E   L
Sbjct  146  HAKDEHFNPLLEQIAKLEEALYNVQFEQHWLEAQTERQALVNEGMSRRAIHKALFESAAL  205

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
               S LQV  +RRLF + +  +RV
Sbjct  206  VGVSVLQVYLLRRLFERKLGTSRV  229



>ref|XP_010524625.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Tarenaya hassleriana]
 ref|XP_010524626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Tarenaya hassleriana]
Length=208

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 110/208 (53%), Gaps = 1/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            G++   +LL +L+SF   L  +   ++  EC      YEGDT+  +FVVV  D  W+ + 
Sbjct  2    GLKDTVVLLGILWSFQVTL-GIRFVIDREECFSHNAQYEGDTLHTSFVVVKSDSQWHYND  60

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  +  P    VH  +  +  KF+F   + G+Y+FCF N     ET+ F + + H  
Sbjct  61   DGVDLVIHGPTGEQVHDFRDQTSGKFEFMVQKKGVYRFCFTNKSPYHETIDFDVQLAHFA  120

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR I   + E
Sbjct  121  YYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAIHKAMFE  180

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS LQV  +RRLF + +  +RV
Sbjct  181  SAALVGASVLQVYLLRRLFERKLGISRV  208



>dbj|BAK05986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 110/208 (53%), Gaps = 0/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            G+R    L++ L  F+ +  A+   ++  EC    V YEGDT+  +FVV+  D  W+   
Sbjct  6    GLRLGYFLVLCLVPFLRHAVAIRFVMDRGECFSHNVDYEGDTVHVSFVVIKADTPWHYSE  65

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  V  P  N +H  +    DKF+F   + G+++FCF N     ETV F +HVGH  
Sbjct  66   DGVDLVVKDPNGNQLHDSRAKVSDKFEFMVQKRGVHRFCFTNKSPYHETVDFDVHVGHFS  125

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  ++ +L E L ++  EQ +L A+  R    NE+  KR +   + E
Sbjct  126  YFDQHAKDEHFGPLFEQMRKLDEDLFNIQFEQHWLTAQTDRQAILNENMSKRAVHKALLE  185

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS++QV  +RRLF + +  +RV
Sbjct  186  SAALIAASAVQVYLLRRLFERKLGASRV  213



>ref|XP_010252793.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nelumbo nucifera]
 ref|XP_010252794.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nelumbo nucifera]
Length=212

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 111/206 (54%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R+  ++L++L S +     +   ++  EC    V YEGDT+  +FVV+  D  W+    G
Sbjct  7    RSMFIVLVILLSILKVAVGIRFVIDREECFSHNVEYEGDTVHFSFVVIKADGPWHYSDDG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  V  P  + +   +  + +KF+F A + G++ FCF N     ET+ F IHVGH    
Sbjct  67   VDLVVKGPSGDQIRDSRDQTSEKFEFTAHKKGLHSFCFTNKSPYHETIDFDIHVGHFTYF  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH +P+  +IA+L E+L ++  EQ +L+A+  R    NE   +R I   V E  
Sbjct  127  DQHAKDEHFNPLLEQIAKLEESLYNIQFEQHWLEAQTDRQALVNEGMSRRAIHKAVFESA  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L  AS LQV  +RRLF + +  +RV
Sbjct  187  ALIGASVLQVYLLRRLFERKLGTSRV  212



>ref|XP_008219687.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Prunus mume]
Length=212

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 108/202 (53%), Gaps = 3/202 (1%)
 Frame = +1

Query  34   MMLFSFVTNLSA---LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L +F+ +L A   +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  
Sbjct  11   VLLLTFLVSLQAVFGIRFVIDREECFSHNVQYEGDTVHISFVVIKVDASWHYTQDGVDLV  70

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P    +H  +  + +KFDF     G+++FCF N     ET+ F IHV H       A
Sbjct  71   VKGPSGEQIHDFRDKTSEKFDFVTRHKGVHQFCFTNKSPYHETIDFDIHVSHFTYYDQHA  130

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R I     E   L  
Sbjct  131  KDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAIHKAFFESAALVG  190

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV  +RRLF + +   RV
Sbjct  191  ASALQVYLLRRLFERKLGVTRV  212



>ref|XP_007205899.1| hypothetical protein PRUPE_ppa011405mg [Prunus persica]
 gb|EMJ07098.1| hypothetical protein PRUPE_ppa011405mg [Prunus persica]
Length=212

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 108/202 (53%), Gaps = 3/202 (1%)
 Frame = +1

Query  34   MMLFSFVTNLSA---LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L +F+ +L A   +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  
Sbjct  11   VLLLTFLVSLQAVFGIRFVIDREECFSHNVQYEGDTVHISFVVIKVDASWHYTQDGVDLV  70

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P    +H  +  + +KFDF     G+++FCF N     ET+ F IHV H       A
Sbjct  71   VKGPSGEQIHDFRDKTSEKFDFVTRHKGVHQFCFTNKSPYHETIDFDIHVSHFTYYDQHA  130

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R I     E   L  
Sbjct  131  KDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAIHKAFFESAALVG  190

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV  +RRLF + +   RV
Sbjct  191  ASALQVYLLRRLFERKLGVTRV  212



>ref|XP_010644591.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Vitis vinifera]
 ref|XP_010644592.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Vitis vinifera]
 emb|CBI39754.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 110/204 (54%), Gaps = 0/204 (0%)
 Frame = +1

Query  19   YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            +  +++++   V  +  +   ++  EC    V YEGDTI  +FVV+  D  W+ +  G+D
Sbjct  8    FGFIVILVLLSVQAVCGIRFVIDREECFSHNVEYEGDTIHASFVVIKVDASWHYNKDGVD  67

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P  N +   +  + +KF+F A   G+++FCF N     ET+ F ++ GH      
Sbjct  68   LVVKGPSGNQIQDYRDKTSEKFEFMAHEKGLHRFCFTNKSPYHETIDFDVYTGHFAYYDQ  127

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    N++  +R ++    E   L
Sbjct  128  HAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQARVNDAMNRRAVYKAFYESAAL  187

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS LQV  +RRLF + +  +RV
Sbjct  188  IGASILQVYLLRRLFERKLGTSRV  211



>gb|KJB10764.1| hypothetical protein B456_001G223000 [Gossypium raimondii]
Length=215

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 113/205 (55%), Gaps = 1/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A+A + + L+S +     +   ++  EC+   V YEGDT+ G+FVV+  +  W+    G+
Sbjct  12   AWAAVGLFLWS-LKLAEGVRFVIDKEECLSHDVKYEGDTVYGSFVVIKAEAPWHFSDEGV  70

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P  +++H  +    +KFDF   + G+Y+FCF N     ET+ F + VGH    H
Sbjct  71   DLVVKGPEGDLIHDFRNKISEKFDFVVHKKGVYRFCFVNKSPYHETIDFDLQVGHFTYRH  130

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AK+EH  P+  +I +L EAL ++  EQ +++A+  R    N+S  +R +   + E + 
Sbjct  131  QHAKEEHFGPLMEQITKLEEALYNIQFEQHWIEAQTDRQAIVNDSLGRRALHKAMFESVA  190

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  ++R+F + +  +RV
Sbjct  191  LIAASILQVFLLKRMFERKLGTSRV  215



>gb|KHN46897.1| Transmembrane emp24 domain-containing protein 2 [Glycine soja]
Length=212

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLS---ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            L+  L   + NL     +   ++  EC    V YEGDT+  +F+V+  D  W+ D  G+D
Sbjct  9    LVFALIGALWNLQRAEGIRFVIDRDECFSHDVKYEGDTVHVSFIVIKADSPWHYDDEGVD  68

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +HVGH      
Sbjct  69   LVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFEQ  128

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R +   + E   L
Sbjct  129  HAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVHKAIFESAAL  188

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS+LQV  ++RLF + +  +RV
Sbjct  189  IGASALQVYLLQRLFERKLGTSRV  212



>ref|XP_010061440.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Eucalyptus grandis]
 gb|KCW68387.1| hypothetical protein EUGRSUZ_F02040 [Eucalyptus grandis]
Length=212

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 108/206 (52%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R   + ++ LF  +  +S +   ++  EC    V YEGDT+  +FVV+  D  W+    G
Sbjct  7    RHVLVTMLALFLSLQAVSGIRFVIDREECFSHNVEYEGDTVHISFVVIKSDSSWHYSQDG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  V  P  + +H  +    +KF+F A   G+++FCF N     ETV F +HVGH    
Sbjct  67   VDLLVKGPSGDQIHDFRDKISEKFEFIAHHKGVHRFCFTNKSPYHETVDFDLHVGHFTYH  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH +P+  +I +L EAL ++  EQ +L+A+  R    N+   +R I     E  
Sbjct  127  DEHAKDEHFNPLMEQIGKLEEALYNIQFEQHWLEAQTERQAIVNDLMSRRAIHKAFFESA  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L  AS LQV  +RRLF + +  +RV
Sbjct  187  ALIGASVLQVYLLRRLFERKLGMSRV  212



>ref|NP_001062344.1| Os08g0532900 [Oryza sativa Japonica Group]
 dbj|BAD11657.1| coated vesicle membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24258.1| Os08g0532900 [Oryza sativa Japonica Group]
 gb|EAZ07774.1| hypothetical protein OsI_30027 [Oryza sativa Indica Group]
 gb|EAZ43460.1| hypothetical protein OsJ_28066 [Oryza sativa Japonica Group]
 dbj|BAG93588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97218.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 109/206 (53%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R   LL++   + +   +A+   ++  EC    V YEGDT+  +FVV+  D  W+    G
Sbjct  7    RTVCLLVLCTVALLRPAAAIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEDG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  V  P    V   +  + DKF+F   + G+++FCF N     ETV F +HVGH    
Sbjct  67   VDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETVDFDVHVGHFSYF  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   + E  
Sbjct  127  DQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALLESA  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L  AS +QV  +RRLF + +  +RV
Sbjct  187  ALIAASVIQVYLLRRLFERKLGTSRV  212



>ref|XP_003618034.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AET00993.1| emp24/gp25L/p24 family protein [Medicago truncatula]
Length=213

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 109/202 (54%), Gaps = 1/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            +L+ ML ++      +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  
Sbjct  13   VLIGMLLNW-KETEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVDLV  71

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P    +   +  + DKF+F A + G++KFCF N     ET+ F +HVGH       A
Sbjct  72   VKGPAGEQIQDFRDKTSDKFEFVAHKPGVHKFCFTNKSPYHETIDFDVHVGHFSYFEQHA  131

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH +P+  +IA+L EAL ++  EQ +L+A+  R    N+   +R +   + E   L  
Sbjct  132  KDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDGMSRRAVHKAIFESAALIG  191

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV  +RRLF + +  +RV
Sbjct  192  ASALQVYLLRRLFERKLGTSRV  213



>ref|XP_003618033.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AET00992.1| emp24/gp25L/p24 family protein [Medicago truncatula]
 gb|AFK48756.1| unknown [Medicago truncatula]
Length=214

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 109/202 (54%), Gaps = 1/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            +L+ ML ++      +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  
Sbjct  14   VLIGMLLNW-KETEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVDLV  72

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P    +   +  + DKF+F A + G++KFCF N     ET+ F +HVGH       A
Sbjct  73   VKGPAGEQIQDFRDKTSDKFEFVAHKPGVHKFCFTNKSPYHETIDFDVHVGHFSYFEQHA  132

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH +P+  +IA+L EAL ++  EQ +L+A+  R    N+   +R +   + E   L  
Sbjct  133  KDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDGMSRRAVHKAIFESAALIG  192

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS+LQV  +RRLF + +  +RV
Sbjct  193  ASALQVYLLRRLFERKLGTSRV  214



>gb|KDP39307.1| hypothetical protein JCGZ_01064 [Jatropha curcas]
Length=212

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 109/203 (54%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            A++L+ +      +  +   ++  EC    V +EGDT+  +FVV+  D  W+  + G+D 
Sbjct  10   AVVLLEILLSQQAVFGIRFVIDREECFSHDVKFEGDTVHVSFVVIKTDSSWHYTNDGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             +  P  + +H  +  + DKF+F A + G+++FCF N     ET+ F IHVGH       
Sbjct  70   VIKGPSGDQIHDFRDKTSDKFEFMARQRGVHRFCFTNKSPYHETIDFDIHVGHFSYYDEH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  KR I     E   L 
Sbjct  130  AKDEHFKPLLDQIWKLEEALYNIQFEQHWLEAQTERQAIVNEAMSKRAIHKAFYESAALI  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS LQV  +RRLF + +  +RV
Sbjct  190  GASVLQVYLLRRLFERKLGMSRV  212



>ref|XP_010689227.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Beta vulgaris subsp. vulgaris]
Length=216

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 114/211 (54%), Gaps = 3/211 (1%)
 Frame = +1

Query  7    GIRAYALLLMMLFS--FVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
            GI+   + ++ML+S   +   + L   ++  EC    V YEGDT+  +FVV+  D  W+S
Sbjct  6    GIKKMVMCILMLWSINLLKGANGLRFVIDREECFSHKVEYEGDTVHFSFVVIKVDSAWHS  65

Query  181  DHPGI-DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  357
            ++ G+ D  V  P    +H  +  S +KF+F A + G+Y FCF N     ET+ F + VG
Sbjct  66   ENEGVVDLVVKGPDGEQLHDTREKSSEKFEFIAHKKGIYHFCFGNRSPYHETIDFDVLVG  125

Query  358  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  537
            H     + AKDEH+ P+  +IA+L EAL ++  EQ +L+A   R    NE   +R I   
Sbjct  126  HYGYVDHHAKDEHVSPLYEQIAKLEEALYNIQFEQHWLEAETDRQAIINEGMSQRAIHKA  185

Query  538  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
              E   L  AS LQV  ++RLF + +  +RV
Sbjct  186  FFESAALIGASVLQVYLLKRLFERKLGTSRV  216



>ref|XP_004144551.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Cucumis sativus]
 gb|KGN43402.1| hypothetical protein Csa_7G031630 [Cucumis sativus]
Length=214

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 112/214 (52%), Gaps = 7/214 (3%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNL-------SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDI  168
            +  +A+  +M+ +FV  L         +   ++  EC   +V YEGDT+  +FVV+  D 
Sbjct  1    MERWAMRFVMMMAFVGVLLLSLRKSEGIRFVIDREECFSHHVQYEGDTVHVSFVVIKADS  60

Query  169  FWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYI  348
             W+    G+D  +  P    +H  +  + +K +F A   G+++FCF N     ET+ F +
Sbjct  61   PWHYGDDGVDLVIKGPSGEHLHDFRDKTSEKHEFIAHNKGLHRFCFTNKSPYHETIDFDV  120

Query  349  HVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVI  528
            HVGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE   KR I
Sbjct  121  HVGHFSYHEQHAKDEHFNPLMDQISKLEEALYNIQFEQHWLEAQTDRQAIVNEGMGKRAI  180

Query  529  FYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
               + E   L  AS LQV  ++RLF + +  +RV
Sbjct  181  HKAMFESAALVGASVLQVYLLQRLFERKLGTSRV  214



>ref|XP_009134990.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Brassica rapa]
Length=208

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  +LL +L+SF  +L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVLLGLLWSFQASL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_006298554.1| hypothetical protein CARUB_v10014637mg [Capsella rubella]
 gb|EOA31452.1| hypothetical protein CARUB_v10014637mg [Capsella rubella]
Length=208

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 110/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L+L +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATILILGLLWSFQATL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMGRRAVHKALVES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            + L  AS LQV  +RRLF + +  +RV
Sbjct  182  LALIAASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_009394560.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Musa acuminata subsp. malaccensis]
Length=212

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 111/205 (54%), Gaps = 6/205 (3%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVT------VNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            +   +FV  L  L +T      ++  EC    V YEGD +  +FVVV  D  W+  + G+
Sbjct  8    IAFLAFVCFLLRLGLTDGIRFVIDREECFSHSVPYEGDMVYVSFVVVKSDTPWHYSNDGV  67

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P  + +H  +  + +KF+F   RSG+++FCF N     ET+ F +HV H  + +
Sbjct  68   DLVVKGPHGDQIHDSRDKTSEKFEFLVQRSGLHRFCFTNKSPYHETIDFDVHVSHFTHYN  127

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEHL P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R I   + E   
Sbjct  128  QHAKDEHLAPLLEQIAKLEEALYNIQFEQHWLEAQTDRQALVNEAMSRRAIHKALFESAA  187

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  + RLF + +  +R+
Sbjct  188  LVGASILQVFLLHRLFERKLGTSRI  212



>ref|XP_004974010.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Setaria italica]
Length=212

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 108/206 (52%), Gaps = 0/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            RA  L ++    F+   + +   ++  EC    V YEGDT+  +FVV+  D  W+    G
Sbjct  7    RAVCLSVLCAVLFLRPAAGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEEG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH    
Sbjct  67   VDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYF  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   + E  
Sbjct  127  EQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESA  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L  AS +QV  +RRLF + +  +RV
Sbjct  187  ALIAASVIQVYLLRRLFERKLGTSRV  212



>ref|XP_006574367.1| PREDICTED: uncharacterized protein LOC100527418 isoform X1 [Glycine 
max]
 gb|KHN43972.1| Transmembrane emp24 domain-containing protein [Glycine soja]
Length=212

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLS---ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            L+ +L   + NL     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D
Sbjct  9    LVFVLIGALWNLQRAEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVD  68

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +HVGH      
Sbjct  69   LVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFEQ  128

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R +   + E   L
Sbjct  129  HAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVHKAIFESAAL  188

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS+LQV  ++RLF + +  +RV
Sbjct  189  IGASALQVYLLQRLFERKLGTSRV  212



>ref|XP_006407808.1| hypothetical protein EUTSA_v10021526mg [Eutrema salsugineum]
 gb|ESQ49261.1| hypothetical protein EUTSA_v10021526mg [Eutrema salsugineum]
Length=208

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L+L +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATILILGLVWSFQATL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NES  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNESMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQ+  +RRLF + +  +RV
Sbjct  182  FALIGASVLQIYLLRRLFERKLGMSRV  208



>ref|XP_011461874.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=212

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (52%), Gaps = 1/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A  +LL  L S     S   V   D EC    VLYEGDT+  +FVV+  D  W+    G+
Sbjct  9    AAVILLAFLLSLQGAFSIRFVIDRD-ECFSHNVLYEGDTVHLSFVVIKVDASWHYTQDGV  67

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P    +H  +  + +K++F     G+++FCF N     ET+ F IHV H     
Sbjct  68   DLMVKGPSGEQIHEFRDKTSEKYEFVTRHKGIHQFCFTNKSPYHETIDFDIHVSHFTYYD  127

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R I     E   
Sbjct  128  QHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAIHKAFFESAG  187

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  +RRLF + +  +RV
Sbjct  188  LVGASVLQVYLLRRLFERKLGMSRV  212



>ref|XP_002882543.1| hypothetical protein ARALYDRAFT_478100 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58802.1| hypothetical protein ARALYDRAFT_478100 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  +LL +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVLLGLLWSFQATL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASLLQVYLLRRLFERKLGMSRV  208



>gb|AAM66112.1| putative coated vesicle membrane protein [Arabidopsis thaliana]
Length=208

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  +LL +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVLLGLLWSFQATL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASFLQVYLLRRLFERKLGMSRV  208



>ref|XP_004491612.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Cicer arietinum]
Length=211

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 105/188 (56%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  V  P  + +   + 
Sbjct  24   GIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVDLVVKGPAGDQIQDFRD  83

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +KF+F A +SG++KFCF N     ET+ F +HVGH       AKDEH +P+  +I++
Sbjct  84   KTSEKFEFVAHKSGVHKFCFTNKSPYHETIDFDVHVGHFSYFEQHAKDEHFNPLLEQISK  143

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    N++  +R I   + E   L  AS+LQV  +RRLF 
Sbjct  144  LEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIHKALFESAALIGASALQVYLLRRLFE  203

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  204  RKLGTSRV  211



>ref|XP_003545588.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Glycine max]
Length=212

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 108/204 (53%), Gaps = 3/204 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLS---ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            L+  L   + NL     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D
Sbjct  9    LVFALIGALWNLQRAEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVD  68

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +HVGH      
Sbjct  69   LVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFEQ  128

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R +   + E   L
Sbjct  129  HAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVHKAIFESAAL  188

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS+LQV  ++RLF + +  +RV
Sbjct  189  IGASALQVYLLQRLFERKLGTSRV  212



>ref|NP_001235792.1| uncharacterized protein LOC100527418 [Glycine max]
 gb|ACU16508.1| unknown [Glycine max]
Length=220

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 109/204 (53%), Gaps = 3/204 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLS---ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            L+ +L   + NL     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D
Sbjct  17   LVFVLIGALWNLQRAEGIRFVIDRDECFSHDVKYEGDTVHVSFVVIKADSPWHYGDEGVD  76

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +HVGH      
Sbjct  77   LVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVHVGHFSYFEQ  136

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R +   + E   L
Sbjct  137  HAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVRKAIFESAAL  196

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS+LQV  ++RLF + +  +RV
Sbjct  197  IGASALQVYLLQRLFERKLGTSRV  220



>ref|XP_006474871.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Citrus sinensis]
Length=921

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 110/203 (54%), Gaps = 1/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            A +L  +FS    +  +   ++  EC    V YEGDT+  +FVV+  D  W S H G+D 
Sbjct  720  AAILAFIFS-PQAVYGIRFVIDREECFSHNVQYEGDTVHASFVVIKADSSWYSSHDGVDL  778

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P  + +H  +    +KF+F A   G+++FCF N     ET+ F +HVGH       
Sbjct  779  VVKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFSYYDEH  838

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R ++    E   L 
Sbjct  839  AKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAVYKAFWESTALV  898

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS LQV  +RRLF + +  +RV
Sbjct  899  GASVLQVYLLRRLFERKLGMSRV  921



>emb|CDY28027.1| BnaC05g44290D [Brassica napus]
Length=211

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L+L +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  6    MKATILILGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  64

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  65   GVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  124

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  125  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  184

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  185  FALIGASVLQVYLLRRLFERKLGMSRV  211



>ref|XP_009147043.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brassica rapa]
Length=208

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L+L +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    MKATILILGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASVLQVYLLRRLFERKLGMSRV  208



>gb|ABB90548.1| coated vesicle membrane protein-like [Triticum aestivum]
Length=212

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 108/203 (53%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             +L++ +  F+   +A+   ++  EC    V YEGDT+  +FVV+  D  W+    G+D 
Sbjct  10   CVLVLCIMPFLHQAAAIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEDGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V       V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH       
Sbjct  70   VVKDSNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHYSYFDQH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R I   + E   L 
Sbjct  130  AKDEHFSPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAIHKALFESAALI  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS +QV  +RRLF + +  +RV
Sbjct  190  AASVIQVYLLRRLFERKLGTSRV  212



>gb|EMS66095.1| Transmembrane emp24 domain-containing protein [Triticum urartu]
Length=212

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 109/206 (53%), Gaps = 1/206 (0%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            RA  L L ++  F+   +A+   ++  EC    V YEGDT+  +FVV+  D  W+    G
Sbjct  8    RACVLALCIML-FLHPAAAIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEDG  66

Query  193  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  372
            +D  V  P    V   +    DKF+F   + G+++FCF N     ET+ F +HVGH    
Sbjct  67   VDLVVKDPNGAQVRDSRDKISDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHYSYF  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
               AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R I   + E  
Sbjct  127  DQHAKDEHFSPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAIHKALFESA  186

Query  553  LLALASSLQVVYIRRLFSKSVAYNRV  630
             L  AS +QV  +RRLF + +  +RV
Sbjct  187  ALIAASVIQVYLLRRLFERKLGTSRV  212



>ref|XP_010464406.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Camelina sativa]
Length=208

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  ++L +L+SF   L  +   ++  EC      YEGDT+  +FVVV  D  W+ +  
Sbjct  3    LKAAIVILGLLWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVVKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_010551965.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Tarenaya hassleriana]
Length=208

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 108/207 (52%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            +++  ++L +L+ F   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKSTIVVLGLLWGFQVTL-GIRFVIDREECFSHKAEYEGDTLHASFVVIKSDAQWHYNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    VH  +  +  K +F   R G+YKFCF N     ET+ F + + H   
Sbjct  62   GVDLVIHGPTGEQVHDFRDQTSGKHEFVVQRKGVYKFCFTNKSPYHETIDFDVQLAHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR I   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAIHKAMFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  AALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_010456670.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Camelina sativa]
Length=208

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  ++L +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVILGLLWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFSPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_001780055.1| predicted protein [Physcomitrella patens]
 gb|EDQ55158.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 107/203 (53%), Gaps = 4/203 (2%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP--GI  195
            AL++ +          +   ++  EC    V  +GD +  ++VV+  +  W  DH   G+
Sbjct  12   ALVVGVWLLLTQQALGIRFVIDKKECFQHEVPNDGDQVLVSYVVIKSESAWTFDHASVGV  71

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH--IPN  369
            D  V +P    VHS K    DKF+F A R G+YKFCF+N     E V F +HVGH     
Sbjct  72   DLIVEAPAGYQVHSSKSKVEDKFNFIAVRRGLYKFCFYNRNYVHENVDFDVHVGHHITDI  131

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
            +  L KDEH+DP+  +I  L E+L S+  EQ +L A+  R    N++  KR+I+  + E 
Sbjct  132  DVQLVKDEHIDPLIWQIERLEESLYSIQFEQHWLLAQTDRQEIVNDAMSKRLIYKAILEA  191

Query  550  ILLALASSLQVVYIRRLFSKSVA  618
            + L   S +QVV +RRLF K + 
Sbjct  192  LALVGCSVVQVVLLRRLFEKKLG  214



>emb|CDX74033.1| BnaA03g30140D [Brassica napus]
Length=208

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  +LL +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVLLGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_010942595.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
 ref|XP_010942596.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=212

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 104/189 (55%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
            + +   ++  EC    V YEGDT+  +FVV+  +  W+    G+DF V SP  + +H  +
Sbjct  24   AGIRFVIDREECFSHSVPYEGDTVRVSFVVIKAENSWHYGDEGVDFVVKSPHGDQLHDAR  83

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
              + +KF+F   + G+++FCF N     ET+ F I VGH  +    AKDEH  P+  +IA
Sbjct  84   DKTSEKFEFIVQKKGLHRFCFTNNSPYHETIDFDIQVGHFTHFDQHAKDEHFSPLLEQIA  143

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            +L +AL ++  EQ +L+A+  R    NE   +R I   + E   L  AS LQV  +RRLF
Sbjct  144  KLEDALYNIQFEQHWLEAQTDRQALVNEGMSRRAIHKALFESAALIGASILQVFLLRRLF  203

Query  604  SKSVAYNRV  630
             + +  +RV
Sbjct  204  ERKLGMSRV  212



>gb|EMT09288.1| Transmembrane emp24 domain-containing protein 7 [Aegilops tauschii]
Length=317

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 108/208 (52%), Gaps = 0/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            G+R    L++ L  F+ +  A+   ++  EC    V Y GDT+  +FVV+  D  W+   
Sbjct  110  GLRLGYFLVLCLVPFLRHAVAIRFVMDRGECFSHNVDYAGDTVHVSFVVIKADTPWHYSE  169

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  V  P  N VH  +    DKF+F   + G+++FCF N     ETV F +HVGH  
Sbjct  170  DGVDLVVKDPNGNQVHDSRAKVSDKFEFIVQKRGVHRFCFTNKSPYHETVDFDVHVGHFS  229

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  +I +L E L +V  EQ +L A+  R    NE+   R I   + E
Sbjct  230  YFDQHAKDEHFGPLFEQIRKLDEDLYNVLFEQHWLTAQTDRQAILNENMSTRAIHKALLE  289

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS++QV  +RRLF + +  +RV
Sbjct  290  SAALIAASAVQVYLLRRLFERKLGTSRV  317



>emb|CDY35954.1| BnaA05g29960D [Brassica napus]
Length=208

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L+L +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    MKATILILGLVWSFHAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|NP_187425.1| p24 subfamily beta 2 [Arabidopsis thaliana]
 sp|Q9S7M9.1|P24B2_ARATH RecName: Full=Transmembrane emp24 domain-containing protein p24beta2; 
AltName: Full=p24 family protein beta1; Short=p24beta1; 
AltName: Full=p24 family protein beta2; Short=p24beta2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF13086.1|AC009176_13 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAF21178.1|AC013483_2 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAK25978.1|AF360268_1 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAK64137.1| putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AEE74586.1| p24 subfamily beta 2 [Arabidopsis thaliana]
Length=208

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 108/207 (52%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++   +LL +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKGTIVLLGLLWSFQATL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASFLQVYLLRRLFERKLGMSRV  208



>ref|XP_010486337.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Camelina sativa]
Length=208

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  ++L +L+SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATIVILGLLWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_009759544.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana sylvestris]
Length=220

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 105/193 (54%), Gaps = 2/193 (1%)
 Frame = +1

Query  58   NLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN--SDHPGIDFTVTSPGDNVV  231
             + A+   ++  EC+ + V Y+GDT+  +FVV+  D  W+  +  P +   +  P    V
Sbjct  28   GIHAIRFVIDREECLSQNVEYDGDTLQLSFVVIAPDTPWHYYTTEPSLHLLIKGPSGEPV  87

Query  232  HSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPIN  411
            H  +  S + ++F+A R G+Y+FCF N     E + F +HV H  + +  AKDEH DP+ 
Sbjct  88   HEFRDKSSEMYEFRAQRKGVYQFCFTNNLPYHEYMDFDLHVSHFTHYNQPAKDEHFDPLL  147

Query  412  VKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYI  591
              I++L EAL+ +  EQ +L+A+  R    NE   +R +   + E I L L + LQ   +
Sbjct  148  EHISKLEEALQKIQVEQHWLEAQTERQASVNEGMGRRAMTKAIVESIALFLVTELQSFLL  207

Query  592  RRLFSKSVAYNRV  630
            RRLF K +  +RV
Sbjct  208  RRLFEKKLKSSRV  220



>ref|NP_001132648.1| hypothetical protein precursor [Zea mays]
 ref|XP_008676620.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008676621.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008676622.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80416.1| unknown [Zea mays]
 gb|ACF81579.1| unknown [Zea mays]
 gb|ACF82270.1| unknown [Zea mays]
 gb|ACN35285.1| unknown [Zea mays]
 gb|AFW61590.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61591.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61592.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61593.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61594.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
Length=213

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 107/203 (53%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             L ++    F+  +  +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D 
Sbjct  11   CLSVLCTVLFLRPVEGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEEGVDL  70

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH       
Sbjct  71   VVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYFEQH  130

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L 
Sbjct  131  AKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAALI  190

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
            +AS +QV  +RRLF + +  +RV
Sbjct  191  VASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_008790745.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Phoenix dactylifera]
Length=212

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 98/188 (52%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDTI  +FVV+ +D  W+    G+D  V  P    +H  + 
Sbjct  25   GIRFVIDREECFTHSVQYEGDTIHASFVVIKYDTPWHYSDDGVDLVVKDPHGAQIHDFRN  84

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               +KF+F   + G+Y+FCF N     ET+ F +HV H       AKDEH  P+  +I +
Sbjct  85   KISEKFEFIGHQKGLYRFCFTNKSPYHETIDFDVHVNHFSYFDEHAKDEHFAPLLEQIGK  144

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE   +R I   + E   L  AS LQV  +RRLF 
Sbjct  145  LEEALYNIQFEQHWLEAQTDRQALVNEGMSRRAIHKALFESAALIGASVLQVFLLRRLFE  204

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  205  RKLGTSRV  212



>ref|XP_010927754.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
 ref|XP_010927755.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=212

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 99/188 (53%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVV+ +D  W+    G+D  V  P    +H  + 
Sbjct  25   GIRFVIDREECFTHSVQYEGDTVHASFVVIKYDTPWHYSDDGVDLVVNDPHGAQIHDFRN  84

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               +KF+F + + G+Y+FCF N     ET+ F +HV H       AKDEH  P+  +I +
Sbjct  85   KISEKFEFISQKKGLYRFCFTNKSPYHETIDFDVHVKHFSYFDEHAKDEHFAPLLEQIGK  144

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE   +R I   + E   L  AS LQV  +RRLF 
Sbjct  145  LEEALYNIQFEQHWLEAQTDRQALVNEGMSRRAIHKALFESAALIGASVLQVYLLRRLFE  204

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  205  RKLGTSRV  212



>ref|XP_009124202.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brassica rapa]
Length=208

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 1/207 (0%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            ++A  L++ +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  
Sbjct  3    LKATILIIGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNED  61

Query  190  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
            G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + +GH   
Sbjct  62   GVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAY  121

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E 
Sbjct  122  YDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFES  181

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
              L  AS LQV  +RRLF + +  +RV
Sbjct  182  FALIGASVLQVYLLRRLFERKLGMSRV  208



>gb|KHG15887.1| Transmembrane emp24 domain-containing 2 [Gossypium arboreum]
Length=215

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 110/205 (54%), Gaps = 1/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A+A + + L+S       +   ++  EC+   V YEGDT+  +FVV+  +  W+    G+
Sbjct  12   AWAAMGLFLWSLKVA-EGVRFVIDKEECLSHDVKYEGDTVYVSFVVIKAEAPWHFSDEGV  70

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  +  P  + +H  +    +KFDF   + G+Y+FCF N     ET+ F + VGH    H
Sbjct  71   DLVIKGPSGDQIHDFRNKISEKFDFVVHKKGVYRFCFVNRSPYHETIDFDLQVGHFTYRH  130

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AK+EH  P+  +I +L EAL ++  EQ +++A+  R    N+S  +R +   + E + 
Sbjct  131  QHAKEEHFSPLMEQITKLEEALYNIQFEQHWIEAQTDRQAIVNDSLGRRALHKAMFESVA  190

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  ++R+F + +  +RV
Sbjct  191  LIAASILQVFLLKRMFERKLGTSRV  215



>ref|XP_008349392.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like, 
partial [Malus domestica]
Length=192

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 100/188 (53%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  V  P  + +H  + 
Sbjct  5    GIRFVIDREECFSHNVQYEGDTVHISFVVIKVDASWHHTQDGVDLMVKGPSGDKIHDFRD  64

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +K+DF A   G+++FCF N     ET+ F IHV H       AKDEH +P+  ++++
Sbjct  65   KTTEKYDFVAHHKGIHQFCFTNKSPYHETIDFDIHVSHFTYYDQHAKDEHFNPLLEQVSK  124

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE+  +R I     E   L  AS LQV  +RRLF 
Sbjct  125  LEEALYNIQFEQHWLEAQTERQAIANEAMGRRAIHKVFFESAALVGASLLQVFLLRRLFE  184

Query  607  KSVAYNRV  630
            + +   RV
Sbjct  185  RKLGMTRV  192



>gb|KJB13907.1| hypothetical protein B456_002G101200 [Gossypium raimondii]
 gb|KJB13908.1| hypothetical protein B456_002G101200 [Gossypium raimondii]
Length=212

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 106/203 (52%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            A+ L+        +  +   ++  EC    V YEGDTI  +FVV+  D  W++ H G+D 
Sbjct  10   AVALLAFLCSPNAVYGIRFVIDREECFSHDVKYEGDTIHVSFVVIKADSTWHNSHEGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P  + +   +    +KF+F A + G+++FCF N     ETV F +H  H       
Sbjct  70   VVKGPTGDQIQDFRDKISEKFEFVAHQKGIHRFCFSNKSPYYETVDFDVHESHFTYYDQH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +     E   L 
Sbjct  130  AKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSKRAVHKAFYESAALI  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS LQV  +RRLF + +  +RV
Sbjct  190  GASVLQVYLLRRLFERKLGMSRV  212



>emb|CDY22128.1| BnaC01g39730D [Brassica napus]
Length=242

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 109/208 (52%), Gaps = 1/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
             ++A  L+L +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ + 
Sbjct  36   SLKATILILGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNE  94

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + +GH  
Sbjct  95   DGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFA  154

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E
Sbjct  155  YYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFE  214

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS LQV  +RRLF + +  +RV
Sbjct  215  SFALIGASVLQVYLLRRLFERKLGMSRV  242



>ref|XP_008358798.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Malus domestica]
Length=212

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 100/188 (53%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  V  P  + +H  + 
Sbjct  25   GIRFVIDREECFSHNVQYEGDTVHISFVVIKVDASWHHTQDGVDLMVKGPSGDKIHDFRD  84

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +K+DF A   G+++FCF N     ET+ F IHV H       AKDEH +P+  ++++
Sbjct  85   KTTEKYDFVAHHKGIHQFCFTNKSPYHETIDFDIHVSHFTYYDQHAKDEHFNPLLEQVSK  144

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE+  +R I     E   L  AS LQV  +RRLF 
Sbjct  145  LEEALYNIQFEQHWLEAQTERQAIANEAMGRRAIHKVFFESAALVGASLLQVFLLRRLFE  204

Query  607  KSVAYNRV  630
            + +   RV
Sbjct  205  RKLGMTRV  212



>ref|XP_006660817.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006660818.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Oryza brachyantha]
Length=212

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 110/210 (52%), Gaps = 0/210 (0%)
 Frame = +1

Query  1    AAGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS  180
               +R   LL++ + +F+    A+   ++  EC    V YEGDT+  +FVV+  D  W+ 
Sbjct  3    GVSLRLGYLLVLCILTFLRPAVAIRFVIDREECFSHNVDYEGDTVHVSFVVIKADTPWHF  62

Query  181  DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGH  360
               G+D  V  P  N +H  +    DKF+F   + G+++FCF N     ETV F + VGH
Sbjct  63   TKDGVDLVVKDPNGNQIHDSRDKITDKFEFIVHKRGVHRFCFTNKSPYHETVDFDVLVGH  122

Query  361  IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  540
                   AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   +
Sbjct  123  FSYFDQHAKDEHFGTLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMGRRAVHKAL  182

Query  541  GEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             E   L  AS +QV  +RRLF + +  +RV
Sbjct  183  FESAALIAASVVQVYLLRRLFERKLGTSRV  212



>ref|XP_010675969.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Beta vulgaris subsp. vulgaris]
Length=210

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 98/188 (52%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             L   ++  EC    V YE D +  +FVV+  D  W +D  G+D  V  P  + VH    
Sbjct  24   GLRFVIDREECFSHNVQYEWDVVHASFVVIKSDSPWRTD-DGVDLVVKGPEHDQVHDSHD  82

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               DKFDF A + G Y FCF N     ET+ F + VGH       AKDEH+ P+  +I +
Sbjct  83   RISDKFDFVAHKKGAYSFCFTNKSPYHETIDFDVQVGHFTYYDQHAKDEHVKPLIEQIEK  142

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L E+L ++  EQ +L+A+  R    NE+  KR I   V E + L  AS LQ+  +RRLF 
Sbjct  143  LGESLYNIQFEQHWLEAQTDRQALVNEAMSKRAIHKAVMESLALVGASVLQIYLLRRLFE  202

Query  607  KSVAYNRV  630
            K +  +RV
Sbjct  203  KKLGTSRV  210



>emb|CDY07978.1| BnaC03g35450D [Brassica napus]
Length=209

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 1/202 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            +LL +++SF   L  +   ++  EC      YEGDT+  +FVV+  D  W+ +  G+D  
Sbjct  9    VLLGLVWSFQAAL-GIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNEDGVDLV  67

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + +GH       A
Sbjct  68   IHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAYYDQHA  127

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR +   + E   L  
Sbjct  128  KDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVHKALFESFALIG  187

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQV  +RRLF + +  +RV
Sbjct  188  ASVLQVYLLRRLFERKLGMSRV  209



>ref|XP_008811267.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Phoenix dactylifera]
Length=212

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 103/189 (54%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
            + +   ++  EC    V YEGDT+  +FVV+  +  W+    G+DF V  P  + +H  +
Sbjct  24   AGIRFVIDREECFSHSVPYEGDTVLVSFVVIKAERSWHYGDEGVDFVVKGPHGDQIHDAR  83

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
              + +KF+F   + G+++FCF N     ET+ F IHVGH  +    AKDEH  P+  +I+
Sbjct  84   DKTSEKFEFIVQQKGLHRFCFTNRSPYHETIDFDIHVGHFTHFDQHAKDEHFAPLLEQIS  143

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            +L EAL ++  EQ +L+A+  R    NE   +R +   + E   L   S LQ+  +RRLF
Sbjct  144  KLEEALYNIQFEQHWLEAQTDRQALVNEGMSRRAMHKALLESAALIGVSMLQIFLLRRLF  203

Query  604  SKSVAYNRV  630
             + +  +RV
Sbjct  204  ERKLGMSRV  212



>ref|XP_011100513.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Sesamum indicum]
 ref|XP_011100514.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Sesamum indicum]
Length=216

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 109/209 (52%), Gaps = 7/209 (3%)
 Frame = +1

Query  25   LLLMMLFSFVTNLS-------ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
            +L+ MLF     L         +   ++  EC+   VLYEGDT+  +FVV+  D  W   
Sbjct  8    MLMKMLFWMTIWLMVQSRGGFGIRFVIDRQECLSHNVLYEGDTVHVSFVVIKADNNWIYS  67

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
              G+D  +  P    VH       +K++F + R G+Y+FCF N     ET+ F +HVGH 
Sbjct  68   DEGVDLLIKGPSGEQVHEFHDRISEKYEFLSQRKGIYRFCFTNKSPYHETIDFDVHVGHF  127

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
               +  AKDEH +P+  +I++L  AL ++  EQ +L+A+  R    NE   ++  +  + 
Sbjct  128  MYHNQHAKDEHFNPMLEQISKLEVALYNIQFEQHWLEAQVDRQALVNEVMGRKAFYKAIF  187

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            E + L  AS LQV  ++RLF + +  +RV
Sbjct  188  ESLALLGASFLQVYLLQRLFERKLGTSRV  216



>ref|XP_006659626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Oryza brachyantha]
Length=213

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 101/188 (54%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            A+   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  V  P    V   + 
Sbjct  26   AIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEDGVDLVVKDPNGAQVRDSRD  85

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + DKF+F   + G+++FCF N     ET+ F +HVGH       AKDEH  P+  +IA+
Sbjct  86   KTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYYDQHAKDEHFAPLFEQIAK  145

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L  AS +QV  +RRLF 
Sbjct  146  LDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALLESAALIAASVIQVYLLRRLFE  205

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  206  RKLGTSRV  213



>ref|XP_004172188.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like, 
partial [Cucumis sativus]
Length=206

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 107/206 (52%), Gaps = 7/206 (3%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNL-------SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDI  168
            +  +A+  +M+ +FV  L         +   ++  EC   +V YEGDT+  +FVV+  D 
Sbjct  1    MERWAMRFVMMMAFVGVLLLSLRKSEGIRFVIDREECFSHHVQYEGDTVHVSFVVIKADS  60

Query  169  FWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYI  348
             W+    G+D  +  P    +H  +  + +K +F A   G+++FCF N     ET+ F +
Sbjct  61   PWHYGDDGVDLVIKGPSGEHLHDFRDKTSEKHEFIAHNKGLHRFCFTNKSPYHETIDFDV  120

Query  349  HVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVI  528
            HVGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE   KR I
Sbjct  121  HVGHFSYHEQHAKDEHFNPLMDQISKLEEALYNIQFEQHWLEAQTDRQAIVNEGMGKRAI  180

Query  529  FYTVGEYILLALASSLQVVYIRRLFS  606
               + E   L  AS LQV  ++RLF 
Sbjct  181  HKAMFESAALVGASVLQVYLLQRLFE  206



>ref|XP_002444693.1| hypothetical protein SORBIDRAFT_07g026110 [Sorghum bicolor]
 gb|EES14188.1| hypothetical protein SORBIDRAFT_07g026110 [Sorghum bicolor]
Length=214

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 100/189 (53%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
              +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D  V  P    V   +
Sbjct  26   EGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEEGVDLVVKDPNGGQVRDSR  85

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
              + DKF+F   + G+++FCF N     ET+ F +HVGH       AKDEH  P+  +IA
Sbjct  86   DKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYFEQHAKDEHFAPLFEQIA  145

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            +L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L  AS +QV  +RRLF
Sbjct  146  KLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAALIAASVIQVYLLRRLF  205

Query  604  SKSVAYNRV  630
             + +  +RV
Sbjct  206  ERKLGTSRV  214



>ref|NP_001147761.1| LOC100281371 precursor [Zea mays]
 ref|XP_008674556.1| PREDICTED: LOC100281371 isoform X1 [Zea mays]
 gb|ACG28608.1| transmembrane emp24 domain-containing protein 3 precursor [Zea 
mays]
 gb|ACN25245.1| unknown [Zea mays]
 gb|ACR37909.1| unknown [Zea mays]
 gb|ACR38221.1| unknown [Zea mays]
 tpg|DAA48232.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
1 [Zea mays]
 tpg|DAA48233.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
2 [Zea mays]
 tpg|DAA48234.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
3 [Zea mays]
Length=213

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             L ++    F+     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D 
Sbjct  11   CLSVLCAVLFLRPAEGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEEGVDL  70

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH       
Sbjct  71   VVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYFEQH  130

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L 
Sbjct  131  AKDEHFAPLFEQIGKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAALI  190

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS +QV  +RRLF + +  +RV
Sbjct  191  AASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_011095562.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Sesamum indicum]
Length=208

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 102/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            A+ +M++ S     S +   +N  EC    V Y G+T+  +FVV+  +  W+    G+D 
Sbjct  7    AVAVMVILSSFGGASGIRFVINREECFSHKVEY-GNTVHFSFVVIKSEGSWHYSEDGVDL  65

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H ++    DK DF A   G+Y+FCF N     ETV F +H GH       
Sbjct  66   VVKGPNGEQIHDVRDKISDKHDFVAYHQGIYRFCFTNKSPYHETVDFDVHAGHFLYHDEH  125

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL +V  EQ +L A+  R  + NE   K  I   + E   L 
Sbjct  126  AKDEHFKPLFEHIGKLEEALYNVQFEQHWLAAQTDRQANVNEKMSKGAIQKALFESAALI  185

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
            LAS LQV  +R LF + +  +RV
Sbjct  186  LASGLQVYILRHLFERKLGASRV  208



>ref|XP_010063252.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
isoform X1 [Eucalyptus grandis]
 gb|KCW70465.1| hypothetical protein EUGRSUZ_F03682 [Eucalyptus grandis]
Length=212

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 104/201 (52%), Gaps = 0/201 (0%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
            +++ LF  +  +S +   ++  +C    V YEGDT+  +FVV+  D  W+    G+D  V
Sbjct  12   VVLGLFLSLHAVSGIRFMIDREDCFSHDVQYEGDTVHASFVVIKSDSSWHYSQEGVDLVV  71

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
              P    +        +KF+F A   G+++FCF N     ET+ F +HVGH       AK
Sbjct  72   KGPSGEQIQDFHDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFTFYDQHAK  131

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH +P+  +I +L EAL ++  EQ +L+A   R    N++  +R +     E   L  A
Sbjct  132  DEHFNPLLEQIGKLEEALYNIQFEQHWLEAETERQAIVNDAMSRRAVHKAFFESAALIGA  191

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S LQV  +RRLF + +  +RV
Sbjct  192  SVLQVYLLRRLFERKLGISRV  212



>gb|ACG35396.1| transmembrane emp24 domain-containing protein 3 precursor [Zea 
mays]
Length=213

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 0/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
             L ++    F+     +   ++  EC    V YEGDT+  +FVV+  D  W+    G+D 
Sbjct  11   CLSVLCAVLFLRPAEGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTPWHYSEEGVDL  70

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH       
Sbjct  71   VVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYFEQH  130

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L 
Sbjct  131  AKDEHFAPLFDQIGKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAALI  190

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
             AS +QV  +RRLF + +  +RV
Sbjct  191  AASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_007049383.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93540.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
Length=216

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 108/204 (53%), Gaps = 1/204 (0%)
 Frame = +1

Query  22   ALLLMMLFSF-VTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            A + M LF + +     +   ++  EC+     YEGDT+  +FVV+  D  W+    GID
Sbjct  13   AWIAMGLFLWSLKGTQGVRFVIDREECLSHDAKYEGDTLHVSFVVIKADSPWHFSDEGID  72

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              +  P    +H  +  + +K++F   + G+Y+FCF+N     ET+ F + + H   +  
Sbjct  73   LVIRGPSGEQIHDFRDKTSEKYEFVVQQKGVYRFCFYNKSPYHETIDFDVKLAHFAYQEQ  132

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH+ P+  +I++L EAL ++  EQ +++A+  R    N+S   R I   + E   L
Sbjct  133  HAKDEHIAPLLEQISKLEEALYNIQFEQHWIEAQTDRQAIVNDSMGLRAIHKAMLESAAL  192

Query  559  ALASSLQVVYIRRLFSKSVAYNRV  630
              AS LQV  +RRLF + +  +RV
Sbjct  193  VGASILQVCLLRRLFERKLGTSRV  216



>gb|EAZ45308.1| hypothetical protein OsJ_29951 [Oryza sativa Japonica Group]
Length=211

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 108/209 (52%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
              +R   LL++ + +F+   +A+   ++  EC    V YEGDT+  +FVV+  +  W+  
Sbjct  3    GSLRLGFLLVLCILAFLRPAAAIRFVIDREECFSHNVDYEGDTVHVSFVVIKAETPWHYT  62

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
              G+D  V  P  N +H  +    DKF+F   R G+++FCF N     ETV F + V H 
Sbjct  63   EDGVDLVVRDPNGNQIHDSRDKISDKFEFIVHRRGVHRFCFTNKSPYHETVDFDVLVSHF  122

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
                  AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +     
Sbjct  123  SYYDQHAKDEHFSALFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKAFF  182

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            E   L  AS +QV  + RLF + +  +RV
Sbjct  183  ESAALIAASVVQVYLLHRLFERKLGTSRV  211



>gb|AGT16036.1| transmembrane emp24 domain-containing protein [Saccharum hybrid 
cultivar R570]
Length=237

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 103/200 (52%), Gaps = 0/200 (0%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
            +L  +  F+     +   ++  EC    V YEGD +  +FVV+  D  W+    G+D  V
Sbjct  14   VLCAVLLFLRPAEGIRFVIDREECFSHNVEYEGDAVHVSFVVIKADTPWHYSEEGVDLVV  73

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
              P    V   +  + DKF+F   + G+++FCF N     ET+ F +HVGH       AK
Sbjct  74   KDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVHVGHFSYFEQHAK  133

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +   + E   L  A
Sbjct  134  DEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKALFESAALIAA  193

Query  568  SSLQVVYIRRLFSKSVAYNR  627
            S +QV  +RRLF + +  +R
Sbjct  194  SVIQVYLLRRLFERKLGTSR  213



>ref|XP_009408352.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Musa acuminata subsp. malaccensis]
Length=210

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 97/184 (53%), Gaps = 0/184 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVV+  +  W+    GID  V  P    +H    
Sbjct  25   GIRFVIDREECFSHSVPYEGDTVHVSFVVIKAETPWHYGDEGIDLVVKDPSGTQIHDFYD  84

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +KF+F A +SG+++FCF N     ET+ F +++GH       AKDEH  P+  +I +
Sbjct  85   KTSEKFEFMAQKSGLHRFCFTNRSPYHETIDFDVYIGHFSYFEQHAKDEHFGPLLEQIGK  144

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE   +R I   + E   L  AS LQV  +RRLF 
Sbjct  145  LEEALYNIQFEQHWLEAQTDRQAIVNEGMSRRAIHKALFESAALIGASVLQVYLLRRLFE  204

Query  607  KSVA  618
            + + 
Sbjct  205  RKLG  208



>ref|XP_009787783.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana sylvestris]
Length=214

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 4/207 (2%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R    LL+M F     +  +   +   EC+   V  EGDTI  +FVV+  D  W+S   G
Sbjct  11   RVALFLLVMCFQ---GIYGIRFVIEREECLSHNVHLEGDTIHVSFVVIKADTPWHSASEG  67

Query  193  -IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
             +D  +  P    +H+    + +K++F A R G+YKFCF N     ET+ F +HV H   
Sbjct  68   AVDLLIKGPSGEQIHNFPDKTSEKYEFVAHRKGVYKFCFTNKSPYHETLDFDVHVVHYTY  127

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH DP+  +I++L  AL ++  EQ +L+A+  R    NE   +R I   + E 
Sbjct  128  FDQHAKDEHFDPLLEQISKLEAALYNIQFEQHWLEAQTERQALVNEGMSQRAITKAILES  187

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            + L   S LQV  ++RLF + V   RV
Sbjct  188  VTLVGVSFLQVFLLQRLFEQKVRTIRV  214



>ref|XP_010088435.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
 gb|EXB36050.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
Length=292

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 3/202 (1%)
 Frame = +1

Query  34   MMLFSFVTNLSA---LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFT  204
            ++L SF+ +L A   +   ++  EC    V YEGDT+  +FVVV  D  W+    G+D  
Sbjct  91   VILLSFLLSLRAVFGIRFVIDREECFSHDVKYEGDTVLVSFVVVKVDSSWHYSEEGVDLV  150

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P  + +H  +  + +KF+F A R G+++FCF N   + ET+ F +HV H       A
Sbjct  151  VKGPTGDQIHDFRDKTSEKFEFVAHRKGVHRFCFTNKSPSHETIDFDVHVSHFSYYDEHA  210

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEHL+P+  +I++L E L ++  EQ +L+A+  R    NE+  KR +     E   L  
Sbjct  211  KDEHLNPLYEQISKLEEVLYNIQFEQHWLEAQTERQALVNEAMSKRAVQKAFFESAALIG  270

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQV  +RRLF + +  +RV
Sbjct  271  ASVLQVYLLRRLFERKLGMSRV  292



>ref|XP_004295183.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=940

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (52%), Gaps = 1/205 (0%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A  +LL  L S     S   V   D EC    VLYEGDT+  +FVV+  D  W+    G+
Sbjct  737  AAVILLAFLLSLQGAFSIRFVIDRD-ECFSHNVLYEGDTVHLSFVVIKVDASWHYTQDGV  795

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P    +H  +  + +K++F     G+++FCF N     ET+ F IHV H     
Sbjct  796  DLMVKGPSGEQIHEFRDKTSEKYEFVTRHKGIHQFCFTNKSPYHETIDFDIHVSHFTYYD  855

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R I     E   
Sbjct  856  QHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAIHKAFFESAG  915

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L  AS LQV  +RRLF + +  +RV
Sbjct  916  LVGASVLQVYLLRRLFERKLGMSRV  940



>gb|EMS53833.1| Transmembrane emp24 domain-containing protein 7 [Triticum urartu]
Length=243

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 95/179 (53%), Gaps = 0/179 (0%)
 Frame = +1

Query  94   ECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFK  273
            EC    V YEGDT+  +FVV+  D  W+    G+D  V  P  N VH  +    DKF+F 
Sbjct  65   ECFSHNVDYEGDTVHVSFVVIKADTPWHYSEDGVDLVVKDPNGNQVHDSRAKVSDKFEFI  124

Query  274  APRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVT  453
              + G+++FCF N     ETV F +HVGH       AKDEH  P+  +I +L + L +V 
Sbjct  125  VQKRGVHRFCFTNKSPYHETVDFDVHVGHFSYFDQHAKDEHFGPLFEQIRKLDDDLYNVL  184

Query  454  SEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             EQ +L A+  R    NE+   R I   + E   L  AS++QV  +RRLF + +  +RV
Sbjct  185  FEQHWLTAQTDRQAILNENMSTRAIHKALLESAALIAASAVQVYLLRRLFERKLGTSRV  243



>gb|EAZ09689.1| hypothetical protein OsI_31972 [Oryza sativa Indica Group]
Length=211

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 107/209 (51%), Gaps = 0/209 (0%)
 Frame = +1

Query  4    AGIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSD  183
              +R   LL++ + +F+   +A+   ++  EC    V YEGDT+  +FVV+  +  W+  
Sbjct  3    GSLRLGFLLVLCILAFLRPAAAIRFVIDREECFSHNVDYEGDTVHVSFVVIKAETPWHYT  62

Query  184  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHI  363
              G+D  V  P  N +H  +    DKF+F   R G+++FCF N     ETV F + V H 
Sbjct  63   EDGVDLVVRDPNGNQIHDSRDKISDKFEFIVHRRGVHRFCFTNKSPYHETVDFDVLVSHF  122

Query  364  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  543
                  AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R +     
Sbjct  123  SYYDQHAKDEHFSALFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVHKAFF  182

Query  544  EYILLALASSLQVVYIRRLFSKSVAYNRV  630
            E   L  AS +QV  +  LF + +  +RV
Sbjct  183  ESAALIAASVVQVYLLHLLFERKLGTSRV  211



>ref|XP_002522778.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF39629.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=938

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 109/216 (50%), Gaps = 8/216 (4%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSV--------TVNDVECVYEYVLYEGDTISGNFVVVDH  162
            G  A  + +  LFSFV     LS          ++  EC    V YEGDT+  +FVVV  
Sbjct  723  GSLAMGIGMKELFSFVLLALLLSAREALGIRFVIDREECFSHDVKYEGDTVHVSFVVVKT  782

Query  163  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  342
            D  W+    G+D  +  P  + +H  +    DK++F A + G++ FCF N     ET+ F
Sbjct  783  DSSWHYTEDGVDLVIKGPSGDQIHDFRDKVSDKYEFMARQKGVHHFCFTNKSPYHETIDF  842

Query  343  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  522
             +HVGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  843  DVHVGHFSYYDEHAKDEHFKPLLDQIWKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRR  902

Query  523  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             +     E   L  AS LQV  +RRLF + +  +RV
Sbjct  903  AVHKAFYESAALIGASVLQVYLLRRLFERKLGISRV  938



>ref|XP_009616557.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana tomentosiformis]
Length=214

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 106/207 (51%), Gaps = 4/207 (2%)
 Frame = +1

Query  13   RAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPG  192
            R    LL++ F     +  +   +   EC+   V  EGDTI  +FV +  D  W+S + G
Sbjct  11   RVALFLLVLCFQ---GIYGIRFVIEREECLSHNVHLEGDTIHVSFVFIKSDTPWHSANEG  67

Query  193  -IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  369
             +D  +  P    +H+    + +K++F A R G+Y+FCF N     ET+ F +HV H   
Sbjct  68   AVDLLIKGPSGEQIHNFPDKTSEKYEFVAHRKGVYQFCFTNKSPNHETLDFDVHVVHYTY  127

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
                AKDEH DP+  +I++L  AL ++  EQ +L+A+  R    NE   +R I   + E 
Sbjct  128  FDQHAKDEHFDPLLEQISKLEAALYNIQFEQHWLEAQTDRQALVNEGMSQRAITKAILES  187

Query  550  ILLALASSLQVVYIRRLFSKSVAYNRV  630
            + L   S LQV  ++RLF K +   RV
Sbjct  188  VTLVGVSFLQVFLLQRLFEKKIRTIRV  214



>emb|CDP13706.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 98/188 (52%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC+   V Y G T+  +FVV+  D  W+  H G+D  V  P    VH  + 
Sbjct  22   GIRFVIDREECISHKVEY-GATVHYSFVVIKSDGSWHFSHEGVDLVVKGPTGEQVHDFRD  80

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +K +F A   G+YKFCF N     ET+ F +  GH       AKDEH  P+   I++
Sbjct  81   KTSEKGEFVAYHEGVYKFCFANKSPYHETIDFDVQAGHFIFHDEHAKDEHFKPLFEHISK  140

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE   K+V+   + E + L  AS LQV  +RRLF 
Sbjct  141  LEEALYNIQFEQHWLEAQTERQAIVNEGMGKKVMHKAMYESLALIAASVLQVYLLRRLFD  200

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  201  RKLGISRV  208



>ref|XP_007020468.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
 gb|EOY11993.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
Length=224

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 110/219 (50%), Gaps = 12/219 (5%)
 Frame = +1

Query  10   IRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHP  189
            I   A +L+        +  +   ++  EC+   V YEGDTI  +FVV+  D  W+S   
Sbjct  6    IEFVAAILLAFLCCPNAVFGIRFVIDREECLSHNVKYEGDTIHVSFVVIKTDSTWHSSDE  65

Query  190  GIDFTVTSPGDNVVH-SMKGTSGD-----------KFDFKAPRSGMYKFCFHNPYSTPET  333
            G+D  V        +  +KG +GD           KF+F A + G+++FCF N     ET
Sbjct  66   GVDLVVAIELATCCNCQVKGPTGDQIQDYRDKISEKFEFVAHQKGVHRFCFSNKSPYYET  125

Query  334  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  513
            V F +H  H       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  126  VDFDVHESHFTYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAM  185

Query  514  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             KR +   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  186  SKRAVHKAIYESAALIGASVLQVYLLRRLFERKLGMSRV  224



>ref|XP_008380011.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Malus domestica]
Length=216

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 94/188 (50%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             L   ++  EC      Y GDTI  +FVV+  D  W+    G+D  +  PG   +H ++G
Sbjct  29   GLRFVIDREECFSHDAKYMGDTIHVSFVVIKVDSTWHYTEDGVDLVIKGPGGEQIHDIRG  88

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +K++      G+++FCF N     ET+ F +H  H       AKDEH  P+  +I +
Sbjct  89   KTSEKYELVVQXQGVHQFCFTNKSPYHETIDFDVHAAHFTYHDQHAKDEHFTPLLEQIQK  148

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A   R    NE   +R     + E   L  AS LQV  ++RLF 
Sbjct  149  LEEALYNIQFEQHWLEAETDRQAIVNEGMSRRATHKALIESAALIGASCLQVFLLKRLFE  208

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  209  RKLGSSRV  216



>ref|XP_009361538.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Pyrus x bretschneideri]
Length=216

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 94/188 (50%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             L   ++  EC      Y GDTI  +FVV+  D  W+    G+D  +  PG   +H ++ 
Sbjct  29   GLRFVIDREECFSHDAKYMGDTIHVSFVVIKVDSTWHYTDDGVDLVIKGPGGEQIHDIRD  88

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +K+D    + G+++FCF N     ETV F +H  H       AKDEH  P+  +I +
Sbjct  89   KTSEKYDLVVQKQGVHQFCFTNKSPYHETVDFDVHAAHFTYYDQHAKDEHFTPLLEQIQK  148

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A   R    NE   +R     + E   L  AS LQV  ++RLF 
Sbjct  149  LEEALYNIQFEQHWLEAETDRQAIVNEGMSRRATHKALIESAALIGASCLQVFLLKRLFE  208

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  209  RKLGSSRV  216



>ref|XP_003600347.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AES70598.1| emp24/gp25L/p24 family/GOLD protein [Medicago truncatula]
Length=210

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 99/198 (50%), Gaps = 1/198 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVD-HDIFWNSDHPGIDFT  204
            + ++L   +  +  +   ++  EC   YV YEGD +  +FVV+   D  W+    G+D T
Sbjct  12   MAILLLCNMNGVLGIRFVIDREECFSHYVQYEGDAVHASFVVISVTDSTWHLTQEGLDLT  71

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P  + +   +  + +KFDF A   G Y+FCF N     E + F +H  H       A
Sbjct  72   VRGPNGDQIREFRDKTSEKFDFVAHTKGPYRFCFTNKSPYREKIDFDVHSNHFSTFEQHA  131

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            +DEH  P+  +I +L EAL ++  EQ +L+A+  R    N +   R I   + E   L  
Sbjct  132  QDEHFTPMLDQIIKLEEALFNIQYEQHWLEAQTERQSIVNNAMSSRAIHKALLESAALIG  191

Query  565  ASSLQVVYIRRLFSKSVA  618
            AS+LQV  +RRLF + + 
Sbjct  192  ASTLQVYLLRRLFERKLG  209



>ref|XP_004252039.2| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Solanum lycopersicum]
Length=277

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 105/200 (53%), Gaps = 1/200 (1%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFW-NSDHPGIDFT  204
            +L++   F+  +  +   ++  EC+   V  EGDTI  +FVV+  D  W +S+  G+D  
Sbjct  6    ILLIFLHFLQGIYGIRFVIDKEECLSHNVHLEGDTIHVSFVVIKADTPWHSSNEGGVDLM  65

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            +  P   ++H  +  + +K++F A + G+Y+FCF N     ET+ F + V H       A
Sbjct  66   IKGPSGELIHGFRDKTSEKYEFVAYKKGIYQFCFTNKSPYHETLDFDVQVVHYAYYDQHA  125

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            K+EH DP+   I++L  AL ++  EQ +L+A+ AR    NE   +R I   + E + L  
Sbjct  126  KNEHFDPLLDHISKLEAALYNIQFEQHWLEAQTARQASLNEGMSQRAITKALLESVTLIG  185

Query  565  ASSLQVVYIRRLFSKSVAYN  624
               LQV  ++RLF   +  N
Sbjct  186  VCFLQVFLLQRLFENKLQKN  205



>ref|XP_010063253.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Eucalyptus 
grandis]
Length=956

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 104/201 (52%), Gaps = 0/201 (0%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTV  207
            +++ LF  +  +S +   ++  +C    V YEGDT+  +FVV+  D  W+    G+D  V
Sbjct  756  VVLGLFLSLHAVSGIRFMIDREDCFSHDVQYEGDTVHASFVVIKSDSSWHYSQEGVDLVV  815

Query  208  TSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAK  387
              P    +        +KF+F A   G+++FCF N     ET+ F +HVGH       AK
Sbjct  816  KGPSGEQIQDFHDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFTFYDQHAK  875

Query  388  DEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALA  567
            DEH +P+  +I +L EAL ++  EQ +L+A   R    N++  +R +     E   L  A
Sbjct  876  DEHFNPLLEQIGKLEEALYNIQFEQHWLEAETERQAIVNDAMSRRAVHKAFFESAALIGA  935

Query  568  SSLQVVYIRRLFSKSVAYNRV  630
            S LQV  +RRLF + +  +RV
Sbjct  936  SVLQVYLLRRLFERKLGISRV  956



>gb|EYU27447.1| hypothetical protein MIMGU_mgv1a013853mg [Erythranthe guttata]
Length=208

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 104/205 (51%), Gaps = 2/205 (1%)
 Frame = +1

Query  16   AYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A   ++++L SF      +   ++  EC    V Y G+T+  +FVV+  +  W+    G+
Sbjct  6    AAVAVVVILCSF-GGAFGIRFVIDREECFSHKVEY-GNTVHFSFVVIKSEGSWHYSEDGV  63

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            D  V  P    +H ++  + +K +F A   G+Y+FCF N     ET+ F +H GH     
Sbjct  64   DLVVKGPNGEQIHDIRDKTSEKHEFVAYHQGVYRFCFTNKSPYHETIDFDVHAGHFLYHD  123

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   +  I   + E   
Sbjct  124  EHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEKMSRGAIHKALLESAA  183

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L LAS LQV  +RRLF + +  +RV
Sbjct  184  LVLASGLQVYVLRRLFERKLGVSRV  208



>gb|KDO50955.1| hypothetical protein CISIN_1g040712mg, partial [Citrus sinensis]
Length=179

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 95/182 (52%), Gaps = 7/182 (4%)
 Frame = +1

Query  85   NDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKF  264
            ++VEC       EGDT+  +FVVV  D  W+    G++ TVT P D  V      S   F
Sbjct  5    HNVEC-------EGDTLHCSFVVVKADNPWHYSDEGVELTVTGPSDERVRDFDRRSTATF  57

Query  265  DFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALE  444
            +F A + G+YKFCF N     ET  F IHV H       AKDEH++PI  +IA+L EAL 
Sbjct  58   EFVAYKKGLYKFCFTNKSPYHETPDFDIHVAHYAYHDQHAKDEHINPILDQIAKLEEALY  117

Query  445  SVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYN  624
             +  +Q +  A+  R    N++  +R I+  +     L  AS LQ+  ++RLF +    +
Sbjct  118  DIHFQQHWFDAQTERQSIVNKTMSRRAIYKAMLGSFFLITASFLQIHLLKRLFDRKQGLS  177

Query  625  RV  630
            RV
Sbjct  178  RV  179



>ref|XP_006586144.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Glycine max]
 gb|KHN11154.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=214

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 101/196 (52%), Gaps = 0/196 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
            +++FS +  +  +   ++  +     V YEGD +  +FVV+  D  W   H G+D +V  
Sbjct  12   VVIFSSLDAVLGIRFVIDKEDFFSHNVQYEGDRVHASFVVIKVDTSWQHTHEGVDLSVKG  71

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P    +      + + F+F A  SG Y+FCF N     ETV F +H  HI      AKDE
Sbjct  72   PSGEPIKDFHDMTSEIFEFVARNSGPYRFCFINKSPYHETVDFDVHSNHIHFTDQHAKDE  131

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            HL P+  +I +L +AL ++  EQ +L+A+  R    + +   R I   + E + L  AS+
Sbjct  132  HLTPLLDQIVKLEQALFNIQYEQHWLEAQTERQAIASNAMSSRAIHKALLESMTLMGASA  191

Query  574  LQVVYIRRLFSKSVAY  621
            LQV  +RRLF +  AY
Sbjct  192  LQVYLLRRLFERKPAY  207



>ref|XP_008229935.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
 ref|XP_008229936.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
 ref|XP_008229938.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
Length=216

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 97/188 (52%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             L   ++  EC      Y+GDTI  +FVV+  D  W++   G+D  +  P    ++ ++ 
Sbjct  29   GLRFVIDREECFSHDAKYQGDTIHVSFVVIKVDSSWHNAEDGVDLVIKGPSGEQINDIRD  88

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +KF+F   + G+++FCF N     ET+ F +H  H       AKDEH  P+  +IA+
Sbjct  89   KTSEKFEFVVQKQGVHQFCFTNKSPYHETIDFDVHAAHFTYYDQHAKDEHFTPLLEQIAK  148

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A   R    NE   +R     + E   L   S LQVV ++RLF 
Sbjct  149  LEEALFNIQFEQHWLEAETDRQAIVNEGMGRRATHKALIESGALIGVSILQVVLLKRLFE  208

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  209  RKLGSSRV  216



>ref|XP_010926811.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=211

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 99/179 (55%), Gaps = 1/179 (1%)
 Frame = +1

Query  94   ECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFK  273
            EC+ +   YEGDT+  +FVV+ ++    SD  G+D  V  P    ++ ++    +KF+F 
Sbjct  34   ECLTQSAEYEGDTVHASFVVIKYEGRDYSD-DGVDLVVRDPDGAQIYDVRNKISEKFEFV  92

Query  274  APRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVT  453
              + G ++FCF N     ET+ F + + H  +    AKDEH+DP+  +IA+L EAL+SV 
Sbjct  93   VGKKGHHRFCFTNKSPYRETIDFDVRLNHFSHIGQHAKDEHVDPLLEQIAKLEEALDSVK  152

Query  454  SEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
             EQ +L A   R    N+S  +R I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  153  FEQHWLFAYAYRQLLVNKSMSQRAIHKAIFESAALVGASVLQVYLLRRLFERKLGISRV  211



>ref|XP_007215846.1| hypothetical protein PRUPE_ppa010256mg [Prunus persica]
 gb|EMJ17045.1| hypothetical protein PRUPE_ppa010256mg [Prunus persica]
Length=257

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 97/188 (52%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             L   ++  EC      Y+GDTI  +FVV+  D  W++   G+D  +  P    ++ ++ 
Sbjct  70   GLRFVIDREECFSHDAKYQGDTIHVSFVVIKVDSSWHNTEDGVDLVIKGPSGEQINDIRD  129

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
             + +KF+F   + G+++FCF N     ET+ F +H  H       AKDEH  P+  +IA+
Sbjct  130  KTSEKFEFVVQKQGVHQFCFTNKSPYHETIDFDVHAAHFTYYDQHAKDEHFAPLLEQIAK  189

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A   R    NE   +R     + E   L   S LQVV ++RLF 
Sbjct  190  LEEALFNIQFEQHWLEAETDRQAIVNEGMSRRATHKALVESGALIGVSILQVVLLKRLFE  249

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  250  RKLGSSRV  257



>ref|XP_004303575.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Fragaria vesca subsp. vesca]
Length=209

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 0/189 (0%)
 Frame = +1

Query  64   SALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMK  243
            + L + ++  EC      YEGDT+  +FVV+  D  W+    G+D  V  P    +H ++
Sbjct  21   AGLRIVIDREECFSHDAKYEGDTVHVSFVVIKIDSSWHYTQDGVDLVVKGPSGEQLHDIR  80

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
              + +KF+F   ++G++ FCF N     ET+ F +H  H       AKDEH  P+  +I 
Sbjct  81   DKTSEKFEFVVQKAGVHHFCFTNKSPYHETIDFDVHSAHFTYYDEHAKDEHFKPLFEQIQ  140

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            +L EA+ ++  EQ +L+A   R    NE   +R     + E   L   S LQV  ++RLF
Sbjct  141  KLEEAIFNIQFEQHWLEAETDRQAILNEGMSRRATHKAMFESAALIGTSFLQVFLLKRLF  200

Query  604  SKSVAYNRV  630
             + +  +RV
Sbjct  201  ERKLGSSRV  209



>ref|XP_002300382.1| emp24/gp25L/p24 family protein [Populus trichocarpa]
 ref|XP_011038808.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Populus euphratica]
 gb|ABK92934.1| unknown [Populus trichocarpa]
 gb|EEE85187.1| emp24/gp25L/p24 family protein [Populus trichocarpa]
Length=213

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 100/188 (53%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   ++  EC    V YEGDT+  +FVVV  D  W+    G+D  V  P  + +H  + 
Sbjct  26   GIRFVIDREECFSHDVKYEGDTVHVSFVVVKVDSSWHYSDDGVDLVVKGPSGDQIHDFRD  85

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               +K +F A + G+++FCF N     ET+ F +HVGH       AKDEH  P+  +I++
Sbjct  86   KISEKIEFVAHQKGVHRFCFTNKSPYHETIDFDVHVGHFSYYDEHAKDEHFQPLLEQISK  145

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    N++  +R I     E   L  AS LQV  +RRLF 
Sbjct  146  LEEALYNIQFEQHWLEAQTDRQAIINDAMSRRTIHKAFFESAALVAASILQVYLLRRLFE  205

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  206  RKLGMSRV  213



>ref|XP_006352045.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Solanum tuberosum]
Length=207

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 102/195 (52%), Gaps = 1/195 (1%)
 Frame = +1

Query  49   FVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNS-DHPGIDFTVTSPGDN  225
            F+  +  +   ++  EC+   V  EGDTI  +FVV+  D  W+S +  G+D  +  P   
Sbjct  13   FLQGIYGIRFEIDKEECLSHNVHLEGDTIHVSFVVIQADTPWHSANKGGVDLMIKGPSGE  72

Query  226  VVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDP  405
            ++H  +  + +K++F A + G+Y+FCF N     ET+ F + V H       AK+EH DP
Sbjct  73   LIHGFRDKTSEKYEFVAYKKGIYQFCFTNKSPYHETLEFDVQVVHYTYYDQHAKNEHFDP  132

Query  406  INVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVV  585
            +  ++++L  AL ++  EQ +L+A  AR    NE   +R I   + E + L     LQV 
Sbjct  133  LLDQLSKLEAALYNIQFEQHWLEAHTARQALLNEGMSQRAITKALLESVTLVGVCFLQVF  192

Query  586  YIRRLFSKSVAYNRV  630
             ++RLF   +   RV
Sbjct  193  LLQRLFENKLQTVRV  207



>ref|XP_003552993.2| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Glycine max]
Length=196

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 101/195 (52%), Gaps = 0/195 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
            M++FS +  +  +   ++  +C    V YEGD +  +FVV+  D  W   + G+D +V  
Sbjct  1    MVIFSSLNAVLGIRFVIDREDCFSHNVQYEGDRVQASFVVIKIDTSWQYTNDGVDLSVKG  60

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P    +      + + F+F A  +G ++FCF N     ET+ F +H  H+      AKDE
Sbjct  61   PSGETIKEFHDMTSEIFEFVARDNGPHRFCFTNKSPYHETIDFDVHSNHVHFTDQHAKDE  120

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            HL P+  +I +L  AL ++  EQ +L+A+  R    + +   R +   + E + L  AS+
Sbjct  121  HLTPLLDQITKLEHALFNIQYEQHWLEAQTERQAIVSNALSSRTLHKAILESMALMGASA  180

Query  574  LQVVYIRRLFSKSVA  618
            LQV  +RRLF + +A
Sbjct  181  LQVYLLRRLFERKLA  195



>gb|KHN31673.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=207

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 101/195 (52%), Gaps = 0/195 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
            M++FS +  +  +   ++  +C    V YEGD +  +FVV+  D  W   + G+D +V  
Sbjct  12   MVIFSSLNAVLGIRFVIDREDCFSHNVQYEGDRVQASFVVIKIDTSWQYTNDGVDLSVKG  71

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P    +      + + F+F A  +G ++FCF N     ET+ F +H  H+      AKDE
Sbjct  72   PSGETIKEFHDMTSEIFEFVARDNGPHRFCFTNKSPYHETIDFDVHSNHVHFTDQHAKDE  131

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            HL P+  +I +L  AL ++  EQ +L+A+  R    + +   R +   + E + L  AS+
Sbjct  132  HLTPLLDQITKLEHALFNIQYEQHWLEAQTERQAIVSNALSSRTLHKAILESMALMGASA  191

Query  574  LQVVYIRRLFSKSVA  618
            LQV  +RRLF + +A
Sbjct  192  LQVYLLRRLFERKLA  206



>ref|XP_008362318.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Malus domestica]
Length=216

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 99/200 (50%), Gaps = 1/200 (1%)
 Frame = +1

Query  31   LMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVT  210
             ++L  F  +L  L   ++  EC      Y GDTI  +FVV+     W+    G+D  + 
Sbjct  18   FLVLCRFEGSL-GLRFVIDREECFSHDAKYMGDTIHVSFVVIKVXSTWHYTDDGVDLVIK  76

Query  211  SPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKD  390
             PG   +H ++  +  K+DF   + G+++FCF N     ET+ F +H  H       AKD
Sbjct  77   GPGGEQIHDIRDKTSVKYDFVVEKQGVHQFCFTNKSPYHETIDFDVHAAHFTYYDQHAKD  136

Query  391  EHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALAS  570
            EH  P+  +I +L EAL ++  EQ +L+A   R    NE   +R     + E   L  AS
Sbjct  137  EHFTPLLDQIQKLEEALYNIQFEQHWLEAETDRQAIVNEGMSRRATHKALIESAALIGAS  196

Query  571  SLQVVYIRRLFSKSVAYNRV  630
             LQV  ++RLF + +  +RV
Sbjct  197  CLQVFLLKRLFERKLGSSRV  216



>ref|XP_004516094.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Cicer arietinum]
Length=209

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 91/185 (49%), Gaps = 1/185 (1%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDH-DIFWNSDHPGIDFTVTSPGDNVVHSMK  243
             +   ++  EC   Y  YEGDTI  +FVV+ + D  W     G+D  V  P  + V    
Sbjct  24   GIRFVIDREECFSHYAQYEGDTIHASFVVISNTDAAWQLTQEGVDLVVKGPSGDQVQEFH  83

Query  244  GTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIA  423
              + +KF+F A   G Y+FCF N     E V F +H  H       A+DEHL P+  +I 
Sbjct  84   DKTSEKFEFVARARGPYRFCFTNKSPYREKVDFDVHSNHFSTFDQHAQDEHLVPLLEQII  143

Query  424  ELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            +L EAL ++  EQ +L+A+  R    N +   R     + E   L  AS+LQV  +RRLF
Sbjct  144  KLEEALFNIQYEQHWLEAQTERQAVVNNAMSSRAFHKALLESAALIGASTLQVYLLRRLF  203

Query  604  SKSVA  618
             + + 
Sbjct  204  ERKLG  208



>ref|XP_005839577.1| hypothetical protein GUITHDRAFT_157078 [Guillardia theta CCMP2712]
 gb|EKX52597.1| hypothetical protein GUITHDRAFT_157078 [Guillardia theta CCMP2712]
Length=146

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIPNEHN  378
            VT P +  ++S++  +  +F F +  +G Y+FCF N  ST  P+TVSF + VG    +  
Sbjct  2    VTGPDEKTIYSVQKETEGRFTFMSHETGTYRFCFGNSMSTVTPKTVSFSLLVGEDTQQAR  61

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
            +AK EH+ P+   +  L E L+ + +EQ+Y++ R+  HR+T+EST  RV+++ + E   L
Sbjct  62   VAKSEHVTPLEKSVMALAEGLQQIQTEQEYMRMRERAHRNTSESTNARVLWWALIEAGAL  121

Query  559  ALASSLQVVYIRRLFSKSVAYNR  627
             L S +Q+VY+R  F    A NR
Sbjct  122  LLMSVIQIVYLRNFFENKRASNR  144



>ref|XP_007049384.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOX93541.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2, partial 
[Theobroma cacao]
Length=203

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 100/188 (53%), Gaps = 1/188 (1%)
 Frame = +1

Query  22   ALLLMMLFSF-VTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            A + M LF + +     +   ++  EC+     YEGDT+  +FVV+  D  W+    GID
Sbjct  13   AWIAMGLFLWSLKGTQGVRFVIDREECLSHDAKYEGDTLHVSFVVIKADSPWHFSDEGID  72

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  378
              +  P    +H  +  + +K++F   + G+Y+FCF+N     ET+ F + + H   +  
Sbjct  73   LVIRGPSGEQIHDFRDKTSEKYEFVVQQKGVYRFCFYNKSPYHETIDFDVKLAHFAYQEQ  132

Query  379  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  558
             AKDEH+ P+  +I++L EAL ++  EQ +++A+  R    N+S  +R I   + E   L
Sbjct  133  HAKDEHIAPLLEQISKLEEALYNIQFEQHWIEAQTDRQAIVNDSMGRRAIHKAMLESAAL  192

Query  559  ALASSLQV  582
              AS+LQV
Sbjct  193  IGASTLQV  200



>gb|ABG66965.1| LRR resistance protein-like protein [Gossypium arboreum]
Length=60

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  451  TSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  630
            T+EQKYLKARD RHRHTNESTRKRVI YTVGEYILL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  1    TAEQKYLKARDTRHRHTNESTRKRVIGYTVGEYILLTLVSALQVIYIRQLFSKSVAYNRV  60



>gb|AIA25722.1| coated vesicle membrane protein, partial [Phyllostachys edulis]
Length=103

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
            ALSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N VH+++G
Sbjct  42   ALSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVHTLRG  101

Query  247  TS  252
             S
Sbjct  102  KS  103



>ref|XP_007146652.1| hypothetical protein PHAVU_006G058200g [Phaseolus vulgaris]
 gb|ESW18646.1| hypothetical protein PHAVU_006G058200g [Phaseolus vulgaris]
Length=207

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 98/194 (51%), Gaps = 0/194 (0%)
 Frame = +1

Query  34   MMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTS  213
            +++FS +  +  +   ++  +C   +V YEGD +  +FVV+  D  W   + G+D  V  
Sbjct  12   LVIFSSLNAVLGIRFVIDRHDCFSHFVEYEGDKVHASFVVIKIDTSWQYTNDGVDLEVRG  71

Query  214  PGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDE  393
            P    +      + + F+F A  SG Y+FCF N     ET+ F IH  H+      AKDE
Sbjct  72   PSGEPIRDFVDMASEIFEFVARSSGPYRFCFTNRSPYHETIDFDIHADHVDFSEQHAKDE  131

Query  394  HLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASS  573
            H+ P+  +I +L  AL ++  EQ +L+A+  R    + +   R I   + E   L  AS 
Sbjct  132  HVTPLLEQIVKLEHALFNIQYEQHWLEAQTERQAIVSSAMSTRTIHKALLESAALMGASF  191

Query  574  LQVVYIRRLFSKSV  615
            LQV  +RRLF + +
Sbjct  192  LQVYLLRRLFERKL  205



>ref|XP_011095564.1| PREDICTED: cellulose synthase-like protein E6 [Sesamum indicum]
Length=934

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 1/203 (0%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            AL ++++ S       +   ++  EC    V Y G+T+  +FVV+  +  W+    G+D 
Sbjct  733  ALAVIVVLSSFGGAFGIRFVIDREECFSHKVEY-GNTVHFSFVVIKSEGSWHYSDDGVDL  791

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H ++  + DK +F A + G+Y+FCF N     ET+ F +H GH       
Sbjct  792  VVKGPNGEQIHDIRDKTSDKHEFVAYQQGVYRFCFTNKSPYHETLDFDVHAGHFLYHDEH  851

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   +  I   + E   L 
Sbjct  852  AKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEKMSRGAIHKALFESAALI  911

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
            LAS LQV  +RRLF + +  +RV
Sbjct  912  LASGLQVYILRRLFERKLGASRV  934



>ref|XP_002532207.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF30176.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=211

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 104/208 (50%), Gaps = 0/208 (0%)
 Frame = +1

Query  7    GIRAYALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDH  186
            G+    +++M           +   +N  ECV   V  +GDT+  +FV++  +   +   
Sbjct  4    GVVRCIVIMMTTTMLWKGTCGIRFVINKEECVSHKVESQGDTLHISFVLIKAESPSHVAD  63

Query  187  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  366
             G+D  +  P    +H +   + +K++F   + G+Y+FCF N      T+ F +H+GH  
Sbjct  64   KGVDLLIKGPSGEKLHDLHDKTSEKYEFVVYKKGLYQFCFTNKSPFLITIDFDVHLGHFT  123

Query  367  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
                 AKDEH  P+  +I+ L+EAL ++  EQ +L+A   R    N++  +R +   + E
Sbjct  124  YHDQHAKDEHFAPLLKQISRLQEALYNIQFEQHWLEAETDRQAIVNDNMSRRALHKAMLE  183

Query  547  YILLALASSLQVVYIRRLFSKSVAYNRV  630
               L  AS LQ+  +RRLF + +  +RV
Sbjct  184  SAALVGASVLQMYLMRRLFDRKLGISRV  211



>gb|AIA25723.1| coated vesicle membrane protein, partial [Phyllostachys nigra 
var. henonis]
Length=103

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  70   LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGT  249
            LSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N VH+++G 
Sbjct  43   LSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVHTLRGK  102

Query  250  S  252
            S
Sbjct  103  S  103



>gb|AIA25724.1| coated vesicle membrane protein, partial [Fargesia nitida]
Length=103

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  70   LSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGT  249
            LSVTV D EC++E+V YEGDT+SGNFVVVDHDIFW+SDHPGID TVTSPG N VH+++G 
Sbjct  43   LSVTVTDTECIHEFVPYEGDTVSGNFVVVDHDIFWSSDHPGIDLTVTSPGGNTVHTLRGK  102

Query  250  S  252
            S
Sbjct  103  S  103



>ref|XP_009793108.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Nicotiana sylvestris]
Length=212

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 101/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVT-VNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            +L+ +L    ++  AL +  V D E  + + +  G+T+  +FVV+  +  W+    G+D 
Sbjct  10   ILIALLVVAWSSRGALGIRFVIDREECFSHKVEMGETVHFSFVVIKSEGSWHYSEEGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H  H       
Sbjct  70   VVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLHAAHFVYHDEH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L 
Sbjct  130  AKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKALFESSALI  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQV  ++ LF + +  +RV
Sbjct  190  CVSILQVFLLKHLFERKLGQSRV  212



>ref|XP_010313948.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Solanum lycopersicum]
Length=215

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 95/188 (51%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   +   EC + + +  G+T+  +FVV+  +  W+ ++ G+D  V  P    +H ++ 
Sbjct  29   GIRFVIEKEEC-FSHKVEMGETVHYSFVVIKSEGDWHHNNDGVDLVVKGPSGEQIHDLRD  87

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               +K +F +   G+Y+FCF N     ET+ F +H  H       AKDEH  P+   I +
Sbjct  88   KISEKSEFTSHHEGIYRFCFTNKSPYHETIDFDLHAAHFVYHDEHAKDEHFKPLFEHIGK  147

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL S+  EQ +L+A+  R    NE   KR ++  + E   L   S LQV  ++ LF 
Sbjct  148  LEEALYSIQFEQHWLEAQTDRQAIVNEGMSKRAMYKALFESSALICVSFLQVFLLKHLFE  207

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  208  RKLGQSRV  215



>ref|XP_009606341.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Nicotiana tomentosiformis]
Length=212

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 101/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVT-VNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            +L+ +L    ++  AL +  V D E  + + +  G+++  +FVV+  +  W+    G+D 
Sbjct  10   ILISLLVVAWSSRGALGIRFVIDREECFSHKVEMGESVHFSFVVIKSEGSWHYSEEGVDL  69

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H  H       
Sbjct  70   VVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLHAAHFVYHDEH  129

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L 
Sbjct  130  AKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKALFESSALI  189

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQV  ++ LF + +  +RV
Sbjct  190  CVSVLQVFLLKHLFERKLGQSRV  212



>ref|XP_002676871.1| predicted protein [Naegleria gruberi]
 gb|EFC44127.1| predicted protein [Naegleria gruberi]
Length=197

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 105/198 (53%), Gaps = 12/198 (6%)
 Frame = +1

Query  22   ALLLMMLFSFVTNLSALSVTVNDVE--CVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGI  195
            A LL+++   + + +AL+ T++  E  C++E  L +   +S  + V+            I
Sbjct  2    ATLLIIVSILIQHTNALTYTLDPAEERCLFE-TLDKPSKLSLKYQVIKGGFL------DI  54

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIPN  369
            D  V  P   ++H  +  S  KF   A + G YKFCF N  ST  P+TVSF+I +G   +
Sbjct  55   DLVVFDPDGEILHQQERESEGKFSINADKKGTYKFCFSNKISTLTPKTVSFHISIGDFVD  114

Query  370  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  549
              N+AK EHL P+   I +L E L  + +EQ+  +AR+A HR+  E+T +RV +Y +   
Sbjct  115  T-NIAKLEHLSPVEQTIQKLSEGLSHIQNEQQEFRAREATHRNICEATNERVTYYNLFSI  173

Query  550  ILLALASSLQVVYIRRLF  603
             LL   S +Q+  +R  F
Sbjct  174  FLLVCLSGVQIYVLRMWF  191



>ref|XP_006344897.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006344898.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Solanum tuberosum]
Length=215

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 94/188 (50%), Gaps = 1/188 (1%)
 Frame = +1

Query  67   ALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKG  246
             +   +   EC + + +  G+T+  +FVV+  +  W+  + G+D  V  P    +H ++ 
Sbjct  29   GIRFVIEKEEC-FSHKVEMGETVHYSFVVIKSEGDWHHSNDGVDLVVKGPSGEQIHDLRD  87

Query  247  TSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAE  426
               +K +F +   G+Y+FCF N     ET+ F +H  H       AKDEH  P+   I +
Sbjct  88   KISEKSEFTSHHEGIYRFCFTNKSPYHETIDFDLHAAHFVYHDEHAKDEHFKPLFEHIGK  147

Query  427  LREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFS  606
            L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L   S LQV  ++ LF 
Sbjct  148  LEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAMYKALFESSALICVSFLQVFLLKHLFE  207

Query  607  KSVAYNRV  630
            + +  +RV
Sbjct  208  RKLGQSRV  215



>ref|XP_009624028.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana tomentosiformis]
Length=210

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 103/202 (51%), Gaps = 4/202 (2%)
 Frame = +1

Query  28   LLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWN-SDHPGIDFT  204
            +L++ +SF      +   +   EC + + +  G+T+  +FVV+  D  W+ S+  G+D  
Sbjct  12   VLVVAWSF-NGAFGIRFVIEKEEC-FSHKVEMGETVHYSFVVIKSDGSWHYSEEEGVDLV  69

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P    +H ++    +K +F A   G+Y+FCF N     ETV F +H  H       A
Sbjct  70   VKGPSGEQIHDLRDKISEKSEFVAHHEGIYRFCFTNKSPYHETVDFDLHAAHFVYHDEHA  129

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L  
Sbjct  130  KDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKALFESSALIC  189

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
             S LQ V+++ LF + +  +RV
Sbjct  190  VSFLQ-VFLKNLFERKLGQSRV  210



>dbj|BAM20109.1| transmembrane emp24 domain-containing protein [Papilio xuthus]
Length=207

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 106/199 (53%), Gaps = 12/199 (6%)
 Frame = +1

Query  19   YALLLMMLFSFVTNLSALSVTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            Y+++++ L +   N   ++V  +  EC YE V  E DT  G    +    F +     ID
Sbjct  11   YSVVIITLLNRA-NGYTITVDAHAEECFYENV--EADTKMGLTFEIAEGGFLD-----ID  62

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIPNE  372
             T+T P   V+H  +  S   + F AP SG Y +CF N  ST  P+ V F + +G  PN+
Sbjct  63   ITITGPDGAVIHKGERESSGIYTFSAPTSGRYTYCFSNKMSTMTPKVVMFNLEIGEAPNK  122

Query  373  HNLAKDEHLDPINVK--IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  546
            +    DE  +  N++  I EL   L++V +EQ+Y++ RD  HR  NEST  RV+ +++ E
Sbjct  123  NAGDNDEEANHNNLENMIKELGATLKTVKNEQEYMQVRDRIHRAINESTNSRVVMWSIFE  182

Query  547  YILLALASSLQVVYIRRLF  603
              +L + +  QV Y++R F
Sbjct  183  ASVLLVMTLGQVYYLKRFF  201



>ref|XP_006452612.1| hypothetical protein CICLE_v100094662mg, partial [Citrus clementina]
 gb|ESR65852.1| hypothetical protein CICLE_v100094662mg, partial [Citrus clementina]
 gb|KDO59138.1| hypothetical protein CISIN_1g0281952mg, partial [Citrus sinensis]
Length=142

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = +1

Query  205  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  384
            V  P  + +H  +    +KF+F A   G+++FCF N     ET+ F +HVGH       A
Sbjct  1    VKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFSYYDEHA  60

Query  385  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  564
            KDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R ++    E   L  
Sbjct  61   KDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAVYKAFWESTALVG  120

Query  565  ASSLQVVYIRRLFSKSVAYNRV  630
            AS LQV  +RRLF + +  +RV
Sbjct  121  ASVLQVYLLRRLFERKLGMSRV  142



>ref|XP_009590973.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nicotiana tomentosiformis]
Length=189

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 80/145 (55%), Gaps = 0/145 (0%)
 Frame = +1

Query  196  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  375
            ++ +  P    VH  +  + + ++F A R G+Y+FCF N     E + F +HV H  + +
Sbjct  45   NYQIKGPSGEPVHEFRDKTSEMYEFMAQRKGIYQFCFTNKSPYHEYMDFDLHVSHFTHCN  104

Query  376  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  555
              AKDEH DP+  +I++L  AL+ +  EQ +L+A+  R    NE   +R +   + E I 
Sbjct  105  QPAKDEHFDPLLEQISKLEAALQKIQVEQHWLEAQTERQASVNEGMGRRAMAKAIVESIA  164

Query  556  LALASSLQVVYIRRLFSKSVAYNRV  630
            L L S LQ   +RRLF K ++ +RV
Sbjct  165  LFLVSELQSFLLRRLFEKKLSSSRV  189



>ref|XP_009793109.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Nicotiana 
sylvestris]
Length=927

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 101/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVT-VNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            +L+ +L    ++  AL +  V D E  + + +  G+T+  +FVV+  +  W+    G+D 
Sbjct  725  ILIALLVVAWSSRGALGIRFVIDREECFSHKVEMGETVHFSFVVIKSEGSWHYSEEGVDL  784

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H  H       
Sbjct  785  VVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLHAAHFVYHDEH  844

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L 
Sbjct  845  AKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKALFESSALI  904

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQV  ++ LF + +  +RV
Sbjct  905  CVSILQVFLLKHLFERKLGQSRV  927



>dbj|GAM18347.1| hypothetical protein SAMD00019534_015220, partial [Acytostelium 
subglobosum LB1]
Length=209

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 99/197 (50%), Gaps = 11/197 (6%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALS--VTVNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGID  198
            ++L+M+ S  T   A S  V     EC+YE +      +  +F V+            ID
Sbjct  14   IVLLMIVSLTTPGQAFSFKVPAKIEECIYEEL-----PLDASFTVMFQVT--QGGFNDID  66

Query  199  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYS--TPETVSFYIHVGHIPNE  372
            FT+ SP   +++  +  S      KA   G+Y FCF N  S  T +TVSF + VG     
Sbjct  67   FTIISPDSRILYKGERESEGTKVMKASMEGLYSFCFSNQMSSLTEKTVSFMVVVGERSQM  126

Query  373  HNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYI  552
             +LAK   + P+  +I +L + ++++ +EQ  LK R+  HR+T EST  RV ++   E +
Sbjct  127  ADLAKKGDITPLERQIVQLADGVQAILNEQNNLKMREITHRNTAESTNSRVTWWAFFEAV  186

Query  553  LLALASSLQVVYIRRLF  603
            LL   S  Q+ Y+RR F
Sbjct  187  LLVTMSLWQIYYLRRFF  203



>ref|XP_009606342.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Nicotiana 
tomentosiformis]
Length=924

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 101/203 (50%), Gaps = 1/203 (0%)
 Frame = +1

Query  25   LLLMMLFSFVTNLSALSVT-VNDVECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDF  201
            +L+ +L    ++  AL +  V D E  + + +  G+++  +FVV+  +  W+    G+D 
Sbjct  722  ILISLLVVAWSSRGALGIRFVIDREECFSHKVEMGESVHFSFVVIKSEGSWHYSEEGVDL  781

Query  202  TVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNL  381
             V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H  H       
Sbjct  782  VVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLHAAHFVYHDEH  841

Query  382  AKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLA  561
            AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  + E   L 
Sbjct  842  AKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKALFESSALI  901

Query  562  LASSLQVVYIRRLFSKSVAYNRV  630
              S LQV  ++ LF + +  +RV
Sbjct  902  CVSVLQVFLLKHLFERKLGQSRV  924



>ref|XP_636960.1| hypothetical protein DDB_G0288053 [Dictyostelium discoideum AX4]
 sp|Q769F9.1|TMEDA_DICDI RecName: Full=Transmembrane emp24 domain-containing protein A; 
Flags: Precursor [Dictyostelium discoideum]
 dbj|BAD05160.1| emp24/gp25L/p24 family protein [Dictyostelium discoideum]
 gb|EAL63452.1| hypothetical protein DDB_G0288053 [Dictyostelium discoideum AX4]
Length=205

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 91/172 (53%), Gaps = 9/172 (5%)
 Frame = +1

Query  94   ECVYEYVLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFK  273
            EC+YE +  +  + +  F V+            IDFT+ SP   +V+S +  S      +
Sbjct  35   ECIYEEIGVDL-SFTAMFQVI------QGGFNDIDFTIISPDKRIVYSGQRESEGTKTLR  87

Query  274  APRSGMYKFCFHNPYS--TPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALES  447
            +  +G+Y FCF N  S  T +TVSF + VG       +AK + L PI   I  L + + +
Sbjct  88   SSFAGVYSFCFSNKMSSLTDKTVSFILSVGESSPIREIAKKKDLTPIERSIMTLSDGVIA  147

Query  448  VTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLF  603
            V +EQ Y K R+A HR+T EST  RV++++V E  +L   S  Q+ Y+RR F
Sbjct  148  VKNEQNYFKMREAAHRNTAESTNSRVLWWSVFEAFVLIALSIWQIYYLRRFF  199



>emb|CDP20746.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  FDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREAL  441
            F+F AP+ G+Y+FCF N     ETV F +HVGH P     AKDEH +P+  +I++L EAL
Sbjct  52   FEFMAPKKGLYRFCFTNRSPYHETVDFDVHVGHFPYYEQHAKDEHFNPLLEQISKLEEAL  111

Query  442  ESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAY  621
             ++  EQ +L+A+  R    NE+  K+ +   + E I L   S LQV  ++RLF + +  
Sbjct  112  YNIQFEQHWLEAQTDRQALVNENMSKKAVHKALLESIALIGTSVLQVYLLQRLFERKLGT  171

Query  622  NRV  630
            +RV
Sbjct  172  SRV  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380