BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF020A10

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621605.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    401   9e-133   Nicotiana tomentosiformis
ref|XP_011100229.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    398   1e-131   Sesamum indicum [beniseed]
emb|CDP15892.1|  unnamed protein product                                398   2e-131   Coffea canephora [robusta coffee]
ref|XP_009783429.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    398   2e-131   Nicotiana sylvestris
ref|XP_002278663.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    396   1e-130   Vitis vinifera
gb|AFQ93695.1|  acyl-CoA oxidase 3                                      395   2e-130   Prunus persica
ref|XP_008244854.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    393   7e-130   Prunus mume [ume]
ref|XP_011466939.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    390   2e-129   Fragaria vesca subsp. vesca
ref|XP_010093490.1|  Acyl-coenzyme A oxidase 3                          392   3e-129   
ref|XP_009621600.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    391   1e-128   Nicotiana tomentosiformis
ref|XP_004303096.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    390   1e-128   Fragaria vesca subsp. vesca
ref|NP_001280826.1|  acyl-coenzyme A oxidase 3, peroxisomal-like        390   2e-128   Malus domestica [apple tree]
ref|XP_009621612.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    389   4e-128   Nicotiana tomentosiformis
ref|XP_009783428.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    389   5e-128   Nicotiana sylvestris
ref|XP_010279215.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    389   6e-128   Nelumbo nucifera [Indian lotus]
gb|KDO45758.1|  hypothetical protein CISIN_1g011790mg                   382   9e-128   Citrus sinensis [apfelsine]
gb|AAF80226.1|AC025290_15  Contains similarity to an acyl-coenzym...    375   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364109.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    388   1e-127   Solanum tuberosum [potatoes]
ref|XP_009354288.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    386   5e-127   Pyrus x bretschneideri [bai li]
ref|XP_006446734.1|  hypothetical protein CICLE_v10014502mg             386   6e-127   Citrus clementina [clementine]
ref|XP_006469060.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    384   3e-126   Citrus sinensis [apfelsine]
ref|XP_007043726.1|  Acyl-CoA oxidase 3 isoform 2                       384   6e-126   
ref|XP_007043727.1|  Acyl-CoA oxidase 3 isoform 3                       382   6e-126   
ref|XP_010522108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    384   7e-126   Tarenaya hassleriana [spider flower]
ref|XP_007043725.1|  Acyl-CoA oxidase 3 isoform 1                       384   9e-126   
ref|XP_004248185.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   2e-125   Solanum lycopersicum
ref|XP_006364108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   2e-125   Solanum tuberosum [potatoes]
ref|XP_009783430.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   2e-125   Nicotiana sylvestris
ref|XP_006306351.1|  hypothetical protein CARUB_v10012245mg             382   3e-125   Capsella rubella
ref|XP_006417937.1|  hypothetical protein EUTSA_v10006988mg             382   3e-125   Eutrema salsugineum [saltwater cress]
ref|XP_004248184.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    382   4e-125   Solanum lycopersicum
emb|CDY10192.1|  BnaC05g04350D                                          381   5e-125   Brassica napus [oilseed rape]
ref|XP_009119069.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    381   5e-125   Brassica rapa
gb|AAF73843.1|AF207994_1  acyl-CoA oxidase ACX3                         381   6e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172119.1|  acyl-coenzyme A oxidase 3                             381   7e-125   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42952.1|  hypothetical protein AALP_AA1G060500                    380   8e-125   Arabis alpina [alpine rockcress]
gb|KJB12480.1|  hypothetical protein B456_002G020600                    375   5e-124   Gossypium raimondii
ref|XP_003527400.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    379   6e-124   Glycine max [soybeans]
ref|XP_003607535.1|  Acyl-coenzyme A oxidase 3, peroxisomal             378   1e-123   Medicago truncatula
ref|XP_004505527.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    377   2e-123   Cicer arietinum [garbanzo]
ref|XP_008455941.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    377   2e-123   Cucumis melo [Oriental melon]
ref|XP_002889597.1|  acyl-CoA oxidase ACX3                              376   6e-123   
ref|XP_011013714.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    374   9e-123   Populus euphratica
ref|XP_004151905.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    375   1e-122   Cucumis sativus [cucumbers]
ref|XP_004171897.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    375   1e-122   
gb|KDP31760.1|  hypothetical protein JCGZ_12221                         375   2e-122   Jatropha curcas
gb|KJB12478.1|  hypothetical protein B456_002G020600                    375   3e-122   Gossypium raimondii
ref|XP_006376402.1|  acyl-CoA oxidase family protein                    374   4e-122   
ref|XP_011013710.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    374   5e-122   Populus euphratica
ref|XP_010457756.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    372   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_003539950.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    371   4e-121   Glycine max [soybeans]
ref|XP_010475360.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    371   5e-121   Camelina sativa [gold-of-pleasure]
gb|KJB12486.1|  hypothetical protein B456_002G020700                    370   7e-121   Gossypium raimondii
gb|KHG26832.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    370   7e-121   Gossypium arboreum [tree cotton]
gb|EYU29818.1|  hypothetical protein MIMGU_mgv1a002427mg                370   8e-121   Erythranthe guttata [common monkey flower]
gb|KJB50144.1|  hypothetical protein B456_008G155500                    370   1e-120   Gossypium raimondii
ref|XP_007132685.1|  hypothetical protein PHAVU_011G116000g             368   8e-120   Phaseolus vulgaris [French bean]
ref|XP_010035824.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    367   2e-119   Eucalyptus grandis [rose gum]
ref|XP_006852548.1|  hypothetical protein AMTR_s00021p00193270          367   2e-119   Amborella trichopoda
dbj|BAK06462.1|  predicted protein                                      357   7e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011002667.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    365   8e-119   Populus euphratica
ref|XP_002325591.1|  acyl-CoA oxidase family protein                    363   6e-118   
ref|XP_002889598.1|  acyl-CoA oxidase 6                                 363   8e-118   Arabidopsis lyrata subsp. lyrata
ref|NP_172120.2|  putative acyl-CoA oxidase                             362   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KCW47289.1|  hypothetical protein EUGRSUZ_K01080                     361   3e-117   Eucalyptus grandis [rose gum]
emb|CDY10194.1|  BnaC05g04370D                                          359   2e-116   Brassica napus [oilseed rape]
emb|CDY57822.1|  BnaA10g28090D                                          357   9e-116   Brassica napus [oilseed rape]
gb|KHG11955.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    357   1e-115   Gossypium arboreum [tree cotton]
gb|KHN07770.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  353   1e-114   Glycine soja [wild soybean]
ref|XP_009119067.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    354   1e-114   Brassica rapa
ref|XP_010485961.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    352   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010689758.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    353   6e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008784451.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    351   3e-113   Phoenix dactylifera
ref|XP_002525155.1|  acyl-CoA oxidase, putative                         349   3e-113   
ref|XP_010916040.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    352   7e-113   Elaeis guineensis
ref|XP_006417936.1|  hypothetical protein EUTSA_v10009440mg             346   9e-112   
gb|KHG13766.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    347   1e-111   Gossypium arboreum [tree cotton]
ref|XP_009388733.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    345   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001057591.1|  Os06g0354500                                       345   4e-111   
gb|KJB31620.1|  hypothetical protein B456_005G198300                    345   6e-111   Gossypium raimondii
ref|XP_010689760.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    345   8e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006656066.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    343   2e-110   
ref|XP_003573815.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    343   5e-110   Brachypodium distachyon [annual false brome]
ref|XP_010689759.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    340   4e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004965421.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    340   9e-109   Setaria italica
ref|XP_009405080.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    335   6e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006592447.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    325   2e-104   
ref|XP_002456627.1|  hypothetical protein SORBIDRAFT_03g039670          325   5e-103   Sorghum bicolor [broomcorn]
gb|AGT17248.1|  acyl-coenzyme A oxidase                                 324   6e-103   Saccharum hybrid cultivar R570
ref|NP_001152024.1|  acyl-coenzyme A oxidase 2                          321   9e-102   Zea mays [maize]
tpg|DAA56859.1|  TPA: putative acyl-CoA oxidase family protein          321   9e-102   
gb|ACN41105.1|  unknown                                                 320   2e-101   Picea sitchensis
gb|EAZ00875.1|  hypothetical protein OsI_22900                          320   5e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_002994091.1|  hypothetical protein SELMODRAFT_187751             318   1e-100   
ref|XP_002985513.1|  hypothetical protein SELMODRAFT_122536             318   1e-100   
gb|EAZ36947.1|  hypothetical protein OsJ_21282                          317   3e-100   Oryza sativa Japonica Group [Japonica rice]
gb|KJB60308.1|  hypothetical protein B456_009G299600                    279   8e-91    Gossypium raimondii
ref|XP_001759376.1|  predicted protein                                  291   2e-90    
ref|XP_001772379.1|  predicted protein                                  291   2e-90    
gb|EPS62711.1|  hypothetical protein M569_12075                         255   6e-82    Genlisea aurea
emb|CBI21935.3|  unnamed protein product                                244   3e-73    Vitis vinifera
ref|XP_007213791.1|  hypothetical protein PRUPE_ppa002439m2g            202   7e-58    
ref|XP_007213790.1|  hypothetical protein PRUPE_ppa002439m1g            191   1e-57    
gb|EMT28672.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  198   9e-56    
ref|XP_011037432.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    186   8e-52    Populus euphratica
ref|XP_005707013.1|  acyl-CoA oxidase isoform 1                         187   1e-51    Galdieria sulphuraria
gb|KHG14872.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    174   7e-51    Gossypium arboreum [tree cotton]
gb|KJB50145.1|  hypothetical protein B456_008G155500                    177   3e-48    Gossypium raimondii
ref|XP_005703885.1|  acyl-CoA oxidase                                   174   1e-46    Galdieria sulphuraria
ref|XP_005716306.1|  acyl-CoA oxidase                                   172   5e-46    Chondrus crispus [carageen]
ref|XP_004365565.1|  acyl-coenzyme A oxidase 3                          172   8e-46    Capsaspora owczarzaki ATCC 30864
ref|XP_010457758.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    161   2e-45    
ref|XP_005712968.1|  acyl-CoA oxidase                                   167   4e-44    Chondrus crispus [carageen]
ref|XP_005536533.1|  acyl-CoA oxidase ACX3                              167   6e-44    Cyanidioschyzon merolae strain 10D
ref|XP_005712270.1|  acyl-CoA oxidase                                   166   9e-44    Chondrus crispus [carageen]
ref|XP_005712269.1|  unnamed protein product                            164   5e-43    Chondrus crispus [carageen]
gb|EEE65671.1|  hypothetical protein OsJ_21283                          155   6e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004363191.1|  putative acyl-CoA oxidase                          163   8e-43    Cavenderia fasciculata
ref|XP_636605.1|  hypothetical protein DDB_G0288735                     160   5e-42    Dictyostelium discoideum AX4
gb|EFA75614.1|  putative acyl-CoA oxidase                               160   6e-42    Heterostelium album PN500
ref|XP_003293845.1|  hypothetical protein DICPUDRAFT_158763             160   7e-42    Dictyostelium purpureum
gb|EEC80572.1|  hypothetical protein OsI_22901                          152   8e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_005649112.1|  acyl-CoA oxidase                                   158   5e-41    Coccomyxa subellipsoidea C-169
dbj|GAM28721.1|  hypothetical protein SAMD00019534_118970               158   5e-41    Acytostelium subglobosum LB1
gb|EMS62186.1|  hypothetical protein TRIUR3_06747                       151   6e-41    Triticum urartu
gb|KIY97857.1|  acyl-CoA oxidase                                        149   1e-40    Monoraphidium neglectum
gb|EMT28673.1|  hypothetical protein F775_14360                         144   1e-39    
ref|XP_009061608.1|  hypothetical protein LOTGIDRAFT_127454             150   2e-38    Lottia gigantea
gb|EFA78930.1|  acyl-CoA oxidase                                        149   5e-38    Heterostelium album PN500
ref|XP_003288089.1|  hypothetical protein DICPUDRAFT_152296             148   1e-37    Dictyostelium purpureum
ref|WP_043324301.1|  acyl-CoA oxidase                                   149   2e-37    
gb|AFE09438.1|  putative acyl-CoA dehydrogenase                         149   3e-37    Corallococcus coralloides DSM 2259
ref|WP_043394213.1|  acyl-CoA oxidase                                   148   5e-37    Archangium violaceum
gb|EFA80269.1|  hypothetical protein PPL_07095                          150   6e-37    Heterostelium album PN500
ref|XP_002159574.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    146   6e-37    Hydra vulgaris
gb|EMS62187.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  140   7e-37    Triticum urartu
gb|ELT92145.1|  hypothetical protein CAPTEDRAFT_182867                  145   2e-36    Capitella teleta
ref|XP_002950277.1|  hypothetical protein VOLCADRAFT_104659             145   2e-36    Volvox carteri f. nagariensis
ref|WP_013937938.1|  acyl-CoA dehydrogenase                             145   5e-36    Myxococcus macrosporus
ref|WP_015352554.1|  acyl-CoA dehydrogenase                             145   7e-36    Myxococcus stipitatus
ref|XP_003288045.1|  hypothetical protein DICPUDRAFT_78883              143   9e-36    Dictyostelium purpureum
ref|WP_011404446.1|  acyl-CoA oxidase                                   144   1e-35    Salinibacter ruber
ref|WP_013062161.1|  acyl-CoA oxidase                                   144   1e-35    Salinibacter ruber
ref|XP_002677851.1|  acyl-coenzyme A oxidase                            144   1e-35    Naegleria gruberi strain NEG-M
ref|WP_044187894.1|  acyl-CoA oxidase                                   144   1e-35    Hyalangium minutum
ref|WP_002637005.1|  acyl-CoA dehydrogenase                             143   2e-35    Myxococcus hansupus
ref|XP_003294150.1|  hypothetical protein DICPUDRAFT_58874              142   2e-35    Dictyostelium purpureum
ref|XP_643323.1|  acyl-CoA oxidase                                      141   3e-35    Dictyostelium discoideum AX4
ref|XP_002128280.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    141   5e-35    Ciona intestinalis [sea vase]
ref|XP_003287521.1|  hypothetical protein DICPUDRAFT_97730              141   7e-35    Dictyostelium purpureum
ref|WP_007237397.1|  acyl-CoA oxidase                                   141   7e-35    
dbj|GAM20274.1|  hypothetical protein SAMD00019534_034490               140   8e-35    Acytostelium subglobosum LB1
ref|XP_002672633.1|  peroxisomal acyl-CoA oxidase                       139   1e-34    Naegleria gruberi strain NEG-M
gb|EFA78532.1|  putative acyl-CoA oxidase                               140   2e-34    Heterostelium album PN500
ref|XP_004360048.1|  acyl-CoA oxidase                                   142   2e-34    Cavenderia fasciculata
emb|CCO32276.1|  hypothetical protein BN14_06332                        138   2e-34    Rhizoctonia solani AG-1 IB
gb|ELU16781.1|  hypothetical protein CAPTEDRAFT_177414                  139   2e-34    Capitella teleta
ref|WP_030226700.1|  acyl-CoA oxidase                                   139   2e-34    Streptomyces lavendulae
ref|WP_033400952.1|  acyl-CoA oxidase                                   139   2e-34    
gb|ABF87186.1|  putative acyl-CoA dehydrogenase                         139   3e-34    Myxococcus xanthus DK 1622
ref|XP_001732973.1|  acyl-CoA oxidase                                   138   4e-34    Dictyostelium discoideum AX4
ref|WP_020478009.1|  acyl-CoA dehydrogenase                             140   4e-34    Myxococcus xanthus
ref|XP_642669.1|  acyl-CoA oxidase                                      138   4e-34    Dictyostelium discoideum AX4
emb|CEL63350.1|  hypothetical protein RSOLAG1IB_05394                   138   6e-34    Rhizoctonia solani AG-1 IB
ref|XP_004339964.1|  acylCoA dehydrogenase, middle domain contain...    139   6e-34    Acanthamoeba castellanii str. Neff
ref|XP_004350494.1|  hypothetical protein DFA_11547                     140   6e-34    Cavenderia fasciculata
ref|XP_007537568.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    135   8e-34    Erinaceus europaeus [common hedgehog]
ref|XP_001639738.1|  predicted protein                                  137   8e-34    Nematostella vectensis
dbj|GAM18567.1|  hypothetical protein SAMD00019534_017420               138   8e-34    Acytostelium subglobosum LB1
ref|XP_005843308.1|  hypothetical protein CHLNCDRAFT_59273              137   1e-33    Chlorella variabilis
ref|WP_010639493.1|  acyl-CoA oxidase                                   137   1e-33    
ref|WP_030389344.1|  acyl-CoA oxidase                                   137   1e-33    Streptomyces sp. NRRL S-241
gb|EUC54225.1|  acyl-coenzyme A oxidase 3, peroxisomal protein          137   1e-33    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_004354454.1|  acyl-CoA oxidase                                   136   1e-33    Cavenderia fasciculata
ref|WP_031177408.1|  acyl-CoA oxidase                                   137   1e-33    Streptomyces
ref|XP_002166799.2|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    137   1e-33    Hydra vulgaris
ref|WP_003946657.1|  MULTISPECIES: acyl-CoA oxidase                     137   1e-33    Streptomyces
ref|WP_018894104.1|  acyl-CoA oxidase                                   137   1e-33    Streptomyces sp. CNY228
ref|WP_033238735.1|  acyl-CoA oxidase                                   137   1e-33    Streptomyces griseus
ref|WP_018471012.1|  acyl-CoA oxidase                                   137   2e-33    Streptomyces
gb|KEP51916.1|  acyl-coenzyme A oxidase 3, peroxisomal protein          137   2e-33    Rhizoctonia solani 123E
gb|EFA77956.1|  acyl-CoA oxidase                                        136   2e-33    Heterostelium album PN500
ref|WP_015360696.1|  acyl-CoA oxidase domain-containing protein         137   3e-33    Nonlabens dokdonensis
ref|XP_006500336.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    136   3e-33    Mus musculus [mouse]
ref|XP_639137.1|  acyl-CoA oxidase                                      136   3e-33    Dictyostelium discoideum AX4
ref|XP_002991925.1|  hypothetical protein SELMODRAFT_134372             136   3e-33    
ref|WP_016696079.1|  hypothetical protein                               132   3e-33    
ref|XP_004351613.1|  acylCoA dehydrogenase, middle domain contain...    136   4e-33    Acanthamoeba castellanii str. Neff
ref|WP_030112305.1|  acyl-CoA oxidase                                   133   4e-33    
ref|WP_002612916.1|  acyl-CoA dehydrogenase                             137   4e-33    Stigmatella aurantiaca
ref|XP_002979998.1|  hypothetical protein SELMODRAFT_178082             136   6e-33    
ref|WP_037233366.1|  acyl-CoA oxidase                                   135   7e-33    Rhodococcus wratislaviensis
ref|XP_005718655.1|  acyl-CoA oxidase                                   135   7e-33    Chondrus crispus [carageen]
ref|WP_009474726.1|  MULTISPECIES: acyl-CoA oxidase                     135   8e-33    Rhodococcus
ref|WP_028643473.1|  acyl-CoA oxidase                                   135   8e-33    Nocardioides sp. URHA0020
gb|AII09135.1|  acyl-CoA oxidase                                        135   8e-33    Rhodococcus opacus
gb|KJF23120.1|  Acyl-CoA dehydrogenase, short-chain specific            135   8e-33    Rhodococcus sp. AD45
ref|WP_005251993.1|  acyl-CoA oxidase                                   135   9e-33    Rhodococcus
ref|WP_023420722.1|  MULTISPECIES: Acyl-coenzyme A oxidase 1, per...    135   1e-32    Streptomyces
ref|WP_033235472.1|  acyl-CoA oxidase                                   134   1e-32    Rhodococcus
ref|WP_017576371.1|  acyl-CoA oxidase                                   135   1e-32    Nocardiopsis kunsanensis
ref|WP_006797234.1|  acyl-CoA oxidase                                   135   1e-32    Flavobacteria bacterium BBFL7
gb|EME62368.1|  acyl-CoA oxidase                                        134   1e-32    Rhodococcus ruber BKS 20-38
ref|WP_020172265.1|  acyl-CoA oxidase                                   135   1e-32    Gordonia polyisoprenivorans
ref|WP_033948443.1|  acyl-CoA oxidase                                   134   1e-32    Streptomyces
ref|XP_001754596.1|  predicted protein                                  135   1e-32    
ref|XP_005846795.1|  hypothetical protein CHLNCDRAFT_135324             133   1e-32    Chlorella variabilis
ref|WP_040783005.1|  acyl-CoA oxidase                                   134   1e-32    Rhodococcus ruber
ref|WP_030332097.1|  acyl-CoA oxidase                                   134   1e-32    Streptomyces sp. NRRL B-1381
ref|WP_030697375.1|  acyl-CoA oxidase                                   134   2e-32    Streptomyces
ref|WP_028638761.1|  acyl-CoA oxidase                                   134   2e-32    Nocardioides sp. URHA0032
ref|WP_026126958.1|  acyl-CoA oxidase                                   134   2e-32    Nocardiopsis xinjiangensis
ref|WP_005258360.1|  acyl-CoA oxidase                                   134   2e-32    Rhodococcus opacus
ref|WP_006552333.1|  acyl-CoA oxidase                                   134   2e-32    Rhodococcus pyridinivorans
ref|WP_005566484.1|  MULTISPECIES: acyl-CoA oxidase                     134   2e-32    Rhodococcus
ref|WP_024101715.1|  acyl-CoA oxidase                                   134   2e-32    Rhodococcus pyridinivorans
ref|WP_019291205.1|  MULTISPECIES: acyl-CoA oxidase                     134   2e-32    Rhodococcus
dbj|BAH32371.1|  putative acyl-CoA oxidase                              134   2e-32    Rhodococcus erythropolis PR4
ref|XP_002123442.2|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    134   2e-32    Ciona intestinalis [sea vase]
ref|WP_041815718.1|  acyl-CoA oxidase                                   134   2e-32    Rhodococcus erythropolis
ref|WP_042377454.1|  acyl-CoA oxidase                                   134   2e-32    Gordonia alkanivorans
ref|WP_005169429.1|  putative acyl-CoA oxidase                          134   2e-32    Gordonia aichiensis
ref|WP_024487810.1|  MULTISPECIES: acyl-CoA oxidase                     134   2e-32    Rhodococcus
ref|WP_037129939.1|  acyl-CoA oxidase                                   134   2e-32    Rhodococcus erythropolis
gb|EEN88202.1|  acyl-CoA dehydrogenase, middle domain protein           134   2e-32    Rhodococcus erythropolis SK121
ref|WP_008735487.1|  acyl-CoA oxidase                                   134   2e-32    Streptomyces sp. Mg1
ref|WP_014359023.1|  acyl-CoA oxidase                                   134   2e-32    Gordonia polyisoprenivorans
gb|AGT91460.1|  acyl-CoA oxidase                                        134   2e-32    Rhodococcus erythropolis CCM2595
gb|EME15692.1|  acyl-CoA oxidase                                        134   3e-32    Rhodococcus qingshengii BKS 20-40
ref|XP_503244.1|  YALI0D24750p                                          134   3e-32    Yarrowia lipolytica CLIB122
ref|XP_010269210.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    134   3e-32    Nelumbo nucifera [Indian lotus]
dbj|GAB38637.1|  putative acyl-CoA oxidase                              134   4e-32    Gordonia sputi NBRC 100414
ref|WP_016932641.1|  acyl-CoA oxidase                                   133   4e-32    Rhodococcus
ref|WP_039855121.1|  acyl-CoA oxidase                                   133   4e-32    Gordonia sputi
ref|XP_004813510.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    132   5e-32    
ref|WP_006935934.1|  MULTISPECIES: Acyl-coenzyme A oxidase 3, per...    133   5e-32    Rhodococcus
ref|WP_030768335.1|  acyl-CoA oxidase                                   133   5e-32    Streptomyces griseus
ref|WP_017680041.1|  acyl-CoA oxidase                                   133   5e-32    Rhodococcus
ref|XP_008053271.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    133   5e-32    
ref|WP_014773637.1|  acyl-CoA oxidase                                   134   5e-32    Belliella baltica
ref|WP_017614281.1|  acyl-CoA oxidase                                   133   5e-32    Nocardiopsis salina
ref|XP_002953234.1|  hypothetical protein VOLCADRAFT_93964              133   6e-32    Volvox carteri f. nagariensis
ref|WP_010592066.1|  acyl-CoA oxidase                                   132   6e-32    Rhodococcus
ref|XP_505264.1|  YALI0F10857p                                          133   7e-32    Yarrowia lipolytica CLIB122
ref|WP_035104505.1|  acyl-CoA oxidase                                   133   7e-32    Corynebacterium camporealensis
ref|WP_006437568.1|  putative acyl-CoA oxidase                          132   7e-32    Gordonia amicalis
gb|AAH22268.1|  ACOXL protein                                           129   8e-32    Homo sapiens [man]
ref|WP_018550940.1|  acyl-CoA oxidase                                   132   8e-32    Streptomyces sp. ATexAB-D23
ref|WP_042246211.1|  acyl-CoA oxidase                                   133   8e-32    Nonlabens ulvanivorans
ref|WP_042270257.1|  acyl-CoA oxidase                                   133   8e-32    Nonlabens ulvanivorans
ref|WP_036581400.1|  acyl-CoA oxidase                                   133   8e-32    Nonlabens ulvanivorans
ref|XP_004771031.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    132   9e-32    Mustela putorius furo [black ferret]
ref|WP_026453893.1|  acyl-CoA oxidase                                   132   9e-32    [Actinopolyspora] iraqiensis
ref|WP_030292936.1|  MULTISPECIES: acyl-CoA oxidase                     132   9e-32    Streptomyces
ref|WP_030760334.1|  MULTISPECIES: acyl-CoA oxidase                     132   1e-31    Streptomyces
ref|WP_031053630.1|  acyl-CoA oxidase                                   132   1e-31    Streptomyces sp. NRRL F-5702
ref|WP_030736574.1|  acyl-CoA oxidase                                   132   1e-31    Streptomyces
ref|WP_043247513.1|  acyl-CoA oxidase                                   132   1e-31    Streptomyces vinaceus
ref|WP_030194549.1|  MULTISPECIES: acyl-CoA oxidase                     132   1e-31    Streptomyces puniceus subgroup
ref|WP_030276558.1|  MULTISPECIES: acyl-CoA oxidase                     132   1e-31    Streptomyces
ref|WP_039751994.1|  acyl-CoA oxidase                                   132   1e-31    
gb|ELU36718.1|  putative acyl-coenzyme a oxidase 3.2, peroxisomal       130   1e-31    Rhizoctonia solani AG-1 IA
ref|WP_035694733.1|  acyl-CoA oxidase                                   132   1e-31    Flavobacterium soli
ref|XP_001786103.1|  predicted protein                                  132   1e-31    
ref|XP_003525063.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    132   1e-31    Glycine max [soybeans]
gb|KHN38187.1|  Acyl-coenzyme A oxidase 2, peroxisomal                  132   1e-31    Glycine soja [wild soybean]
dbj|GAK89314.1|  acyl-coenzyme A oxidase 1                              129   1e-31    Nonlabens ulvanivorans
ref|XP_003799352.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    131   2e-31    
ref|WP_019809905.1|  acyl-CoA oxidase                                   131   2e-31    Saccharomonospora halophila
ref|XP_001691953.1|  hypothetical protein CHLREDRAFT_170822             129   2e-31    Chlamydomonas reinhardtii
gb|EFA85005.1|  acyl-CoA oxidase                                        131   2e-31    Heterostelium album PN500
ref|WP_043644508.1|  hypothetical protein                               131   2e-31    
ref|WP_029254848.1|  acyl-CoA oxidase                                   131   2e-31    Rhodococcus erythropolis
ref|WP_011753930.1|  acyl-CoA oxidase                                   131   2e-31    Nocardioides
gb|AJD87363.1|  hypothetical protein 3                                  132   2e-31    Blastobotrys adeninivorans
ref|XP_007159635.1|  hypothetical protein PHAVU_002G254200g             131   2e-31    Phaseolus vulgaris [French bean]
ref|WP_007023318.1|  acyl-CoA oxidase                                   131   2e-31    Saccharomonospora paurometabolica
ref|WP_006865285.1|  acyl-CoA oxidase                                   131   2e-31    Gordonia namibiensis
ref|WP_042295862.1|  acyl-CoA oxidase                                   132   2e-31    Nonlabens ulvanivorans
ref|WP_039500185.1|  acyl-CoA oxidase                                   130   2e-31    
ref|WP_034942646.1|  acyl-CoA oxidase                                   131   3e-31    
ref|WP_031937608.1|  acyl-CoA oxidase                                   130   3e-31    
ref|WP_030531740.1|  acyl-CoA oxidase                                   130   3e-31    
ref|WP_040338148.1|  acyl-CoA oxidase                                   131   3e-31    
gb|ERE69860.1|  acyl-coenzyme A oxidase-like protein                    125   3e-31    
ref|WP_012688927.1|  acyl-CoA oxidase                                   130   3e-31    
ref|XP_003289973.1|  hypothetical protein DICPUDRAFT_48894              130   3e-31    
dbj|GAK93202.1|  acyl-coenzyme A oxidase 1                              129   3e-31    
ref|XP_009441363.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    128   4e-31    
ref|XP_003926782.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    130   4e-31    
ref|WP_037831419.1|  acyl-CoA oxidase                                   130   4e-31    
ref|WP_041825462.1|  acyl-CoA oxidase                                   130   4e-31    
ref|WP_030125188.1|  MULTISPECIES: acyl-CoA oxidase                     130   4e-31    
ref|XP_008234652.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    130   5e-31    
gb|ADW07059.1|  acyl-CoA dehydrogenase domain-containing protein        130   5e-31    
ref|WP_017581593.1|  acyl-CoA oxidase                                   130   5e-31    
ref|WP_027862959.1|  acyl-CoA oxidase                                   130   5e-31    
ref|WP_015576152.1|  acyl-coenzyme A oxidase 1                          130   5e-31    
ref|WP_023647853.1|  acyl-CoA oxidase                                   130   5e-31    
ref|WP_036194533.1|  acyl-CoA oxidase                                   130   5e-31    
ref|XP_009150593.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    130   5e-31    
ref|WP_044101585.1|  acyl-CoA oxidase                                   131   5e-31    
emb|CDY08820.1|  BnaA06g24040D                                          130   6e-31    
emb|CDY14540.1|  BnaC03g49190D                                          130   6e-31    
ref|WP_028418867.1|  acyl-CoA oxidase                                   130   6e-31    
ref|WP_036565630.1|  acyl-CoA oxidase                                   130   6e-31    
ref|XP_004360487.1|  acyl-CoA oxidase                                   131   6e-31    
ref|WP_022827387.1|  acyl-CoA oxidase                                   130   6e-31    
gb|KFH61896.1|  hypothetical protein MVEG_12230                         130   7e-31    
ref|WP_026238320.1|  acyl-CoA oxidase                                   129   8e-31    
ref|WP_026716117.1|  acyl-CoA oxidase                                   130   9e-31    
ref|XP_007208434.1|  hypothetical protein PRUPE_ppa002282mg             130   9e-31    
gb|AFQ93694.1|  acyl-CoA oxidase 2                                      130   9e-31    
ref|WP_026245499.1|  acyl-CoA oxidase                                   129   9e-31    
ref|WP_042532221.1|  acyl-CoA oxidase                                   130   9e-31    
ref|WP_017588837.1|  acyl-CoA oxidase                                   129   9e-31    
emb|CDP01433.1|  unnamed protein product                                130   1e-30    
ref|XP_004771033.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    129   1e-30    
ref|WP_006122746.1|  MULTISPECIES: acyl-CoA oxidase                     129   1e-30    
ref|WP_030591343.1|  acyl-CoA oxidase                                   129   1e-30    
ref|XP_004771032.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    129   1e-30    
ref|WP_029430245.1|  acyl-CoA oxidase                                   129   1e-30    
ref|XP_005630480.1|  PREDICTED: acyl-CoA oxidase-like isoform X5        127   1e-30    
ref|XP_008453798.1|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    129   1e-30    
sp|O64894.1|ACOX2_CUCMA  RecName: Full=Acyl-coenzyme A oxidase, p...    129   1e-30    
ref|WP_030220322.1|  acyl-CoA oxidase                                   129   1e-30    
ref|XP_006394077.1|  hypothetical protein EUTSA_v10003747mg             129   1e-30    
ref|WP_030762017.1|  acyl-CoA oxidase                                   129   1e-30    
gb|EXX57885.1|  acyl-CoA oxidase                                        124   1e-30    
ref|WP_036491874.1|  acyl-CoA oxidase                                   129   1e-30    
gb|KDD73136.1|  hypothetical protein H632_c2497p0                       126   1e-30    
ref|XP_004146872.1|  PREDICTED: acyl-coenzyme A oxidase, peroxiso...    129   1e-30    
gb|EON25586.1|  acyl-CoA oxidase domain-containing protein              129   2e-30    
ref|WP_019144377.1|  acyl-CoA oxidase                                   128   2e-30    
ref|XP_004362274.1|  acyl-CoA oxidase                                   129   2e-30    
ref|XP_006156694.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    128   2e-30    
ref|WP_014044514.1|  MULTISPECIES: acyl-CoA oxidase                     129   2e-30    
gb|EDK36547.2|  hypothetical protein PGUG_00645                         129   2e-30    
ref|WP_009183890.1|  acyl-CoA oxidase                                   129   2e-30    
ref|XP_001487268.1|  hypothetical protein PGUG_00645                    129   2e-30    
ref|WP_012924042.1|  acyl-CoA oxidase                                   129   2e-30    
ref|WP_018524646.1|  MULTISPECIES: acyl-CoA oxidase                     128   2e-30    
ref|XP_502199.1|  YALI0C23859p                                          129   2e-30    
gb|EAW50357.1|  acyl-Coenzyme A oxidase-like, isoform CRA_a             124   2e-30    
gb|KEH20862.1|  peroxisomal acyl-CoA oxidase                            129   2e-30    
ref|XP_005630478.1|  PREDICTED: acyl-CoA oxidase-like isoform X3        128   2e-30    
ref|WP_015607106.1|  Acyl-CoA oxidase domain-containing protein         128   2e-30    
ref|WP_020214166.1|  hypothetical protein                               129   2e-30    
ref|WP_032755520.1|  acyl-CoA oxidase                                   128   2e-30    
ref|XP_009183206.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   2e-30    
ref|XP_002886952.1|  hypothetical protein ARALYDRAFT_894142             119   3e-30    
gb|ADD09618.1|  acyl-coA oxidase                                        128   3e-30    
gb|ADD09596.1|  acyl-coA oxidase                                        128   3e-30    
ref|XP_005630477.1|  PREDICTED: acyl-CoA oxidase-like isoform X2        127   3e-30    
gb|KJB44225.1|  hypothetical protein B456_007G240800                    128   3e-30    
gb|KJB44226.1|  hypothetical protein B456_007G240800                    128   3e-30    
ref|XP_007047997.1|  Acyl-CoA oxidase 2 isoform 1                       128   3e-30    
ref|WP_018102778.1|  MULTISPECIES: acyl-CoA oxidase                     128   3e-30    
gb|KJB44224.1|  hypothetical protein B456_007G240800                    127   3e-30    
gb|EYU24007.1|  hypothetical protein MIMGU_mgv1a002222mg                128   3e-30    
ref|XP_009378530.1|  PREDICTED: acyl-coenzyme A oxidase, peroxiso...    128   4e-30    
ref|WP_030317285.1|  acyl-CoA oxidase                                   127   4e-30    
ref|XP_005630476.1|  PREDICTED: acyl-CoA oxidase-like isoform X1        127   4e-30    
ref|XP_002866650.1|  acyl-CoA oxidase                                   128   4e-30    
ref|WP_029182498.1|  acyl-CoA oxidase                                   127   4e-30    
ref|XP_005630479.1|  PREDICTED: acyl-CoA oxidase-like isoform X4        127   4e-30    
ref|XP_002309985.1|  acyl CoA oxidase family protein                    128   4e-30    
ref|WP_012832911.1|  acyl-CoA oxidase                                   128   4e-30    
ref|WP_008354960.1|  acyl-CoA oxidase                                   127   4e-30    
ref|WP_007317217.1|  acyl-CoA oxidase                                   128   4e-30    
ref|XP_004504056.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    128   4e-30    
ref|XP_009629828.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    128   5e-30    
ref|XP_009345476.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   5e-30    
ref|WP_013993723.1|  acyl-CoA oxidase                                   128   5e-30    
ref|WP_036336177.1|  acyl-CoA oxidase                                   127   5e-30    
ref|XP_011097594.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    128   5e-30    
ref|XP_011030976.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   5e-30    
ref|WP_031456312.1|  acyl-CoA oxidase                                   128   5e-30    
ref|WP_030081577.1|  acyl-CoA oxidase                                   127   5e-30    
ref|XP_011232878.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    124   5e-30    
ref|WP_030580799.1|  acyl-CoA oxidase                                   127   5e-30    
ref|WP_013416987.1|  acyl-CoA oxidase                                   127   5e-30    
ref|XP_009366361.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   5e-30    
ref|WP_022597503.1|  acyl-CoA oxidase                                   127   5e-30    
emb|CDJ82242.1|  Acyl-CoA oxidase dehydrogenase and Acyl-CoA oxid...    127   5e-30    
gb|KJB71251.1|  hypothetical protein B456_011G112800                    126   5e-30    
ref|WP_018163641.1|  hypothetical protein                               127   6e-30    
ref|WP_005518129.1|  acyl-CoA oxidase                                   127   6e-30    
ref|XP_645634.1|  acyl-CoA oxidase                                      127   6e-30    
gb|ERJ18395.1|  acyl-CoA oxidase protein                                128   6e-30    
ref|XP_002619538.1|  hypothetical protein CLUG_00697                    127   6e-30    
ref|WP_030629375.1|  acyl-CoA oxidase                                   127   6e-30    
ref|NP_001099978.1|  acyl-coenzyme A oxidase-like protein               127   6e-30    
ref|WP_040608171.1|  hypothetical protein                               127   7e-30    
ref|XP_006183680.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   7e-30    
ref|XP_010983071.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   7e-30    
ref|WP_041451393.1|  acyl-CoA oxidase                                   127   7e-30    
ref|XP_006047075.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    127   7e-30    
gb|AEF38816.1|  Putative acyl-CoA oxidase                               127   7e-30    
ref|WP_030133589.1|  acyl-CoA oxidase                                   127   7e-30    
ref|WP_036382477.1|  acyl-CoA oxidase                                   127   7e-30    
ref|NP_001032145.1|  acyl-coenzyme A oxidase 2                          127   7e-30    
dbj|BAH19744.1|  AT5G65110                                              127   7e-30    
ref|XP_010519778.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   7e-30    
ref|WP_031088727.1|  acyl-CoA oxidase                                   127   8e-30    
ref|XP_011022766.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   8e-30    
ref|XP_008961118.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    126   8e-30    
gb|AAC13497.1|  acyl-CoA oxidase                                        127   8e-30    
ref|NP_201316.1|  acyl-coenzyme A oxidase 2                             127   9e-30    
ref|WP_036550021.1|  acyl-CoA oxidase                                   127   9e-30    
ref|XP_004361564.1|  putative acyl-CoA oxidase                          127   9e-30    
ref|XP_004399937.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    126   9e-30    
ref|XP_008698361.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    125   9e-30    
ref|WP_037662951.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_032769032.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_029121178.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_029104814.1|  acyl-CoA oxidase                                   126   1e-29    
ref|XP_009779578.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   1e-29    
gb|KDP46864.1|  hypothetical protein JCGZ_24073                         127   1e-29    
ref|WP_020937550.1|  acyl-CoA dehydrogenase                             126   1e-29    
gb|AAR00586.1|U77053_1  acyl-CoA oxidase                                127   1e-29    
gb|AAB67883.1|  acyl-CoA oxidase homolog                                127   1e-29    
ref|WP_035128869.1|  acyl-CoA oxidase                                   126   1e-29    
ref|XP_010025485.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    127   1e-29    
ref|WP_003970716.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_020497070.1|  hypothetical protein                               126   1e-29    
ref|WP_024795146.1|  acyl-CoA oxidase                                   126   1e-29    
gb|KJB71252.1|  hypothetical protein B456_011G112800                    126   1e-29    
ref|WP_027391884.1|  acyl-CoA oxidase                                   127   1e-29    
ref|WP_030704772.1|  acyl-CoA oxidase                                   126   1e-29    
ref|XP_010957303.1|  PREDICTED: acyl-coenzyme A oxidase-like protein    125   1e-29    
ref|XP_006193629.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    126   1e-29    
ref|WP_020534466.1|  hypothetical protein                               127   1e-29    
ref|WP_033226284.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_012381918.1|  acyl-CoA oxidase                                   126   1e-29    
gb|EUA26849.1|  acyl-CoA dehydrogenase, N-terminal domain protein       121   1e-29    
ref|XP_008338613.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   1e-29    
ref|XP_637610.2|  acyl-CoA oxidase                                      126   1e-29    
ref|WP_014374170.1|  acyl-CoA oxidase                                   126   1e-29    
ref|WP_026707256.1|  acyl-CoA oxidase                                   127   1e-29    
ref|WP_026810093.1|  acyl-CoA oxidase                                   127   1e-29    
gb|EUA10788.1|  acyl-CoA dehydrogenase, C-terminal domain protein       125   1e-29    
ref|XP_010484314.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    126   2e-29    
ref|XP_009838049.1|  hypothetical protein H257_12517                    126   2e-29    
ref|WP_013286960.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_020391585.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_005531336.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_030268321.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_012946546.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_013476358.1|  acyl-CoA oxidase                                   126   2e-29    
ref|XP_009838050.1|  hypothetical protein, variant                      126   2e-29    
ref|XP_010680574.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    126   2e-29    
gb|ESW97032.1|  Acyl-coenzyme A oxidase                                 126   2e-29    
ref|WP_036402348.1|  acyl-CoA oxidase                                   125   2e-29    
ref|XP_002269650.2|  PREDICTED: acyl-coenzyme A oxidase, peroxisomal    126   2e-29    
ref|WP_032779937.1|  acyl-CoA oxidase                                   125   2e-29    
ref|XP_005647184.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_026242212.1|  acyl-CoA oxidase                                   125   2e-29    
ref|XP_006355366.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    126   2e-29    
ref|WP_030570486.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_024874955.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_039676522.1|  acyl-CoA oxidase                                   126   2e-29    
ref|WP_014738397.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_014816551.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_007619749.1|  putative acyl-CoA oxidase                          126   2e-29    
ref|WP_037494263.1|  acyl-CoA oxidase                                   125   2e-29    
gb|EFA74856.1|  acyl-CoA oxidase                                        125   2e-29    
gb|KDO56615.1|  hypothetical protein CISIN_1g048624mg                   125   2e-29    
gb|EPZ31508.1|  Acyl-CoA dehydrogenase/oxidase domain-containing ...    125   2e-29    
gb|KJB71250.1|  hypothetical protein B456_011G112800                    125   2e-29    
ref|WP_043221719.1|  acyl-CoA oxidase                                   125   2e-29    
ref|WP_028655548.1|  acyl-CoA oxidase                                   125   2e-29    
ref|XP_009390291.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   2e-29    
ref|WP_043391714.1|  MULTISPECIES: acyl-CoA oxidase                     125   2e-29    
ref|WP_029720473.1|  acyl-CoA oxidase                                   125   3e-29    
ref|XP_006428162.1|  hypothetical protein CICLE_v10025052mg             125   3e-29    
ref|WP_031121894.1|  acyl-CoA oxidase                                   125   3e-29    
ref|XP_006826958.1|  hypothetical protein AMTR_s00010p00190650          125   3e-29    
ref|XP_004366148.1|  acyl-CoA oxidase                                   125   3e-29    
ref|WP_012361078.1|  acyl-CoA oxidase                                   125   3e-29    
gb|EAY96779.1|  hypothetical protein OsI_18704                          125   3e-29    
ref|XP_004237411.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   3e-29    
ref|WP_018783924.1|  acyl-CoA oxidase                                   125   3e-29    
gb|ESA00876.1|  hypothetical protein GLOINDRAFT_265185                  125   3e-29    
ref|WP_041801916.1|  acyl-CoA oxidase                                   125   3e-29    
ref|WP_023986016.1|  MULTISPECIES: acyl-CoA oxidase                     125   3e-29    
ref|WP_036456278.1|  acyl-CoA oxidase                                   125   3e-29    
ref|WP_012395254.1|  acyl-CoA oxidase                                   125   3e-29    
gb|EPQ74968.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  125   3e-29    
ref|WP_013453510.1|  acyl-CoA oxidase                                   125   3e-29    
ref|WP_020786817.1|  Acyl-coenzyme A oxidase 3, peroxisomal             125   3e-29    
ref|WP_041518765.1|  acyl-CoA oxidase                                   125   4e-29    
ref|WP_033441505.1|  acyl-CoA oxidase                                   124   4e-29    
gb|AEM70899.1|  Acyl-CoA oxidase                                        125   4e-29    
ref|XP_008338612.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   4e-29    
ref|XP_010808073.1|  PREDICTED: acyl-coenzyme A oxidase-like prot...    124   4e-29    
gb|EUA00393.1|  acyl-CoA dehydrogenase, C-terminal domain protein       124   4e-29    
ref|XP_008370191.1|  PREDICTED: acyl-coenzyme A oxidase 2, peroxi...    125   4e-29    
gb|EEE62556.1|  hypothetical protein OsJ_17355                          125   4e-29    
ref|WP_019598670.1|  hypothetical protein                               125   4e-29    



>ref|XP_009621605.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana tomentosiformis]
Length=686

 Score =   401 bits (1031),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE SEP  + D  EMRKLMDGHNLQ+RDWL+G+M+QS+LFNP+ RGGKVFV  
Sbjct  41   PCLSYNPPEFSEPSSIFDTKEMRKLMDGHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQP  100

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TMRRIG+LL  GVF+ WLT  GPE ELRKLALLDV+ +FDHSL++K+G
Sbjct  101  DYNQSKEQQREITMRRIGYLLQNGVFESWLTGKGPEDELRKLALLDVVGIFDHSLAIKIG  160

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS TG
Sbjct  161  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTG  220

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  221  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  268



>ref|XP_011100229.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Sesamum 
indicum]
Length=678

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 205/231 (89%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVF  179
            S+SPCLSYTPPEVSE P   DV  MRKLMDGHNL+DRDWL+ +MIQS LFNP+ RGGK+F
Sbjct  31   SSSPCLSYTPPEVSEQPSSFDVNSMRKLMDGHNLEDRDWLFNLMIQSRLFNPKLRGGKIF  90

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V  DYNQ+MEQQR +TM+RI +LLD GVF+GWLT  G E+E+RKLALL+VI +FDHSL++
Sbjct  91   VVPDYNQSMEQQREITMKRIQYLLDHGVFEGWLTRKGFEAEMRKLALLEVIEIFDHSLAI  150

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWGGA+QF GTKRHHD WL  TENY VKGCF+MTELGHGSNVRGIET+TTYDS
Sbjct  151  KIGVHFFLWGGAVQFFGTKRHHDRWLSATENYLVKGCFSMTELGHGSNVRGIETITTYDS  210

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +TGEFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK++GVHAFI QI
Sbjct  211  KTGEFVINTPCESAQKYWIGGAANHATHTVVFSQLNIDGKNEGVHAFITQI  261



>emb|CDP15892.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   398 bits (1022),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 206/230 (90%), Gaps = 1/230 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            +SPCLSYTPPE+SEP    DV  MRKLMDGHN++DRDWLY +++QS LFNP+E+GGK+FV
Sbjct  28   SSPCLSYTPPELSEPNSFFDVKLMRKLMDGHNIEDRDWLYNLIVQSKLFNPQEKGGKIFV  87

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
              DYNQ+MEQQR MTM+RI +LLD GVF+GWLT  GPE+ELRK A LDV+ +FDHSL++K
Sbjct  88   LPDYNQSMEQQREMTMKRIEYLLDNGVFQGWLTRKGPEAELRKFAFLDVVGIFDHSLAIK  147

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            +GVHF LWGGAIQF GTKRHHD+WL+DTE+Y VKGCF+MTELGHGSNVRGIET+TTYDS 
Sbjct  148  IGVHFFLWGGAIQFFGTKRHHDKWLKDTEDYVVKGCFSMTELGHGSNVRGIETITTYDSN  207

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EF+INTPCESAQKYWIGGAANHATHTIVFSQL I+G++QGVHAFIAQI
Sbjct  208  TREFIINTPCESAQKYWIGGAANHATHTIVFSQLNINGRNQGVHAFIAQI  257



>ref|XP_009783429.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana sylvestris]
Length=686

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE SEP  + D+ EMRKLMDGHNLQ+RDWL+G+M+QS+LFNP+ RGGKVFV  
Sbjct  41   PCLSYNPPEFSEPSSVFDIKEMRKLMDGHNLQERDWLFGLMLQSNLFNPKIRGGKVFVQP  100

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TMRRIG+L+  GVF+ WLT  GPE ELRKLALLDV+ +FDHSL++K+G
Sbjct  101  DYNQSKEQQREITMRRIGYLMQNGVFERWLTGKGPEDELRKLALLDVVGIFDHSLAIKIG  160

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS T 
Sbjct  161  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTR  220

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  221  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  268



>ref|XP_002278663.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Vitis vinifera]
Length=691

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 205/231 (89%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEV-SEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVF  179
            S SPCL Y+PPE+ S P   ++ +MRKLMDGHNLQDRDWL+G+MIQS LFNPR  GG+VF
Sbjct  33   SPSPCLQYSPPELASPPSDFNLSDMRKLMDGHNLQDRDWLFGLMIQSKLFNPRVAGGRVF  92

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V+ DYNQ+MEQQR MTM+RI +LLDCGVF+ WLT  GPE E+RK AL +VI ++DHSL+V
Sbjct  93   VSPDYNQSMEQQREMTMKRIHYLLDCGVFQEWLTGRGPEVEMRKFALHEVIGMYDHSLAV  152

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            KLGVH+ LWGGAIQF GTKRHHD+WLRD+ENY +KGCFAMTELGHGSNVRGIETVTTYDS
Sbjct  153  KLGVHYFLWGGAIQFFGTKRHHDKWLRDSENYVIKGCFAMTELGHGSNVRGIETVTTYDS  212

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +TGEFVIN+PCESAQKYWIGGAANHATHTIVFSQL I+GK +GVHAFIAQI
Sbjct  213  KTGEFVINSPCESAQKYWIGGAANHATHTIVFSQLNINGKSEGVHAFIAQI  263



>gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica]
Length=672

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S +PC+ ++PPE+SEP   D  EMRKL+D HNL+DRDWL+G+M QS  FNPRE GG+VFV
Sbjct  25   SPNPCVGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDWLFGLMKQSKPFNPREAGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MTM+RI +LLD GVF+GWLTE G E+ELRKLAL +VI ++DHSLSVK
Sbjct  85   SPDYNQSMEQQREMTMKRIAYLLDRGVFEGWLTEKGVEAELRKLALHEVIGIYDHSLSVK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD+WLRDTENY +KGCFAM+ELGHGSNVRGIETVTTYDS 
Sbjct  145  LGVHFFLWGGAIQFFGTKRHHDKWLRDTENYTIKGCFAMSELGHGSNVRGIETVTTYDSN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I GK+ GVHAFIAQI
Sbjct  205  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNISGKNHGVHAFIAQI  254



>ref|XP_008244854.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Prunus 
mume]
Length=662

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S +PC+ ++PPE+SEP   D  EMRKL+D HNL+DRDWL+G+M QS LFNPRE GG+VFV
Sbjct  25   SPNPCVGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDWLFGLMKQSKLFNPREAGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MTM+RI +LLD GVF+GWLTE G E+ELRKLAL +VI ++DHSL+VK
Sbjct  85   SPDYNQSMEQQREMTMKRIAYLLDRGVFEGWLTEKGVEAELRKLALHEVIGIYDHSLAVK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVH+ LWG AI F GTKRHHD+WLRDTENY +KGCFAM+ELGHGSNVRGIETVTTYDS 
Sbjct  145  LGVHYFLWGSAILFFGTKRHHDKWLRDTENYTIKGCFAMSELGHGSNVRGIETVTTYDSN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I GK+QGVHAFIAQI
Sbjct  205  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNISGKNQGVHAFIAQI  254



>ref|XP_011466939.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=596

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 205/231 (89%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERG-GKVF  179
            +A+PCL Y+PPE++EP   +  EMRKL+D HNL++RDWL+G+M QS LFNP+E G G+VF
Sbjct  25   TANPCLGYSPPELTEPFEFNTKEMRKLLDHHNLEERDWLFGLMRQSKLFNPKEAGDGRVF  84

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V+ DYNQ+MEQQR MTM+RI +LLD GVFKGWLTE G E+ELRK ALL+V  ++DHSLSV
Sbjct  85   VSPDYNQSMEQQREMTMKRIEYLLDRGVFKGWLTEKGVEAELRKFALLEVSGIYDHSLSV  144

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            KLGVHF LWGGAI F GTKRHHD+WLRDTENYA+KGCFAMTELGHGSNVRGIETVTTYDS
Sbjct  145  KLGVHFFLWGGAILFFGTKRHHDKWLRDTENYAIKGCFAMTELGHGSNVRGIETVTTYDS  204

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I G +QGVHAFIAQI
Sbjct  205  KTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNISGTNQGVHAFIAQI  255



>ref|XP_010093490.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
 gb|EXB54129.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
Length=667

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            +A+PCL+Y+PPE+SEP   D   MR L+D HNLQ RDWL+G++IQS LFNPR   GKVFV
Sbjct  25   AANPCLNYSPPELSEPSEFDPKAMRSLLDAHNLQQRDWLFGLLIQSPLFNPRTAAGKVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+M+QQR MTM+RI +LLD GVF GWLTE GPE+E+RK A  +VI ++DHSL+VK
Sbjct  85   SPDYNQSMQQQREMTMKRITYLLDRGVFHGWLTEKGPEAEMRKFAFFEVIGIYDHSLAVK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD+WLRDTENYA+KGCFAM+ELGHGSNVRGIETVTTYD  
Sbjct  145  LGVHFFLWGGAIQFFGTKRHHDKWLRDTENYAIKGCFAMSELGHGSNVRGIETVTTYDKN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVI+TPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  205  TGEFVISTPCESAQKYWIGGAANHATHTIVFSQLNINGSNQGVHAFIAQI  254



>ref|XP_009621600.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana tomentosiformis]
Length=691

 Score =   391 bits (1004),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE SEP  + D+ EMRKL+D HNL+D+DWL+G+M+QS+LFN + RG KVFV  
Sbjct  46   PCLSYNPPEFSEPSSVFDIKEMRKLLDDHNLEDKDWLFGLMLQSNLFNTKVRGDKVFVCP  105

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQ  +TMRRI +LL+ GVFKGWLT NGPE ELRKLA  DV+++FDHSLSVK+G
Sbjct  106  DYNQSKEQQSEITMRRIEYLLEHGVFKGWLTGNGPEDELRKLAFTDVVSIFDHSLSVKIG  165

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS TG
Sbjct  166  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTG  225

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  226  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  273



>ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=674

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 205/231 (89%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERG-GKVF  179
            +A+PCL Y+PPE++EP   +  EMRKL+D HNL++RDWL+G+M QS LFNP+E G G+VF
Sbjct  25   TANPCLGYSPPELTEPFEFNTKEMRKLLDHHNLEERDWLFGLMRQSKLFNPKEAGDGRVF  84

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V+ DYNQ+MEQQR MTM+RI +LLD GVFKGWLTE G E+ELRK ALL+V  ++DHSLSV
Sbjct  85   VSPDYNQSMEQQREMTMKRIEYLLDRGVFKGWLTEKGVEAELRKFALLEVSGIYDHSLSV  144

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            KLGVHF LWGGAI F GTKRHHD+WLRDTENYA+KGCFAMTELGHGSNVRGIETVTTYDS
Sbjct  145  KLGVHFFLWGGAILFFGTKRHHDKWLRDTENYAIKGCFAMTELGHGSNVRGIETVTTYDS  204

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I G +QGVHAFIAQI
Sbjct  205  KTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNISGTNQGVHAFIAQI  255



>ref|NP_001280826.1| acyl-coenzyme A oxidase 3, peroxisomal-like [Malus domestica]
 gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus domestica]
Length=674

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S +PCL ++PPE+SEP   D  EMRKL+D HNL+DRDWL+G+M QS L NPRE GG+VF+
Sbjct  26   SPNPCLGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDWLFGLMKQSKLLNPREAGGRVFI  85

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A DYNQ+MEQQR MTM+RI +LLD GVFKGWLT+ G ++ELRK A  +VI +FDHSL+VK
Sbjct  86   APDYNQSMEQQRQMTMKRIAYLLDRGVFKGWLTDKGVDAELRKFAFFEVIGIFDHSLAVK  145

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD+WL DTENY +KGCFAM+ELGHGSNVRGIETVTTYDS 
Sbjct  146  LGVHFFLWGGAIQFFGTKRHHDKWLSDTENYTIKGCFAMSELGHGSNVRGIETVTTYDSS  205

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I G +QGVHA IAQI
Sbjct  206  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLSISGNNQGVHALIAQI  255



>ref|XP_009621612.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana tomentosiformis]
Length=676

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 199/228 (87%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE SEP  + D+ EMRKL+DGHNLQ+ DWL+G+M+QS+LFN   RGGKVFV  
Sbjct  31   PCLSYNPPEFSEPYSVFDIKEMRKLLDGHNLQEMDWLFGLMLQSNLFNTNVRGGKVFVLP  90

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TMRRIG+LL  GVFKGWLT  GPE ELRK   +DVI +FDHSL +K+G
Sbjct  91   DYNQSKEQQREITMRRIGYLLQNGVFKGWLTGKGPEDELRKFDFVDVIGIFDHSLKIKIG  150

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS TG
Sbjct  151  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTG  210

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  211  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  258



>ref|XP_009783428.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana sylvestris]
Length=691

 Score =   389 bits (1000),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE S P  + D  EMRKL+D HNL+D+DWL+G+M++++LFNP+ RGGKVFV  
Sbjct  46   PCLSYIPPEFSGPSSVFDTKEMRKLLDDHNLEDKDWLFGLMLKNNLFNPKIRGGKVFVCP  105

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TMRRI +LL+ GVFKGWLT NGPE ELRKLA  DV+++FDHSLSVK+G
Sbjct  106  DYNQSKEQQREITMRRIEYLLEHGVFKGWLTGNGPEDELRKLAFTDVVSIFDHSLSVKIG  165

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS T 
Sbjct  166  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTR  225

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  226  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  273



>ref|XP_010279215.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Nelumbo 
nucifera]
Length=684

 Score =   389 bits (999),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            +S CL Y PPE+SE    DV EMR+LMDGHN++DRDWL+G+MIQS LF PR  GGKVFV+
Sbjct  38   SSVCLQYAPPELSEKFDFDVREMRQLMDGHNIEDRDWLFGLMIQSKLFCPRNSGGKVFVS  97

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ+MEQQR MTM+RI +LLD GVF+GWLTE G E+ELRK A  +VI +FDHSL+VKL
Sbjct  98   PDYNQSMEQQREMTMKRIAYLLDRGVFEGWLTEKGAEAELRKFAFFEVIGIFDHSLAVKL  157

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGAIQF GTKRHHD+WL+DTE+Y +KGCFAMTELGHGSNVRGIET+TTYD+ T
Sbjct  158  GVHFFLWGGAIQFFGTKRHHDKWLKDTESYVIKGCFAMTELGHGSNVRGIETITTYDTST  217

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHAT+TIVFSQL I+GK +GVHAFI QI
Sbjct  218  GEFVINTPCESAQKYWIGGAANHATYTIVFSQLHINGKSEGVHAFITQI  266



>gb|KDO45758.1| hypothetical protein CISIN_1g011790mg [Citrus sinensis]
 gb|KDO45759.1| hypothetical protein CISIN_1g011790mg [Citrus sinensis]
Length=477

 Score =   382 bits (980),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            + + CLSY+PPE++E    D+ EMRKL+DGHNLQ+RDWL+ +M+QS LFNPR+RG KV+V
Sbjct  25   TTNACLSYSPPELNEVYDFDLKEMRKLLDGHNLQERDWLFNLMVQSKLFNPRKRGEKVYV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A DYNQ MEQQR MTM+RI +LL+  VF+GWLT  G E+ELRKLALL+V  +FDHSL++K
Sbjct  85   APDYNQTMEQQREMTMKRISYLLERNVFEGWLTAKGAEAELRKLALLEVTGIFDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            +GVHF LWGGAIQF GT+RHH++WLRDTENY V GCFAMTELGHGSNVRGIETVTTYD+ 
Sbjct  145  IGVHFFLWGGAIQFFGTQRHHEKWLRDTENYVVLGCFAMTELGHGSNVRGIETVTTYDAN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEF+INTPCESAQKYWIGGAANHATHTIVFSQL+I+GK+QGVHAFI QI
Sbjct  205  TGEFIINTPCESAQKYWIGGAANHATHTIVFSQLEINGKNQGVHAFICQI  254



>gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzyme A oxidase I precursor 
from Candida tropicalis gb|M12161 [Arabidopsis thaliana]
Length=305

 Score =   375 bits (964),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S   CL Y+PPE++E  G DV EMRKL+DGHN+ DRDW+YG+M+QS+LFN +ERGGK+FV
Sbjct  30   SRELCLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ MEQQR +TM+RI +LL+ GVFKGWLTE GPE+ELRKLALL+V  ++DHS+S+K
Sbjct  90   SPDYNQTMEQQREITMKRIWYLLENGVFKGWLTETGPEAELRKLALLEVCGIYDHSVSIK  149

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            +GVHF LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD +
Sbjct  150  VGVHFFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPK  209

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  210  TEEFVINTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>ref|XP_006364109.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum tuberosum]
Length=683

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE+SEP  + D  EMRKLMDGHN  ++DWL+G+M+QS+LFNP ERGGKVFV+ 
Sbjct  38   PCLSYNPPELSEPSAIFDTKEMRKLMDGHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSP  97

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TM+RIG+LL+ GVFK WLT  GPE ELRKL LLD + ++DHSL++K+G
Sbjct  98   DYNQSKEQQREITMKRIGYLLEHGVFKKWLTGKGPEDELRKLGLLDCLCIYDHSLAIKVG  157

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAIQF GTKRHHD+WL+DTE+Y VKGCF+MTELGHGSNVR IETVTTYDS TG
Sbjct  158  VHFFLWGGAIQFFGTKRHHDKWLKDTEDYVVKGCFSMTELGHGSNVRSIETVTTYDSSTG  217

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHTIVFSQL IDG++QGVHAFIAQI
Sbjct  218  EFVINTPCESAQKYWIGGAANHATHTIVFSQLIIDGENQGVHAFIAQI  265



>ref|XP_009354288.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Pyrus 
x bretschneideri]
Length=674

 Score =   386 bits (992),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL ++PPE+SEP   D  EMRKL+D HNL+DRDWL+G+M QS LFNPRE GG+VF+A DY
Sbjct  30   CLGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDWLFGLMKQSKLFNPREAGGRVFIAPDY  89

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ+MEQQR MTM+RI +LLD GVFKGWLT+ G ++ELRK A  +VI +FDHSL+VKLGVH
Sbjct  90   NQSMEQQRQMTMKRIAYLLDRGVFKGWLTDRGVDAELRKFAFFEVIGIFDHSLAVKLGVH  149

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWGGAIQF GTKRHHD+WL DTENYA+KGCFAM+ELGHGSNVRGIETVTTYDS T EF
Sbjct  150  FFLWGGAIQFFGTKRHHDKWLSDTENYAIKGCFAMSELGHGSNVRGIETVTTYDSSTEEF  209

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL I G +QGVHA IAQI
Sbjct  210  VINTPCESAQKYWIGGAANHATHTIVFSQLSISGNNQGVHALIAQI  255



>ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
 gb|ESR59974.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
Length=671

 Score =   386 bits (991),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            + + CLSY+PPE++E    D+ EMRKL+DGHNLQ+RDWL+ +M+QS LFNPR+RG KV+V
Sbjct  25   TTNACLSYSPPELNEVYDFDLKEMRKLLDGHNLQERDWLFNLMVQSKLFNPRKRGEKVYV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A DYNQ MEQQR MTM+RI +LL+ GVF+GWLT  G E+ELRKLALL+V  +FDHSL++K
Sbjct  85   APDYNQTMEQQREMTMKRISYLLERGVFEGWLTAKGAEAELRKLALLEVTGIFDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            +GVHF LWGGAIQF GT+RHH++WLRDTENY V GCFAMTELGHGSNVRGIETVTTYD+ 
Sbjct  145  IGVHFFLWGGAIQFFGTQRHHEKWLRDTENYVVLGCFAMTELGHGSNVRGIETVTTYDAN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEF+INTPCESAQKYWIGGAANHATHTIVFSQL+I+GK+QGVHAFI QI
Sbjct  205  TGEFIINTPCESAQKYWIGGAANHATHTIVFSQLEINGKNQGVHAFICQI  254



>ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Citrus 
sinensis]
Length=671

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 204/230 (89%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            + + CLSY+PPE++E    D+ EMRKL+DGHNLQ++DWL+ +M+QS LFNPR+RG KV+V
Sbjct  25   TTNACLSYSPPELNEVYDFDLKEMRKLLDGHNLQEQDWLFNLMVQSKLFNPRKRGEKVYV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A DYNQ MEQQR MTM+RI +LL+ GVF+GWLT  G E+ELRKLALL+V  +FDHSL++K
Sbjct  85   APDYNQTMEQQREMTMKRISYLLERGVFEGWLTAKGAEAELRKLALLEVTGIFDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            +GVHF LWGGAIQF GT+RHH++WLRDTENY V GCFAMTELGHGSNVRGIETVTTYD+ 
Sbjct  145  IGVHFFLWGGAIQFFGTQRHHEKWLRDTENYVVLGCFAMTELGHGSNVRGIETVTTYDAN  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEF+INTPCESAQKYWIGGAANHATHTIVFSQL+I+GK+QGVHAFI QI
Sbjct  205  TGEFIINTPCESAQKYWIGGAANHATHTIVFSQLEINGKNQGVHAFICQI  254



>ref|XP_007043726.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
 gb|EOX99557.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
Length=676

 Score =   384 bits (985),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL Y+PPE+SE    D+ EMR+L+DGH++ DRDWL+G+M+QS LFNPR RGGKVFV
Sbjct  30   SSNACLDYSPPELSEGYAFDIKEMRQLLDGHHVADRDWLFGMMMQSKLFNPRVRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +LL+ GVFKGWLTE G E+E+RK A  + + LFDHS+++K
Sbjct  90   SPDYNQSMEQQREMTWKRIVYLLERGVFKGWLTEKGEEAEMRKFAYFEAVGLFDHSIAIK  149

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY +KGCFAMTELGHGSNVRGIETVTTYDS 
Sbjct  150  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYLIKGCFAMTELGHGSNVRGIETVTTYDSN  209

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  210  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGTNQGVHAFIAQI  259



>ref|XP_007043727.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
 gb|EOX99558.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
Length=642

 Score =   382 bits (982),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL Y+PPE+SE    D+ EMR+L+DGH++ DRDWL+G+M+QS LFNPR RGGKVFV
Sbjct  30   SSNACLDYSPPELSEGYAFDIKEMRQLLDGHHVADRDWLFGMMMQSKLFNPRVRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +LL+ GVFKGWLTE G E+E+RK A  + + LFDHS+++K
Sbjct  90   SPDYNQSMEQQREMTWKRIVYLLERGVFKGWLTEKGEEAEMRKFAYFEAVGLFDHSIAIK  149

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY +KGCFAMTELGHGSNVRGIETVTTYDS 
Sbjct  150  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYLIKGCFAMTELGHGSNVRGIETVTTYDSN  209

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  210  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGTNQGVHAFIAQI  259



>ref|XP_010522108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Tarenaya hassleriana]
Length=680

 Score =   384 bits (985),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 206/232 (89%), Gaps = 2/232 (1%)
 Frame = +3

Query  3    SASP--CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKV  176
            S SP  CL Y+PP+++E  G D+ EMRKL+DGHN++DRDWLYG+MIQS+LFN RERGGK+
Sbjct  29   SLSPEVCLQYSPPQLNESYGFDIKEMRKLLDGHNVEDRDWLYGLMIQSNLFNRRERGGKI  88

Query  177  FVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLS  356
            FV+ DYNQ MEQQR +TMRRI +LL+ GVF+GWLT+ G E+EL+K +LL++  +FDHSL+
Sbjct  89   FVSPDYNQTMEQQREITMRRIWYLLEKGVFQGWLTKTGAEAELKKFSLLEICGIFDHSLA  148

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            +K+GVHF LW GAIQF GT+RHH++WL+DTE+Y VKGCFAMTELGHGSNVRGIETVTTYD
Sbjct  149  IKIGVHFFLWAGAIQFFGTRRHHEKWLKDTEDYVVKGCFAMTELGHGSNVRGIETVTTYD  208

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             RTGEF+INTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  209  PRTGEFIINTPCESAQKYWIGGAANHATHTIVFSQLDINGTNQGVHAFIAQI  260



>ref|XP_007043725.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOX99556.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
Length=690

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL Y+PPE+SE    D+ EMR+L+DGH++ DRDWL+G+M+QS LFNPR RGGKVFV
Sbjct  44   SSNACLDYSPPELSEGYAFDIKEMRQLLDGHHVADRDWLFGMMMQSKLFNPRVRGGKVFV  103

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +LL+ GVFKGWLTE G E+E+RK A  + + LFDHS+++K
Sbjct  104  SPDYNQSMEQQREMTWKRIVYLLERGVFKGWLTEKGEEAEMRKFAYFEAVGLFDHSIAIK  163

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY +KGCFAMTELGHGSNVRGIETVTTYDS 
Sbjct  164  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYLIKGCFAMTELGHGSNVRGIETVTTYDSN  223

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  224  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGTNQGVHAFIAQI  273



>ref|XP_004248185.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum lycopersicum]
Length=683

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 201/228 (88%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE+ EP  + D  EMRKLMDGHN  ++DWL+G+M+QS+LFNP ERGGKVFV+ 
Sbjct  38   PCLSYNPPELLEPSAIFDTKEMRKLMDGHNFVEKDWLFGLMLQSNLFNPIERGGKVFVSP  97

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+ EQQR +TM+RIG+LL+ GVFK WLT  G E ELRKL LLD + ++DHSL++K+G
Sbjct  98   DYNQSKEQQREITMKRIGYLLEHGVFKKWLTGKGHEDELRKLGLLDCLGIYDHSLAIKVG  157

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAIQF GTKRHHD+WL+DTE+Y +KGCF+MTELGHGSNVRGIETVTTYDS TG
Sbjct  158  VHFFLWGGAIQFFGTKRHHDKWLKDTEDYVIKGCFSMTELGHGSNVRGIETVTTYDSSTG  217

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHTIVFSQL IDG++QGVHAFIAQI
Sbjct  218  EFVINTPCESAQKYWIGGAANHATHTIVFSQLIIDGENQGVHAFIAQI  265



>ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE+SEP  + D+ EMRKLMDGHNL++RDW +G+++QS LFNP +RGGKVF++ 
Sbjct  40   PCLSYNPPELSEPAAVFDIKEMRKLMDGHNLEERDWFFGLILQSKLFNPVKRGGKVFLSP  99

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DY+Q+ EQQR +TMRRI +L++ G  K WLT  GPE ELRKL+LLD + +FDHSLSVK+G
Sbjct  100  DYSQSKEQQREITMRRIEYLVEHGFSKNWLTVKGPEDELRKLSLLDCLFIFDHSLSVKMG  159

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF+LWGGAIQF GTKRHHD+WL+DTE+Y VKGCF+MTELGHGSNVR IETVTTYDS TG
Sbjct  160  VHFLLWGGAIQFFGTKRHHDKWLKDTEDYVVKGCFSMTELGHGSNVRSIETVTTYDSSTG  219

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHTIVFSQL IDG++QGVHAFIAQI
Sbjct  220  EFVINTPCESAQKYWIGGAANHATHTIVFSQLIIDGENQGVHAFIAQI  267



>ref|XP_009783430.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana sylvestris]
Length=686

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 199/228 (87%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE SEP  + D+ EMRKL+DG+NLQ+RDWL+G+M+QS+LFN + RGGKVFV  
Sbjct  41   PCLSYNPPEFSEPFSVFDIKEMRKLLDGYNLQERDWLFGLMLQSNLFNTKVRGGKVFVCP  100

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DY+Q+ EQQR +TMRRIG+L+  GVF+ WLT  GPE ELRK   +DV+ +FDHSL +KLG
Sbjct  101  DYDQSKEQQREITMRRIGYLMQNGVFERWLTGKGPEDELRKFDFVDVVGIFDHSLKIKLG  160

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF LWGGAI+F GT+RHHD+WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYDS T 
Sbjct  161  VHFFLWGGAIKFFGTQRHHDKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDSSTR  220

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHT+VFSQL IDGK+QGVHAFIAQI
Sbjct  221  EFVINTPCESAQKYWIGGAANHATHTVVFSQLHIDGKNQGVHAFIAQI  268



>ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
 gb|EOA39249.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
Length=675

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMRKL+DGHN+ DRDW+YG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNEICGFDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE GPE+ELRKLALL+V  L+DHS+S+K+GVH
Sbjct  94   NQTMEQQREITMKRIWYLLENGVFKGWLTETGPEAELRKLALLEVCGLYDHSVSIKVGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD R+ EF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPRSEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
 gb|ESQ36290.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
Length=675

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G +V EMRKL+DGHN++DRDWLYG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESYGFEVKEMRKLLDGHNMEDRDWLYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE GP++EL+KLALL+V  ++DHSLS+KLGVH
Sbjct  94   NQTMEQQREVTMKRIWYLLERGVFKGWLTETGPDAELKKLALLEVCGIYDHSLSIKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GT+RHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD RTGEF
Sbjct  154  FFLWGNAVKFFGTRRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAA HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAAKHATHTIVFSQLDINGTNQGVHAFIAQI  259



>ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum lycopersicum]
Length=686

 Score =   382 bits (980),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 201/228 (88%), Gaps = 1/228 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PCLSY PPE+SE   + D+ EMRKLMDGHNL++RDW +G+++QS LFNP  RGGKVF++ 
Sbjct  41   PCLSYNPPELSETAAVFDIKEMRKLMDGHNLEERDWFFGLILQSKLFNPVRRGGKVFLSP  100

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DY+Q+ EQQR MTMRRI +L++ G  K WLT  GPE ELRKLALLD I ++DHSLS+K+G
Sbjct  101  DYSQSKEQQREMTMRRIEYLVEHGFSKDWLTVKGPEDELRKLALLDCIFIYDHSLSIKMG  160

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF+LWGGAIQF GTKRHHD+WL+DTE+Y +KGCF+MTELGHGSNVRGIETVTTYDS TG
Sbjct  161  VHFLLWGGAIQFFGTKRHHDKWLKDTEDYVIKGCFSMTELGHGSNVRGIETVTTYDSSTG  220

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHTIVFSQL IDG++QGVHAFIAQI
Sbjct  221  EFVINTPCESAQKYWIGGAANHATHTIVFSQLIIDGENQGVHAFIAQI  268



>emb|CDY10192.1| BnaC05g04350D [Brassica napus]
Length=677

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMR+L+DGHN +DRDWLYG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  36   CLQYSPPELNESYGFDVKEMRRLLDGHNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPDY  95

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GV++GWLT++GPE+EL+KLALL+V  ++DHSLS+KLGVH
Sbjct  96   NQTMEQQREITMKRIWYLLEKGVYRGWLTDSGPEAELKKLALLEVCGIYDHSLSIKLGVH  155

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD RTGEF
Sbjct  156  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEF  215

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAA HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  216  VINTPCESAQKYWIGGAAKHATHTIVFSQLNINGTNQGVHAFIAQI  261



>ref|XP_009119069.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Brassica rapa]
 emb|CDY57818.1| BnaA10g28060D [Brassica napus]
Length=675

 Score =   381 bits (978),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMR+L+DGHN +DRDWLYG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESYGFDVKEMRRLLDGHNTEDRDWLYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GV++GWLT++GPE+EL+KLALL+V  ++DHSLS+KLGVH
Sbjct  94   NQTMEQQREITMKRIWYLLEKGVYRGWLTDSGPEAELKKLALLEVCGIYDHSLSIKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD RTGEF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPRTGEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAA HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAAKHATHTIVFSQLNINGTNQGVHAFIAQI  259



>gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
Length=675

 Score =   381 bits (978),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMRKL+DGHN+ DRDW+YG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE GPE+ELRKLALL+V  ++DHS+S+K+GVH
Sbjct  94   NQTMEQQREITMKRIWYLLENGVFKGWLTETGPEAELRKLALLEVCGIYDHSVSIKVGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD +T EF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPKTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
 sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 
3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA 
oxidase; Short=AtCX3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana]
 gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
 gb|AAP37772.1| At1g06290 [Arabidopsis thaliana]
 dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
Length=675

 Score =   381 bits (978),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMRKL+DGHN+ DRDW+YG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE GPE+ELRKLALL+V  ++DHS+S+K+GVH
Sbjct  94   NQTMEQQREITMKRIWYLLENGVFKGWLTETGPEAELRKLALLEVCGIYDHSVSIKVGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD +T EF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPKTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>gb|KFK42952.1| hypothetical protein AALP_AA1G060500 [Arabis alpina]
Length=675

 Score =   380 bits (977),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G ++ EMRKL+DGHN++DRDWLYG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESYGFELNEMRKLLDGHNVEDRDWLYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LLD GVFKGWLTE+GPESEL+KLALL+V  ++DHS+S+KLGVH
Sbjct  94   NQTMEQQREITMKRIWYLLDNGVFKGWLTESGPESELKKLALLEVCGIYDHSVSIKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GT+RHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYDSRT EF
Sbjct  154  FFLWGNAVKFFGTRRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDSRTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAA HATHTIVFSQL I+  +QGVHAFIAQI
Sbjct  214  VINTPCESAQKYWIGGAAKHATHTIVFSQLNINRTNQGVHAFIAQI  259



>gb|KJB12480.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=548

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CLSY+PPE+SE    D+ +MRKL+D HNL++RDWL+G+M QS LFNP+ RGGKVFV
Sbjct  50   SSNACLSYSPPELSENYAFDIKDMRKLIDRHNLEERDWLFGLMKQSKLFNPKVRGGKVFV  109

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT++RI +LL+ G FKGWLTE G + E+RK A  +V +++DHSL  K
Sbjct  110  SPDYNQSMEQQREMTLKRIEYLLEKGAFKGWLTEKGEDIEMRKFAGFEVCSIYDHSLFTK  169

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY++KGCFAMTELGHGSNVRG+ETVTTYDS 
Sbjct  170  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYSIKGCFAMTELGHGSNVRGLETVTTYDSN  229

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHT+VFSQL I+G +QGVHAFI QI
Sbjct  230  TGEFVINTPCESAQKYWIGGAANHATHTVVFSQLHINGTNQGVHAFIVQI  279



>ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Glycine 
max]
Length=675

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 196/227 (86%), Gaps = 0/227 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            PCLSY+PPE+S     D  EMRKLMD HNL++RDW++ +++QS LFNPR R G+VFV+ D
Sbjct  32   PCLSYSPPELSNTISFDTREMRKLMDCHNLEERDWIFSLILQSPLFNPRHRAGRVFVSPD  91

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ ME QR  TM+RIG+LL  GVF+GWLT NGPE ELRKLAL +VI ++DHSL+VKLGV
Sbjct  92   YNQPMEHQRQATMKRIGYLLQKGVFRGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGV  151

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF LWGGA++FLGTKRHHD+WL  TENY +KGCFAM+ELGHGSNVRGIETVTTYDS TGE
Sbjct  152  HFFLWGGAVKFLGTKRHHDKWLNSTENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGE  211

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCES QKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  212  FVINTPCESGQKYWIGGAANHATHTIVFSQLYINGSNQGVHAFIAQI  258



>ref|XP_003607535.1| Acyl-coenzyme A oxidase 3, peroxisomal [Medicago truncatula]
 gb|AES89732.1| peroxisomal acyl-CoA oxidase [Medicago truncatula]
Length=678

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = +3

Query  15   CLSYTPPEVSE--PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            CLS++PPE+SE  P   D +EMRKL+DGHNL+DRDWL+G+MIQS LFN RE  G+VFV  
Sbjct  33   CLSHSPPELSESNPTTFDTFEMRKLLDGHNLEDRDWLFGLMIQSGLFNRREVDGRVFVNP  92

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+MEQQR MTM+RI +LLD GVF+GWLT +GP+ ELRKLAL +VI ++DHSL+VKLG
Sbjct  93   DYNQSMEQQREMTMKRIAYLLDRGVFRGWLTGDGPQEELRKLALHEVIGMYDHSLAVKLG  152

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VH  LWGGA++FLGTKRHHD+WLR TENY +KGCFAM+ELGHGSNVRGIETVTTYD  +G
Sbjct  153  VHIFLWGGAVKFLGTKRHHDKWLRATENYDIKGCFAMSELGHGSNVRGIETVTTYDPISG  212

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  213  EFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGSNQGVHAFIAQI  260



>ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cicer 
arietinum]
Length=678

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = +3

Query  15   CLSYTPPEVSE--PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            CLSY+PPE+SE  P   DV EMR+L+DGHN+++RDWL+G+MIQS LFN RE  G+VFV+ 
Sbjct  33   CLSYSPPELSESNPVTFDVTEMRRLLDGHNIEERDWLFGLMIQSRLFNQREVDGRVFVSP  92

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            DYNQ+MEQQR MTM+RI +LLD GVF+GWLT  GP+ ELRKLAL +VI ++DHSL+VK+G
Sbjct  93   DYNQSMEQQREMTMKRIAYLLDRGVFRGWLTGEGPQDELRKLALHEVIGMYDHSLAVKIG  152

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VH  LWGGA++FLGTKRHHD+WLR TEN  +KGCFAM+ELGHGSNVRGIETVTTYDS TG
Sbjct  153  VHIFLWGGAVKFLGTKRHHDKWLRATENNEMKGCFAMSELGHGSNVRGIETVTTYDSNTG  212

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTPCESAQKYWIGGAANH+THTIVFSQL I+G +QGVHAFIAQI
Sbjct  213  EFVINTPCESAQKYWIGGAANHSTHTIVFSQLNINGSNQGVHAFIAQI  260



>ref|XP_008455941.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
melo]
Length=677

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S +PCL ++PPE+SE    D+ EMR L+DGHNL DRDW++G+M+QS LFNP + GG+VFV
Sbjct  25   SPNPCLQFSPPELSERFSFDIVEMRNLLDGHNLPDRDWIFGLMVQSKLFNPFQSGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+M+QQR MTM+RI +LLD GVFKGWLT+NG E+  RK AL + I ++DHSL++K
Sbjct  85   SPDYNQSMQQQREMTMKRIEYLLDNGVFKGWLTDNGIEAVWRKFALFEAIGIYDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD WL++TENYA++GCFAM+ELGHGSNVRGIETVT YDS 
Sbjct  145  LGVHFHLWGGAIQFFGTKRHHDAWLKNTENYAIRGCFAMSELGHGSNVRGIETVTKYDSS  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATH IVFSQL I+GK++GVHAFIAQI
Sbjct  205  TGEFVINTPCESAQKYWIGGAANHATHAIVFSQLDINGKNEGVHAFIAQI  254



>ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMRKL+DGHN+ DRDW+YG+M+QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNENYGFDVKEMRKLLDGHNVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE GPE+ELRKLALL+V  ++DHS+S+K+GVH
Sbjct  94   NQTMEQQREITMKRIWYLLENGVFKGWLTETGPEAELRKLALLEVCGIYDHSVSIKVGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIET+TTYD  T EF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETLTTYDPTTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VI TPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VITTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>ref|XP_011013714.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=643

 Score =   374 bits (961),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            ++ CLSY+PPE++E    DV EMRK++D HNL+DRDWL+G++ Q  +FN +ERGG++FV+
Sbjct  34   SNSCLSYSPPELAESFDFDVKEMRKILDFHNLEDRDWLFGVIKQGSVFNGKERGGRLFVS  93

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ MEQQR MTM+RI +LL+ G F GWLT+ G ++EL+KLA L+VI +FDHSLSVK+
Sbjct  94   PDYNQTMEQQREMTMKRIEYLLERGAFDGWLTKKGVQAELKKLAFLEVIQIFDHSLSVKI  153

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGAIQF+GTKRHHD+WLRDTE +A+KGCF+MTELGHGSNVRGIETVTTYDS+T
Sbjct  154  GVHFFLWGGAIQFMGTKRHHDKWLRDTETFAIKGCFSMTELGHGSNVRGIETVTTYDSKT  213

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G ++GVHA IAQI
Sbjct  214  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGVNEGVHALIAQI  262



>ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
 gb|KGN63212.1| hypothetical protein Csa_2G415540 [Cucumis sativus]
Length=681

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            + +PCL ++PPE+SE    D+ EMR L+D HNL DRDW++G+M+QS LFNP + GG+VFV
Sbjct  25   TPNPCLQFSPPELSERFSFDIVEMRNLLDAHNLPDRDWIFGLMVQSKLFNPLQSGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+M+QQR MTM+RI +LLD GVFKGWLT+NG E+  RK AL + I ++DHSL++K
Sbjct  85   SPDYNQSMQQQREMTMKRIEYLLDNGVFKGWLTDNGIEAAWRKFALFEAIGIYDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD WL++TENYA++GCFAM+ELGHGSNVRGIETVT YDS 
Sbjct  145  LGVHFHLWGGAIQFFGTKRHHDAWLKNTENYAIRGCFAMSELGHGSNVRGIETVTKYDSS  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATH IVFSQL I+GK++GVHAFIAQI
Sbjct  205  TGEFVINTPCESAQKYWIGGAANHATHAIVFSQLDINGKNEGVHAFIAQI  254



>ref|XP_004171897.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
Length=681

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            + +PCL ++PPE+SE    D+ EMR L+D HNL DRDW++G+M+QS LFNP + GG+VFV
Sbjct  25   TPNPCLQFSPPELSERFSFDIVEMRNLLDAHNLPDRDWIFGLMVQSKLFNPLQSGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+M+QQR MTM+RI +LLD GVFKGWLT+NG E+  RK AL + I ++DHSL++K
Sbjct  85   SPDYNQSMQQQREMTMKRIEYLLDNGVFKGWLTDNGIEAAWRKFALFEAIGIYDHSLAIK  144

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD WL++TENYA++GCFAM+ELGHGSNVRGIETVT YDS 
Sbjct  145  LGVHFHLWGGAIQFFGTKRHHDAWLKNTENYAIRGCFAMSELGHGSNVRGIETVTKYDSS  204

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATH IVFSQL I+GK++GVHAFIAQI
Sbjct  205  TGEFVINTPCESAQKYWIGGAANHATHAIVFSQLDINGKNEGVHAFIAQI  254



>gb|KDP31760.1| hypothetical protein JCGZ_12221 [Jatropha curcas]
Length=680

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            C+SY+PPE+ E    D  EMRKL+D HN+ DRDWL+G+M QS +FNPRE+GG+V+VA DY
Sbjct  37   CVSYSPPELHERCDFDPNEMRKLLDMHNIDDRDWLFGLMRQSKVFNPREKGGRVYVAPDY  96

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ+MEQQR +TMRR+ +LL+ GVF GWLT  G ESE++K+AL +VI +FDHSL++KLGVH
Sbjct  97   NQSMEQQREITMRRVAYLLERGVFDGWLTGKGLESEMKKMALFEVIGMFDHSLAIKLGVH  156

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWGGAIQF GT+RHHD+WLRDTE YA+KGCFAMTELGHGSNVRGIETVT YDS TGEF
Sbjct  157  FFLWGGAIQFFGTERHHDKWLRDTETYAIKGCFAMTELGHGSNVRGIETVTIYDSNTGEF  216

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL I+G  +GVHAFIAQI
Sbjct  217  VINTPCESAQKYWIGGAANHATHTIVFSQLNINGMSEGVHAFIAQI  262



>gb|KJB12478.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
 gb|KJB12479.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=694

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CLSY+PPE+SE    D+ +MRKL+D HNL++RDWL+G+M QS LFNP+ RGGKVFV
Sbjct  50   SSNACLSYSPPELSENYAFDIKDMRKLIDRHNLEERDWLFGLMKQSKLFNPKVRGGKVFV  109

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT++RI +LL+ G FKGWLTE G + E+RK A  +V +++DHSL  K
Sbjct  110  SPDYNQSMEQQREMTLKRIEYLLEKGAFKGWLTEKGEDIEMRKFAGFEVCSIYDHSLFTK  169

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY++KGCFAMTELGHGSNVRG+ETVTTYDS 
Sbjct  170  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYSIKGCFAMTELGHGSNVRGLETVTTYDSN  229

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHT+VFSQL I+G +QGVHAFI QI
Sbjct  230  TGEFVINTPCESAQKYWIGGAANHATHTVVFSQLHINGTNQGVHAFIVQI  279



>ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|ERP54199.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=673

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            ++ CLSY+PPE++E    D+ EMRK++D HNL+DRDWL+G++ Q  +FN +ERGG++FV+
Sbjct  34   SNSCLSYSPPELTESFDFDIKEMRKILDFHNLEDRDWLFGVIKQGRVFNGKERGGRLFVS  93

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ MEQQR MTM+RI +LL+ G F GWLT+ G E+EL+KLALL+ I +FDHSL++K+
Sbjct  94   PDYNQTMEQQREMTMKRIEYLLERGAFDGWLTKKGVEAELKKLALLEAIQIFDHSLAIKI  153

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGAIQF+GTKRHHD+WLRDTE +A+KGCF+MTELGHGSNVRGIETVTTYDS+T
Sbjct  154  GVHFFLWGGAIQFMGTKRHHDKWLRDTETFAIKGCFSMTELGHGSNVRGIETVTTYDSKT  213

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G ++GVHA IAQI
Sbjct  214  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGVNEGVHALIAQI  262



>ref|XP_011013710.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Populus euphratica]
Length=680

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            ++ CLSY+PPE++E    D+ EMRK++D HNL+DRDWL+G++ Q  +FN +ERGG++FV+
Sbjct  34   SNSCLSYSPPELTESFDFDIKEMRKILDFHNLEDRDWLFGVIKQGSVFNGKERGGRLFVS  93

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ MEQQR MTM+RI +LL+ G F GWLT+ G E+EL+KLALL+VI +FDHSL++K 
Sbjct  94   PDYNQTMEQQREMTMKRIEYLLERGAFDGWLTKKGVEAELKKLALLEVIEIFDHSLAIKT  153

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGAIQF+GTKRHHD+WLRDTE +A+KGCF+MTELGHGSNVRGIETVTTYDS+T
Sbjct  154  GVHFFLWGGAIQFMGTKRHHDKWLRDTETFAIKGCFSMTELGHGSNVRGIETVTTYDSKT  213

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G ++GVHA IAQI
Sbjct  214  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGVNEGVHALIAQI  262



>ref|XP_010457756.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=675

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E    DV EMRKL+DGHN+ DRDW+YG+M QS+LFN +ERGGK+FV+ DY
Sbjct  34   CLQYSPPELNESCVFDVKEMRKLLDGHNVVDRDWIYGLMTQSNLFNRKERGGKIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVFKGWLTE+GP++ELRKLALL+V  ++DHS+S+K+GVH
Sbjct  94   NQTMEQQREITMKRIWYLLENGVFKGWLTESGPDAELRKLALLEVCGIYDHSVSIKVGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD  + EF
Sbjct  154  FFLWGNAVKFFGTKRHHEKWLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPTSEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VI TPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  214  VITTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  259



>ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Glycine max]
Length=675

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 191/224 (85%), Gaps = 0/224 (0%)
 Frame = +3

Query  21   SYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQ  200
            SY+PPE+S     D  EMRKLMD HNL+DRDWL+ +++QS LFNPR R G+ FV  DYNQ
Sbjct  35   SYSPPELSNTISFDTREMRKLMDCHNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQ  94

Query  201  NMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFI  380
             ME QR  TM+RI +LLD GVF+GWLT NGPE ELRKLAL +VI ++DHSL+VKLGVHF 
Sbjct  95   PMEHQRQATMKRIAYLLDKGVFRGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFF  154

Query  381  LWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVI  560
            LWGGA++FLGTKRHHD+WL  TENY +KGCFAM+ELGHGSNVRGIETVTTYDS TGEFVI
Sbjct  155  LWGGAVKFLGTKRHHDKWLNSTENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVI  214

Query  561  NTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            NTPCES QKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  215  NTPCESGQKYWIGGAANHATHTIVFSQLYINGSNQGVHAFIAQI  258



>ref|XP_010475360.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=676

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E    DV EMRKL+DGH++ DRDW+YG+M QS+LFN +ERGGK+FV+ DY
Sbjct  35   CLQYSPPELNESCVFDVKEMRKLLDGHDVVDRDWIYGLMTQSNLFNRKERGGKIFVSPDY  94

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR +TM+RI +LL+ GVF+GWLTE+GPE+ELRKLALL+V  ++DHS+S+K+GVH
Sbjct  95   NQTMEQQREITMKRIWYLLENGVFQGWLTESGPEAELRKLALLEVCGIYDHSVSIKVGVH  154

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWG A++F GTKRHH++WL+ TE+Y VKGCFAMTELGHGSNVRGIETVTTYD  T EF
Sbjct  155  FFLWGNAVKFFGTKRHHEKWLKSTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPTTEEF  214

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VI+TPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  215  VISTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  260



>gb|KJB12486.1| hypothetical protein B456_002G020700 [Gossypium raimondii]
Length=672

 Score =   370 bits (951),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CLSY+PPE+SE    DV EMRKL+DGHNL++RDWL+G+M QS LFNP+ RGGKVFV
Sbjct  28   SSNACLSYSPPELSENCAFDVKEMRKLIDGHNLEERDWLFGLMKQSELFNPKVRGGKVFV  87

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT++RI +L + GVFKGWLTE G E E+RK A  +V +++DHSL  K
Sbjct  88   SPDYNQSMEQQREMTLKRIKYLQERGVFKGWLTEKGEEIEMRKFAGFEVFSIYDHSLFTK  147

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF +WGGAIQF GTK HHD+WLRDTENY++KGCFAMTELGHGSN+R +ETVTTYDS 
Sbjct  148  LGVHFPMWGGAIQFCGTKHHHDKWLRDTENYSIKGCFAMTELGHGSNIRSLETVTTYDSN  207

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQK+WIGGAA HATHT+VFSQL I+G +QGVHAFI QI
Sbjct  208  TGEFVINTPCESAQKFWIGGAAKHATHTVVFSQLHINGINQGVHAFIVQI  257



>gb|KHG26832.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=670

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CLSY+PPE+SE    D+ +MRKL+D HNL++RDWL+G+M QS LFNP+ RGGKVFV+ DY
Sbjct  30   CLSYSPPELSENYAFDIKDMRKLIDRHNLEERDWLFGLMKQSKLFNPKVRGGKVFVSPDY  89

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ+MEQQR MT++RI +LL+ G FKGWLTE G + E+RK A  +V +++DHSL  KLGVH
Sbjct  90   NQSMEQQREMTLKRIEYLLEKGAFKGWLTEKGEDIEMRKFAGFEVCSIYDHSLFTKLGVH  149

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWGGAIQF GTK HHD+WLRDTENY +KGCFAMTELGHGSNVRGIETVTTYDS TGEF
Sbjct  150  FFLWGGAIQFFGTKHHHDKWLRDTENYWIKGCFAMTELGHGSNVRGIETVTTYDSNTGEF  209

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHT+VFSQL I+G +QGVHAFI QI
Sbjct  210  VINTPCESAQKYWIGGAANHATHTVVFSQLHINGTNQGVHAFIVQI  255



>gb|EYU29818.1| hypothetical protein MIMGU_mgv1a002427mg [Erythranthe guttata]
Length=676

 Score =   370 bits (951),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 201/231 (87%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGG-LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVF  179
            S SPCLSY PPE SEP    DV  MRKLMDGHNL DRDW++ +MIQS LFNP+ RGGKVF
Sbjct  28   SRSPCLSYAPPETSEPPSPFDVSSMRKLMDGHNLVDRDWVFNLMIQSKLFNPKMRGGKVF  87

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V  DYNQ+MEQQR +TM+RI +LLD GVF GWLT  G ESE+RKLALL+VI +FDHSL++
Sbjct  88   VVPDYNQSMEQQREITMKRIQYLLDHGVFDGWLTGRGFESEMRKLALLEVIEIFDHSLAI  147

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWGGAIQF GTKRHHD+WL  TENY +KGCF+MTELGHGSNVRGIETVTTYDS
Sbjct  148  KIGVHFFLWGGAIQFFGTKRHHDKWLSATENYLIKGCFSMTELGHGSNVRGIETVTTYDS  207

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            ++GEFVINTPCESAQKYWIGGAANHATHT+VFSQL +DGK++GVHAFI QI
Sbjct  208  KSGEFVINTPCESAQKYWIGGAANHATHTVVFSQLNVDGKNEGVHAFITQI  258



>gb|KJB50144.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=676

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL+Y+PPE+SE    D+ +MRKLMDGH+L++RD L+G++ QS +FNPR RGGKVFV
Sbjct  30   SSNACLNYSPPELSEKYAFDISDMRKLMDGHDLEERDRLFGMITQSKVFNPRVRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +L + GVF+GWLT  G E E+R+ A  +V+ LFDHS+S+K
Sbjct  90   SPDYNQSMEQQREMTWKRIEYLFERGVFQGWLTGEGEEVEMRRFACFEVLGLFDHSISIK  149

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTK HHD+WLRDTENY +KGCFAMTELGHGSNVRGIET+TTYDS 
Sbjct  150  LGVHFFLWGGAIQFFGTKHHHDKWLRDTENYLIKGCFAMTELGHGSNVRGIETITTYDSN  209

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHA IAQI
Sbjct  210  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLNINGTNQGVHALIAQI  259



>ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
 gb|ESW04679.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
Length=674

 Score =   368 bits (944),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 194/226 (86%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CLSY+PPE+S     D  EMR+LMDGHNL+DRDWL+ +++QS LFN RER G++FV  DY
Sbjct  32   CLSYSPPELSNDFAFDAREMRRLMDGHNLEDRDWLFSVIVQSALFNRRERAGRIFVCPDY  91

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ+MEQQR  T++RI +L+  GVF+GWLT   PE ELRKLAL +V+ ++DHSL+VKLGVH
Sbjct  92   NQSMEQQREATLKRIEYLVKRGVFRGWLTGEAPEEELRKLALHEVLGMYDHSLAVKLGVH  151

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            + LWGGA++FLGTKRHHD+WL  TENY +KGCFAM+ELGHGSNVRGIET+TTYDS TGEF
Sbjct  152  YFLWGGAVKFLGTKRHHDKWLSATENYDMKGCFAMSELGHGSNVRGIETITTYDSNTGEF  211

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCES QKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  212  VINTPCESGQKYWIGGAANHATHTIVFSQLNINGSNQGVHAFIAQI  257



>ref|XP_010035824.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Eucalyptus 
grandis]
 gb|KCW47288.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=675

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 192/231 (83%), Gaps = 1/231 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGG-LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVF  179
            S +PCL Y+PPE++EP    DV  MR L+DGHN+ +RDWL+G+M QS LFNPR  GG+VF
Sbjct  27   SGAPCLDYSPPELAEPAAAFDVAAMRALLDGHNVAERDWLFGLMTQSKLFNPRRVGGRVF  86

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            VA DYNQ+MEQQR MTMRRI  LL+ GVF+GWLT    E ELRKLAL +V  ++DHSL++
Sbjct  87   VAPDYNQSMEQQREMTMRRIEFLLERGVFEGWLTAGTAEGELRKLALQEVANIYDHSLAI  146

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K GVHF LWGGAIQF GT+RHH +WLRDTENY VKGCFAMTELGHGSNVRGIETVTTYD 
Sbjct  147  KFGVHFFLWGGAIQFFGTERHHVKWLRDTENYVVKGCFAMTELGHGSNVRGIETVTTYDP  206

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            R  EF+INTPCESAQKYWIGGAANHATHT+ FSQL I+G +QGVHAFI QI
Sbjct  207  RAREFIINTPCESAQKYWIGGAANHATHTVAFSQLNINGINQGVHAFIVQI  257



>ref|XP_006852548.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
 gb|ERN14015.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
Length=678

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            ASPCL +TPPEVSE     D  E+R+L+DGH++++RDWL  +M   + F PRE GGKVFV
Sbjct  31   ASPCLQFTPPEVSEGSFSFDNLELRRLLDGHHVEERDWLLNLMAGCNYFCPREIGGKVFV  90

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
             ADYNQ+M+QQR +TM+RI  LL  GVF+GWLT  G E+EL+KLA L+ + +FDHSLS+K
Sbjct  91   GADYNQSMKQQREVTMKRISFLLSNGVFEGWLTRKGVEAELKKLAFLECLGIFDHSLSIK  150

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF LWGGAIQF GTKRHHD+WLRDTE YAVKGCFAM+ELGHGSNVRGIETVTTYDS 
Sbjct  151  LGVHFFLWGGAIQFFGTKRHHDKWLRDTECYAVKGCFAMSELGHGSNVRGIETVTTYDSN  210

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQKYWIGGAANHATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  211  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLHINGTNQGVHAFIAQI  260



>dbj|BAK06462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 194/229 (85%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            SPCLSY PPE SE P      E+R L+DGH+L++RDW YG M +S LF PR  G KVFV+
Sbjct  36   SPCLSYAPPESSEAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGDKVFVS  95

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRRIG+L   GVF+GWLTE GP++ELRKLALL+ + ++DHSL++K+
Sbjct  96   PDYNEGKEGQREATMRRIGYLARRGVFRGWLTEPGPDAELRKLALLECLGVYDHSLAIKV  155

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGA++FLGTKRHHD+WL DTENY +KGCFAMTELGHGSNVRGIETV TYDS+T
Sbjct  156  GVHFFLWGGAVKFLGTKRHHDKWLLDTENYIIKGCFAMTELGHGSNVRGIETVATYDSKT  215

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAFIAQI
Sbjct  216  GEFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFIAQI  264



>ref|XP_011002667.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=680

 Score =   365 bits (938),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CLSYTPPEV+E    D  EMRK++D HNL+DRDWL+G++ Q  +FN +ERGG++FV  DY
Sbjct  37   CLSYTPPEVTESLDFDTKEMRKILDFHNLEDRDWLFGVIKQGSVFNGKERGGRLFVLPDY  96

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR MTM+RI +L + GVF GWL + G E+EL+KLA L+VI  FD SL+V LGVH
Sbjct  97   NQTMEQQREMTMKRIKYLFERGVFDGWLMKKGVEAELKKLAFLEVIQNFDQSLAVMLGVH  156

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F LWGGAIQF+GTKRHHD+WLRDTE + +KGCF+MTELGHGSNVRGIETVTTYD +TGEF
Sbjct  157  FFLWGGAIQFMGTKRHHDKWLRDTETFGLKGCFSMTELGHGSNVRGIETVTTYDLKTGEF  216

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIGGAANHATHTIVFSQL IDG +QGVHAFIAQI
Sbjct  217  VINTPCESAQKYWIGGAANHATHTIVFSQLNIDGVNQGVHAFIAQI  262



>ref|XP_002325591.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|EEE99972.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=680

 Score =   363 bits (931),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = +3

Query  6    ASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            ++ CLSYTPPE +E    D  EMRK++D HNL+DRDWL+G++ Q  +FN +ERGG++FV 
Sbjct  34   SNSCLSYTPPEETESLDFDTKEMRKILDLHNLEDRDWLFGVIKQGKVFNGKERGGRLFVL  93

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             +YNQ MEQQR MTM+RI +L + GVF GWL + G E+EL+KLA LDVI  FD SL+V L
Sbjct  94   PEYNQTMEQQREMTMKRIEYLFERGVFDGWLMKKGVEAELKKLAFLDVIQNFDQSLAVML  153

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGAIQF+GTKRHHD+WLRDTE + +KGCF+MTELGHGSNVRGIETVTTYD +T
Sbjct  154  GVHFFLWGGAIQFMGTKRHHDKWLRDTETFGLKGCFSMTELGHGSNVRGIETVTTYDLKT  213

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAANHATHTIVFSQL IDG +QGVHAFIAQI
Sbjct  214  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLNIDGVNQGVHAFIAQI  262



>ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65857.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL Y+PPE++E  G DV EMRKL+DGHNL+DRDW YG+M+QS+LFN +ERGGK FV+ DY
Sbjct  34   CLQYSPPELNERYGFDVKEMRKLLDGHNLEDRDWFYGLMMQSNLFNRKERGGKGFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR ++M+RI +LL+ GVF+GWLTE GPE+EL K AL +V  ++D+SLS KLGVH
Sbjct  94   NQTMEQQRHISMKRILYLLENGVFQGWLTETGPEAELNKFALYEVCGIYDYSLSAKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F+LWG A++F GTKRHH++WL+DTE+Y VKGCFAMTELGHG+NVRGIETVTTYD+RT EF
Sbjct  154  FLLWGNAVKFFGTKRHHEKWLKDTEDYLVKGCFAMTELGHGTNVRGIETVTTYDARTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIG AANHA H IV SQL I+G +QGVH FIAQI
Sbjct  214  VINTPCESAQKYWIGEAANHANHAIVISQLSINGTNQGVHVFIAQI  259



>ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana]
 sp|Q9LMI7.1|ACO32_ARATH RecName: Full=Putative acyl-coenzyme A oxidase 3.2, peroxisomal; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82160.1|AC068143_2 Contains similarity to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis 
thaliana gb|AF057043 and contains an acyl-CoA oxidase 
PF|01756 domain [Arabidopsis thaliana]
 gb|AEE27973.1| acyl-CoA oxidase [Arabidopsis thaliana]
Length=675

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            C  Y+PPE++E  G +V EMRKL+DGHNL++RDWLYG+M+QS+LFNP++RGG++FV+ DY
Sbjct  34   CFQYSPPELNESYGFEVKEMRKLLDGHNLEERDWLYGLMMQSNLFNPKQRGGQIFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            NQ MEQQR ++M+RI +LL+ GVF+GWLTE GPE+EL+K AL +V  ++D+SLS KLGVH
Sbjct  94   NQTMEQQRQISMKRIFYLLEKGVFQGWLTETGPEAELKKFALYEVCGIYDYSLSAKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F+LWG A++F GTKRHH++WL+DTE+Y VKGCFAMTELGHG+NVRGIETVTTYD  T EF
Sbjct  154  FLLWGNAVKFFGTKRHHEKWLKDTEDYVVKGCFAMTELGHGTNVRGIETVTTYDPTTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIG AANHA H IV SQL ++G +QG+H FIAQI
Sbjct  214  VINTPCESAQKYWIGEAANHANHAIVISQLSMNGTNQGIHVFIAQI  259



>gb|KCW47289.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=678

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 192/234 (82%), Gaps = 4/234 (2%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGG-LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVF  179
            S +PCL Y+PPE++EP    DV  MR L+DGHN+ +RDWL+G+M QS LFNPR  GG+VF
Sbjct  27   SGAPCLDYSPPELAEPAAAFDVAAMRALLDGHNVAERDWLFGLMTQSKLFNPRRVGGRVF  86

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            VA DYNQ+MEQQR MTMRRI  LL+ GVF+GWLT    E ELRKLAL +V  ++DHSL++
Sbjct  87   VAPDYNQSMEQQREMTMRRIEFLLERGVFEGWLTAGTAEGELRKLALQEVANIYDHSLAI  146

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGS---NVRGIETVTT  530
            K GVHF LWGGAIQF GT+RHH +WLRDTENY VKGCFAMTELGHGS   NVRGIETVTT
Sbjct  147  KFGVHFFLWGGAIQFFGTERHHVKWLRDTENYVVKGCFAMTELGHGSNVCNVRGIETVTT  206

Query  531  YDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            YD R  EF+INTPCESAQKYWIGGAANHATHT+ FSQL I+G +QGVHAFI QI
Sbjct  207  YDPRAREFIINTPCESAQKYWIGGAANHATHTVAFSQLNINGINQGVHAFIVQI  260



>emb|CDY10194.1| BnaC05g04370D [Brassica napus]
Length=674

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 193/226 (85%), Gaps = 0/226 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADY  194
            CL YTPPEV+E  G  V EMRKL+DGHNL+DRDWLYGI+IQS+LFN + RGGKVFV+ DY
Sbjct  34   CLQYTPPEVNESYGFQVKEMRKLLDGHNLEDRDWLYGIIIQSNLFNRKIRGGKVFVSPDY  93

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            N+ MEQQR ++M+RI HLL+ GVFKGWLTE GPE+EL+K AL +V  ++D+SLS KLGVH
Sbjct  94   NETMEQQREISMKRILHLLEKGVFKGWLTETGPEAELKKFALYEVCGMYDYSLSAKLGVH  153

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
            F+LWG AI+F GTKRHH++WL+ TE+Y VKGCFAMTELGHGSNV+GIETVTTYD RT EF
Sbjct  154  FLLWGNAIKFFGTKRHHEKWLKHTEDYLVKGCFAMTELGHGSNVKGIETVTTYDPRTEEF  213

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            VINTPCESAQKYWIG AA HA H IV SQL+I+  +QG+H FIAQI
Sbjct  214  VINTPCESAQKYWIGEAAIHANHAIVISQLEINETNQGIHVFIAQI  259



>emb|CDY57822.1| BnaA10g28090D [Brassica napus]
Length=675

 Score =   357 bits (917),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 194/227 (85%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGG-KVFVAAD  191
            CL YTPPEV+E  G  V EMRKL+DGHNL+DRDWLYGI+IQS+LFN +ERGG KVFV+ D
Sbjct  34   CLQYTPPEVNESYGFQVKEMRKLLDGHNLEDRDWLYGIIIQSNLFNRKERGGGKVFVSPD  93

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN+ MEQQR ++M+RI + L+ GVFKGWLTE GPESEL+K AL +V  ++D+SLS KLGV
Sbjct  94   YNETMEQQREISMKRIMYFLENGVFKGWLTETGPESELKKFALYEVCGMYDYSLSAKLGV  153

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF+LWG AI+F GTKRHH++WL+DTE+Y VKGCFAMTELGHGSNV+GIETVT+YD RT E
Sbjct  154  HFLLWGNAIKFFGTKRHHEKWLKDTEDYLVKGCFAMTELGHGSNVKGIETVTSYDPRTEE  213

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIG AA HA H IV SQL+I+  +QG+H FIAQI
Sbjct  214  FVINTPCESAQKYWIGEAAIHANHAIVISQLEINETNQGIHVFIAQI  260



>gb|KHG11955.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=671

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CLSY+PPE+SE    DV EMRKL+D HNL++RDWL+G+M QS LFNP+ +GGKVFV
Sbjct  28   SSNACLSYSPPELSENYAFDVKEMRKLIDSHNLEERDWLFGLMKQSELFNPKVKGGKVFV  87

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT++RI +L + GVFKGWLTE G E E+RK +  ++ +++DHSL  K
Sbjct  88   SPDYNQSMEQQREMTLKRIKYLQERGVFKGWLTEKGEEIEMRKFSGFEIFSIYDHSLFTK  147

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF + GGAIQF GTK HHD+WLRDTENY++KGCFAMTELGHGSN+R +ETVTTYDS 
Sbjct  148  LGVHFPM-GGAIQFCGTKHHHDKWLRDTENYSIKGCFAMTELGHGSNIRSLETVTTYDSN  206

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TGEFVINTPCESAQK+WIGGAA HATHT+VFSQL I+G +QGVHAFI QI
Sbjct  207  TGEFVINTPCESAQKFWIGGAAKHATHTVVFSQLHINGINQGVHAFIVQI  256



>gb|KHN07770.1| Acyl-coenzyme A oxidase 3, peroxisomal [Glycine soja]
Length=624

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            MRKLMD HNL++RDW++ +++QS LFNPR R G+VFV+ DYNQ ME QR  TM+RIG+LL
Sbjct  1    MRKLMDCHNLEERDWIFSLILQSPLFNPRHRAGRVFVSPDYNQPMEHQRQATMKRIGYLL  60

Query  252  DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDE  431
              GVF+GWLT NGPE ELRKLAL +VI ++DHSL+VKLGVHF LWGGA++FLGTKRHHD+
Sbjct  61   QKGVFRGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFFLWGGAVKFLGTKRHHDK  120

Query  432  WLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAAN  611
            WL  TENY +KGCFAM+ELGHGSNVRGIETVTTYDS TGEFVINTPCES QKYWIGGAAN
Sbjct  121  WLNSTENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINTPCESGQKYWIGGAAN  180

Query  612  HATHTIVFSQLKIDGKDQGVHAFIAQI  692
            HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  181  HATHTIVFSQLYINGSNQGVHAFIAQI  207



>ref|XP_009119067.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Brassica rapa]
Length=676

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 193/227 (85%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGG-KVFVAAD  191
            CL YTPPEV+E  G DV EMRKL+D HNL+DRDWLYGI+IQS+LFN + RGG KVFV+ D
Sbjct  34   CLQYTPPEVNESYGFDVKEMRKLLDRHNLEDRDWLYGIIIQSNLFNRKIRGGGKVFVSPD  93

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN+ MEQQR ++M+RI +LL+ GVF+GWLTE  PE+EL+K AL +V  ++D+SLS KLGV
Sbjct  94   YNETMEQQREISMKRIMYLLEKGVFQGWLTETSPEAELKKFALYEVCGMYDYSLSAKLGV  153

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
             F+LWG A++  GTKRHHD+WL+DTE+Y VKGCFAMTELGHGSNVRGIETVTTYD  T E
Sbjct  154  QFLLWGNAVKLFGTKRHHDKWLKDTEDYLVKGCFAMTELGHGSNVRGIETVTTYDPMTEE  213

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIG AANHATH IV SQL+I+G +QG+H FIAQI
Sbjct  214  FVINTPCESAQKYWIGEAANHATHAIVISQLEINGTNQGIHVFIAQI  260



>ref|XP_010485961.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Camelina sativa]
Length=623

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            MRKL+DGHNL DRDW+YG+M QS+LFN +ERGGK+FV+ DYNQ MEQQR +TM+RI +LL
Sbjct  1    MRKLLDGHNLVDRDWIYGLMTQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLL  60

Query  252  DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDE  431
            + GVFKGWLTE+GPE+ELRKLALL+V  ++DHS+S+K+GVHF LWG A++F GTKRHH++
Sbjct  61   ENGVFKGWLTESGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEK  120

Query  432  WLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAAN  611
            WL++TE+Y VKGCFAMTELGHGSNVRGIETVTTYD  + EFVI+TPCESAQKYWIGGAAN
Sbjct  121  WLKNTEDYVVKGCFAMTELGHGSNVRGIETVTTYDPTSEEFVISTPCESAQKYWIGGAAN  180

Query  612  HATHTIVFSQLKIDGKDQGVHAFIAQI  692
            HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  181  HATHTIVFSQLHINGTNQGVHAFIAQI  207



>ref|XP_010689758.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=686

 Score =   353 bits (906),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            CLSY+PPE+SEP  + D  +MR L+D HN++ R+WL+ I++QS+LFNP  RG + FV  D
Sbjct  42   CLSYSPPELSEPCAVFDTNQMRSLLDSHNIEHRNWLFNIILQSNLFNPIIRGHRKFVIPD  101

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN +MEQQR +T +RI +L DCGVFKGWLT +  E ELR +A  +V+ALFDHSL++KLGV
Sbjct  102  YNHSMEQQREITFKRILYLRDCGVFKGWLTGHSQEDELRNMAFNEVLALFDHSLAIKLGV  161

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF LWGGAIQF GTKRHHD+WL+ TE Y +KGCFAMTELGHGSNVRGIET+TTYDS T E
Sbjct  162  HFFLWGGAIQFFGTKRHHDKWLKITEEYGIKGCFAMTELGHGSNVRGIETITTYDSNTEE  221

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            F+INTPCESAQKYWIGGAA HATHT+VFSQLKI+GKD+GVHAFI QI
Sbjct  222  FIINTPCESAQKYWIGGAAKHATHTVVFSQLKINGKDEGVHAFIVQI  268



>ref|XP_008784451.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Phoenix 
dactylifera]
Length=689

 Score =   351 bits (901),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 190/237 (80%), Gaps = 7/237 (3%)
 Frame = +3

Query  3    SASP------CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRER  164
            SASP      CL Y+PPEVSE    D  EMR+LMD H+L+ RDWL+ +M ++ LF PR R
Sbjct  34   SASPFLVPAACLRYSPPEVSEKAAFDSREMRRLMDDHDLEARDWLFRVMEENRLFCPRRR  93

Query  165  GG-KVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALF  341
            GG K FVA DYNQ  EQQR  TMRRI +LL  GVF+GWLT  G E+E+RK AL + + ++
Sbjct  94   GGEKAFVAPDYNQTKEQQREATMRRIEYLLGRGVFEGWLTGRGLEAEMRKFALFECVGIY  153

Query  342  DHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIET  521
            DHS+++KLGV F LWGGAIQFLGTKRHHD+WL+DTENY VKGCFAMTELGHGSNVRGIET
Sbjct  154  DHSIAIKLGVQFFLWGGAIQFLGTKRHHDKWLKDTENYVVKGCFAMTELGHGSNVRGIET  213

Query  522  VTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            + TYDS T EFVI+TPCESAQKYWIGGAA HATHTI+FSQL I+G  QGVHAFIAQI
Sbjct  214  IATYDSNTEEFVISTPCESAQKYWIGGAAKHATHTIIFSQLHINGTSQGVHAFIAQI  270



>ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis]
 gb|EEF37282.1| acyl-CoA oxidase, putative [Ricinus communis]
Length=625

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            MRKL+D HN++DRDWL+G+M QS +FNP E+GG+V+   DYNQ+ EQQR MTM+RIG++L
Sbjct  1    MRKLLDMHNIEDRDWLFGLMRQSKVFNPVEKGGRVYAVPDYNQSTEQQREMTMKRIGYML  60

Query  252  DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDE  431
            + GVF GWLT  G ESE++K A L+V  +FDHSLSVKLGVHF LWGGAIQF GTKRHHD+
Sbjct  61   ERGVFNGWLTGKGLESEMKKFAFLEVTGIFDHSLSVKLGVHFFLWGGAIQFFGTKRHHDK  120

Query  432  WLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAAN  611
            WLR+TE YA+KGCFAM+ELGHGSNVRGIETV TYDS TGEFVINTPCESAQKYWIGGAAN
Sbjct  121  WLRNTETYALKGCFAMSELGHGSNVRGIETVATYDSNTGEFVINTPCESAQKYWIGGAAN  180

Query  612  HATHTIVFSQLKIDGKDQGVHAFIAQI  692
            HATHTIVFSQL I+G +QGVHAFIAQI
Sbjct  181  HATHTIVFSQLNINGTNQGVHAFIAQI  207



>ref|XP_010916040.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Elaeis 
guineensis]
Length=747

 Score =   352 bits (902),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGG-KVFVAAD  191
            CL Y+PPE SE    D  EMR+LMDGH+L+ RDWL+ +M +S LF PR RGG KVFV  D
Sbjct  102  CLHYSPPEASEKASFDSCEMRRLMDGHDLEARDWLFRVMEESLLFCPRRRGGEKVFVVPD  161

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ  EQQR +TMRRI +LL  GVF GWLT  GPE+E+RK A  + + ++DHSL++KLGV
Sbjct  162  YNQTKEQQREVTMRRIEYLLGRGVFDGWLTGRGPEAEMRKFAFFECLGIYDHSLAIKLGV  221

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF LWGGAIQF GTKRHHD+WL+DTENY VKGCFAMTELGHGSNVRGIET+ TYDS T E
Sbjct  222  HFFLWGGAIQFFGTKRHHDKWLKDTENYDVKGCFAMTELGHGSNVRGIETIATYDSNTEE  281

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTP ESAQKYWIGGAA HATHTI+FSQL I+G +QGVHAFIAQI
Sbjct  282  FVINTPYESAQKYWIGGAAKHATHTIIFSQLHINGANQGVHAFIAQI  328



>ref|XP_006417936.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
 gb|ESQ36289.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
Length=648

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPE-VSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            CL Y+PPE ++   G ++ EMRKL+DGHN+++RDWLYG+M+QS+LFN +ERGGK+FV+ D
Sbjct  23   CLQYSPPEELNGSYGFEIKEMRKLLDGHNVEERDWLYGLMMQSNLFNRKERGGKIFVSPD  82

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ MEQQR +TM+RI +LL  GVFKGWLTE GP++E +K AL +V  ++D+S+  KLGV
Sbjct  83   YNQTMEQQREVTMKRIWYLLQKGVFKGWLTETGPDAEQKKFALYEVCGIYDYSIIAKLGV  142

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF+LWG A++F GTKRH D+WL+DTE+Y VKGC  MTELGHGSNV+GIETVTTYD RTGE
Sbjct  143  HFLLWGNAVKFFGTKRHDDKWLKDTEDYVVKGCLVMTELGHGSNVKGIETVTTYDPRTGE  202

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIG AAN+ATH IV SQL I+G +QG+H FIAQI
Sbjct  203  FVINTPCESAQKYWIGEAANYATHAIVISQLNINGTNQGIHVFIAQI  249



>gb|KHG13766.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=675

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 185/230 (80%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ C +YTPPE+SE    D  EMR+L+DGH+L+ RD L+G+M QS LFNPR RGGKVFV
Sbjct  29   SSNACFNYTPPELSEKYAFDTKEMRRLIDGHHLEVRDRLFGMMSQSKLFNPRVRGGKVFV  88

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ MEQQR +T++RI +L D G FKGWLT+ G E ELRK A  +V  +FDHS+   
Sbjct  89   SPDYNQPMEQQREITLKRIDYLFDRGAFKGWLTDQGEEIELRKFASFEVFGIFDHSMGTM  148

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            L VHF LWGGA+Q  GTK HH++WLRDTE   VKGCFAM+ELGHGSNVRG+ETVTTYDS 
Sbjct  149  LAVHFFLWGGAVQVFGTKHHHNKWLRDTETRVVKGCFAMSELGHGSNVRGVETVTTYDSN  208

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EFVI TPCESAQK+WIGGAANHATH IVFSQL I+G +QGVHAFIAQI
Sbjct  209  TQEFVITTPCESAQKFWIGGAANHATHAIVFSQLNINGSNQGVHAFIAQI  258



>ref|XP_009388733.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=679

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = +3

Query  15   CLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            CL Y PPE+SE P   D+  +R+++DGH+L  RDWL+ +M +S LF PR RG + FVA D
Sbjct  34   CLHYDPPELSEKPPAFDLAALRRVLDGHDLAARDWLFRLMEESPLFCPRRRGDRTFVAPD  93

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ  EQQR +TMRRI +LL  GVF+GW+T +GPE+ELRKLA  + IA++DHSLSVKLGV
Sbjct  94   YNQTKEQQRAVTMRRIEYLLRRGVFEGWITGSGPEAELRKLAFFECIAIYDHSLSVKLGV  153

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
             F LWGGAI+F GTKRHHD+WL+ TE+Y VKGCFAMTELGHGSNVRGIET+  YD+ T E
Sbjct  154  TFFLWGGAIRFFGTKRHHDKWLKATEDYQVKGCFAMTELGHGSNVRGIETIAIYDTNTRE  213

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIGGAANHATHTI+FSQL I+G  QG+HAF+AQI
Sbjct  214  FVINTPCESAQKYWIGGAANHATHTIIFSQLLINGTSQGIHAFVAQI  260



>ref|NP_001057591.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAD35410.1| putative acyl-CoA oxidase ACX3 [Oryza sativa Japonica Group]
 dbj|BAF19505.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAG90186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=685

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 189/229 (83%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            S CLSY PPE SEP       E+R L+DGH+L++RDW +  M +S LF  R  GGKVFV+
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRR+G+L   GVF+GWLTE GP++ELRKLALL+ + ++DHSL++K+
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLAIKI  158

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWG AI+FLGTKRHHD+WL DTENY +KGCF+MTELGHGSNVRGIETV TYD +T
Sbjct  159  GVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATYDIKT  218

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAF+AQI
Sbjct  219  REFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVAQI  267



>gb|KJB31620.1| hypothetical protein B456_005G198300 [Gossypium raimondii]
Length=674

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 185/230 (80%), Gaps = 0/230 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ C +YT PE+SE    D  EMR+L+DGH+L+ RD L+G+M QS LFNPR RGGKVFV
Sbjct  28   SSNACFNYTLPELSEKYAFDTKEMRRLIDGHHLEVRDRLFGMMSQSKLFNPRVRGGKVFV  87

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ MEQQR +T++RI +L + G FKGWLTE G E ELRK A  +V   FDHS+   
Sbjct  88   SPDYNQPMEQQREITLKRIDYLFERGAFKGWLTEQGEEIELRKFASFEVFGTFDHSMGTM  147

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            L VHF LWGGA+Q  GTK HHD+WLRDTE + VKGCFAM+ELGHGSNVRG+ETVTTYDS 
Sbjct  148  LAVHFFLWGGAVQVFGTKHHHDKWLRDTEAHVVKGCFAMSELGHGSNVRGVETVTTYDSN  207

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EFVINTPCESAQK+WIGGAANHATH IVFSQL I+G +QGVHAFIAQI
Sbjct  208  TQEFVINTPCESAQKFWIGGAANHATHAIVFSQLNINGSNQGVHAFIAQI  257



>ref|XP_010689760.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=688

 Score =   345 bits (885),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 189/229 (83%), Gaps = 3/229 (1%)
 Frame = +3

Query  15   CLSYTPPEVSEPGG---LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            CLSY+PPE+SEP      D  EMR L+D HN++DRD LY ++I+S +FNPR+ G +VFV+
Sbjct  42   CLSYSPPELSEPCATISFDTKEMRNLLDMHNIEDRDGLYNLIIESSVFNPRKVGSRVFVS  101

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ MEQQR +TM R+ +L+D GV  GW+TE G   ELR++AL +V+ ++DHSL+V L
Sbjct  102  PDYNQPMEQQREVTMERLQYLVDHGVLGGWITERGAAIELRRMALNEVVQIYDHSLAVML  161

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            G H+ LWGGAIQF GTKRHHD+WL+ TE Y +KGCFAMTELGHGSNVRGIET+TTYDS T
Sbjct  162  GAHYFLWGGAIQFFGTKRHHDKWLKITEEYGIKGCFAMTELGHGSNVRGIETITTYDSNT  221

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EF+INTPCESAQKYWIGGAA HATHT+VFSQLKI+GKD+GVHAFI QI
Sbjct  222  EEFIINTPCESAQKYWIGGAAKHATHTVVFSQLKINGKDEGVHAFIVQI  270



>ref|XP_006656066.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like, partial 
[Oryza brachyantha]
Length=647

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            S CLSY  PE SEP       E+R L+DGH++++RDW +  M +S LF PR  GG+VFV+
Sbjct  1    SACLSYGSPESSEPAPAFSPLELRLLLDGHHVRERDWAFRAMEESPLFCPRRCGGRVFVS  60

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRR+G+L   GVF+GWLTE GPE+ELRKLALL+ + ++DHSL++K+
Sbjct  61   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPEAELRKLALLECLGVYDHSLAIKI  120

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWG AI+FLGTKRHHD+WL DTENY +KGCF+MTELGHGSNVRGIETV TYDS+T
Sbjct  121  GVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATYDSKT  180

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EF+INTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAF+AQI
Sbjct  181  REFMINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVAQI  229



>ref|XP_003573815.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Brachypodium 
distachyon]
Length=686

 Score =   343 bits (879),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 194/235 (83%), Gaps = 6/235 (3%)
 Frame = +3

Query  6    ASPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRE-----RG  167
            +SPCLSY PPE +E P      E+R L+DGH+L++RDWL+G M +S LF PR       G
Sbjct  34   SSPCLSYAPPESTENPPAFSPIELRALLDGHHLRERDWLFGAMEESPLFCPRRVGGGGGG  93

Query  168  GKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDH  347
            GKVFV+ DYN+  E QR  TMRRI +L   GVF+GWLTE GP++ELRKLA+LD + ++DH
Sbjct  94   GKVFVSPDYNEGKEGQREATMRRIAYLTGRGVFRGWLTEPGPDAELRKLAMLDCLGVYDH  153

Query  348  SLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVT  527
            SL++K+GVHF LWG AI+FLGTKRHHD+WL +TENY +KGCFAMTELGHGSNVRGIET+ 
Sbjct  154  SLAIKVGVHFFLWGSAIKFLGTKRHHDKWLVETENYVIKGCFAMTELGHGSNVRGIETIA  213

Query  528  TYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TYDS++ EFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAF+AQI
Sbjct  214  TYDSKSREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVAQI  268



>ref|XP_010689759.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 186/227 (82%), Gaps = 0/227 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            PC +Y+ P +SE    D  EMR L+D HN++DRD LY ++I+S +FNPR+ G +VFV+ D
Sbjct  20   PCSTYSDPHLSETISFDTKEMRNLLDMHNIEDRDGLYNLIIESSVFNPRKVGSRVFVSPD  79

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ MEQQR +TM R+ +L+D GV  GW+TE G   ELR++AL +V+ ++DHSL+V LG 
Sbjct  80   YNQPMEQQREVTMERLQYLVDHGVLGGWITERGAAIELRRMALNEVVQIYDHSLAVMLGA  139

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            H+ LWGGAIQF GTKRHHD+WL+ TE Y +KGCFAMTELGHGSNVRGIET+TTYDS T E
Sbjct  140  HYFLWGGAIQFFGTKRHHDKWLKITEEYGIKGCFAMTELGHGSNVRGIETITTYDSNTEE  199

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            F+INTPCESAQKYWIGGAA HATHT+VFSQLKI+GKD+GVHAFI QI
Sbjct  200  FIINTPCESAQKYWIGGAAKHATHTVVFSQLKINGKDEGVHAFIVQI  246



>ref|XP_004965421.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Setaria 
italica]
Length=687

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 188/231 (81%), Gaps = 3/231 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRER--GGKVF  179
            SPCLSY  PE +EP       E+R L+DGH+L +RDW++ +M +S LF PR+R  G +VF
Sbjct  39   SPCLSYALPESTEPAPAFPPAELRALLDGHHLWERDWVFRVMEESQLFCPRQRCSGSRVF  98

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            VA DYN   E QR  TMRR+ HL   GVF+GWLTE G E+ELRKLALL+ + ++DHSL++
Sbjct  99   VAPDYNDGKEAQREATMRRVAHLARRGVFRGWLTEPGAEAELRKLALLESLGVYDHSLAI  158

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWG AI+FLGTKRHHD+WL  TENY +KGCFAMTELGHGSNVRGIET+ TYDS
Sbjct  159  KIGVHFFLWGSAIKFLGTKRHHDKWLFATENYDIKGCFAMTELGHGSNVRGIETIATYDS  218

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +  EF+INTPCESAQKYWIGGAANHATHTIVFSQL I+GK++GVHAF+AQI
Sbjct  219  KAREFIINTPCESAQKYWIGGAANHATHTIVFSQLHINGKNEGVHAFVAQI  269



>ref|XP_009405080.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=683

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 182/229 (79%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            + CL Y+PPE+SE P   D   +R+++DGH+ + RDWL+ +M +S LF PR RG + FVA
Sbjct  36   AACLHYSPPELSEQPPSFDTASLRRVLDGHDTEGRDWLFRLMEESSLFCPRRRGNRTFVA  95

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYNQ MEQQR +TMRRI +LL  GVF+GWLT +GPE+ +RK A  + I +FDHSL++KL
Sbjct  96   PDYNQTMEQQRAVTMRRIEYLLANGVFEGWLTGSGPEALMRKFAFFECIGIFDHSLAIKL  155

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF LWGGA+Q  GTK HHD+WL+  ENY V+GCF MTELGHGSNVRG+ET+ TYD+  
Sbjct  156  GVHFFLWGGAVQIFGTKHHHDKWLKAAENYQVQGCFVMTELGHGSNVRGLETIATYDANA  215

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            GEFVINTPCESAQKYWIGGAAN ATH ++FSQL I+G +QGVH FIAQI
Sbjct  216  GEFVINTPCESAQKYWIGGAANDATHAVIFSQLLINGTNQGVHVFIAQI  264



>ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Glycine max]
Length=584

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = +3

Query  21   SYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQ  200
            SY+PPE+S     D  EMRKLMD HNL+DRDWL+ +++QS LFNPR R G+ FV  DYNQ
Sbjct  35   SYSPPELSNTISFDTREMRKLMDCHNLEDRDWLFSLILQSPLFNPRHRAGRFFVCPDYNQ  94

Query  201  NMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFI  380
             ME QR  TM+RI +LLD GVF+GWLT NGPE ELRKLAL +VI ++DHSL+VKLGVHF 
Sbjct  95   PMEHQRQATMKRIAYLLDKGVFRGWLTGNGPEQELRKLALHEVIGMYDHSLAVKLGVHFF  154

Query  381  LWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVI  560
            LWGGA++FLGTKRHHD+WL  TENY +KGCFAM+ELGHGSNVRGIETVTTYDS TGEFVI
Sbjct  155  LWGGAVKFLGTKRHHDKWLNSTENYDIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVI  214

Query  561  NTPCESAQKYWIGGAAN  611
            NTPCES QKYWIGGAAN
Sbjct  215  NTPCESGQKYWIGGAAN  231



>ref|XP_002456627.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
 gb|EES01747.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
Length=684

 Score =   325 bits (832),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 184/231 (80%), Gaps = 3/231 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLF-NPRER-GGKVF  179
            S CLSY PPE +E P      ++R L+DGH+L  RDWL+  M +S LF +P  R G +VF
Sbjct  36   SCCLSYVPPESTERPAAFAPGDLRLLLDGHDLPARDWLFRAMEESPLFRSPSARTGSRVF  95

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V AD N   E QR  TMRRI +L   GVF+GWLT++G ++ELRKLALLD IA++DHSL++
Sbjct  96   VGADLNDGKEGQREATMRRIAYLKQRGVFRGWLTKDGADAELRKLALLDCIAIYDHSLAI  155

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWG AI+FLGTKRHHD+WL  TENY + GCFAMTELGHGSNVRGIET+ TYDS
Sbjct  156  KIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIMGCFAMTELGHGSNVRGIETIATYDS  215

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             T EF+INTPCESAQKYWIGGAANHATHTIVF QL I+G+++GVHAF+AQI
Sbjct  216  ETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVAQI  266



>gb|AGT17248.1| acyl-coenzyme A oxidase [Saccharum hybrid cultivar R570]
Length=682

 Score =   324 bits (831),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 184/231 (80%), Gaps = 3/231 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLF-NPRER-GGKVF  179
            S CLSY PPE +E P      ++R L+DGH+L  RDWL+ +M +S LF +P  R G +VF
Sbjct  36   SCCLSYVPPESTERPAAFAPGDLRVLLDGHDLPARDWLFRVMEESPLFRSPCARTGSRVF  95

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            V  D N   E QR  TMRRI +L   GVF+GWLTE+G ++ELRKLALLD IA++DHSL++
Sbjct  96   VGPDLNDGKEGQREATMRRIAYLKQRGVFRGWLTEDGADAELRKLALLDCIAIYDHSLAI  155

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWG AI+FLGTKRHHD+WL  TENY + GCFAMTELGHGSNVRGIET+ TYDS
Sbjct  156  KIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIMGCFAMTELGHGSNVRGIETIATYDS  215

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             T EF+INTPCES+QKYWIGGAANHATHTIVF QL I+G+++GVHAF+AQI
Sbjct  216  ETREFIINTPCESSQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVAQI  266



>ref|NP_001152024.1| acyl-coenzyme A oxidase 2 [Zea mays]
 gb|ACG45431.1| acyl-coenzyme A oxidase 2 [Zea mays]
Length=684

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 181/231 (78%), Gaps = 3/231 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGK--VF  179
            S CLSY PPE +E P      ++R L+DGH+L  RDWL+  M +S LF  R       VF
Sbjct  36   SCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGSRVF  95

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            VA D+N   E QR  TMRRI +L   GVF+GWLTE+G  +ELRKLALLD IA++DHSL++
Sbjct  96   VAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTEDGAAAELRKLALLDCIAIYDHSLAI  155

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWG AI+FLGTKRHHD+WL  TENY +KGCFAMTELGHGSNVRGIET+ TYDS
Sbjct  156  KIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIKGCFAMTELGHGSNVRGIETIATYDS  215

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             T EF+INTPCESAQKYWIGGAANHATHTIVF QL I+G+++GVHAF+AQI
Sbjct  216  ETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVAQI  266



>tpg|DAA56859.1| TPA: putative acyl-CoA oxidase family protein [Zea mays]
Length=684

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 181/231 (78%), Gaps = 3/231 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGK--VF  179
            S CLSY PPE +E P      ++R L+DGH+L  RDWL+  M +S LF  R       VF
Sbjct  36   SCCLSYVPPESTERPAAFAPADLRLLLDGHDLPTRDWLFRAMEESPLFRSRSSRTGSRVF  95

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
            VA D+N   E QR  TMRRI +L   GVF+GWLTE+G  +ELRKLALLD IA++DHSL++
Sbjct  96   VAPDFNDGKEGQREATMRRIAYLNRRGVFRGWLTEDGAAAELRKLALLDCIAIYDHSLAI  155

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
            K+GVHF LWG AI+FLGTKRHHD+WL  TENY +KGCFAMTELGHGSNVRGIET+ TYDS
Sbjct  156  KIGVHFFLWGSAIKFLGTKRHHDKWLVATENYDIKGCFAMTELGHGSNVRGIETIATYDS  215

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             T EF+INTPCESAQKYWIGGAANHATHTIVF QL I+G+++GVHAF+AQI
Sbjct  216  ETREFIINTPCESAQKYWIGGAANHATHTIVFCQLHINGRNEGVHAFVAQI  266



>gb|ACN41105.1| unknown [Picea sitchensis]
Length=680

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 183/229 (80%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPE-VSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            S CL Y+PPE  S     D+  MR+L+DGHN++DRDW++ +M  S LF P+ RGG+++V 
Sbjct  34   SSCLQYSPPENFSGKPTFDIGAMRELIDGHNIEDRDWIFNLMANSDLFCPKRRGGQIYVL  93

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+ ME QR MTM+RI +LLD GVFKGWLT+   E E R   L + + L+DHSL VKL
Sbjct  94   PDYNKPMEHQREMTMKRILYLLDKGVFKGWLTKPSLEMEARSSTLHECLGLYDHSLGVKL  153

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVH+ LWGGAI+FLGTK H ++WL+DTE++ ++G FAMTELGHGSNVRGIET+TTYD  T
Sbjct  154  GVHYNLWGGAIKFLGTKGHREKWLQDTEDFVIRGSFAMTELGHGSNVRGIETITTYDPST  213

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EFVI TPCESAQKYWIGGAANHATHT+VFSQL I+GK++GVHAF+AQI
Sbjct  214  QEFVITTPCESAQKYWIGGAANHATHTVVFSQLIINGKNEGVHAFVAQI  262



>gb|EAZ00875.1| hypothetical protein OsI_22900 [Oryza sativa Indica Group]
Length=688

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 186/233 (80%), Gaps = 7/233 (3%)
 Frame = +3

Query  15   CLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERG----GKVF  179
            CL Y PPE +E P    + ++R+L+DGH+L  RDW++ +M QS LF  R  G    G+VF
Sbjct  38   CLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLFCSRHGGPGPAGRVF  97

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLT--ENGPESELRKLALLDVIALFDHSL  353
             + D+N++ E  R  TMRRIG+L   GVF+GWLT  E   E+ELR++ALLD I ++DHSL
Sbjct  98   ASPDFNKDKEGLREATMRRIGYLARRGVFRGWLTDTEGDAEAELRRIALLDCIGVYDHSL  157

Query  354  SVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTY  533
            ++K+GVHF LWG AI+FLGTKRHHD+WL DTENY +KGCF+MTELGHGSNVRGIETV TY
Sbjct  158  AIKIGVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATY  217

Query  534  DSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            D +T EFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAF+AQI
Sbjct  218  DIKTREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVAQI  270



>ref|XP_002994091.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
 gb|EFJ04838.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
Length=678

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            PCL Y+PPE++     D+  M+ L+DGH+ Q R +++ +M +S LF  R  G +VF+ AD
Sbjct  35   PCLEYSPPELNSEPAFDIELMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLGAD  94

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ ME QR +TM+RI + LD GVF+GWLT++ P+S LR  A+ + I LFDHSL++KLGV
Sbjct  95   YNQPMEVQRELTMKRIQYFLDRGVFRGWLTDDRPQSALRMAAMFEYIGLFDHSLAIKLGV  154

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF LWGG++++LG+KRHHD+WL  TE ++V GCFAMTELGHGSNVRGIET+T YD  T E
Sbjct  155  HFHLWGGSVKYLGSKRHHDKWLMPTEEFSVIGCFAMTELGHGSNVRGIETITVYDPSTQE  214

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIGGAA HATHT+VFSQL ++GK++GVHAFIA+I
Sbjct  215  FVINTPCESAQKYWIGGAAMHATHTVVFSQLHMNGKNEGVHAFIAEI  261



>ref|XP_002985513.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
 gb|EFJ13387.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
Length=678

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD  191
            PCL Y+PPE++     D+  M+ L+DGH+ Q R +++ +M +S LF  R  G +VF+ AD
Sbjct  35   PCLEYSPPELNSEPAFDIELMQGLLDGHDAQTRTFIFNLMSESDLFVSRRVGRRVFLGAD  94

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YNQ ME QR +TM+RI + LD GVF+GWLT++ P+S LR  A+ + I LFDHSL++KLGV
Sbjct  95   YNQPMEVQRELTMKRIQYFLDRGVFRGWLTDDRPQSALRMAAMFEYIGLFDHSLAIKLGV  154

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF LWGG++++LG+KRHHD+WL  TE ++V GCFAMTELGHGSNVRGIET+T YD  T E
Sbjct  155  HFHLWGGSVKYLGSKRHHDKWLLPTEEFSVIGCFAMTELGHGSNVRGIETITVYDPSTKE  214

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            FVINTPCESAQKYWIGGAA HATHT+VFSQL ++GK++GVHAFIA+I
Sbjct  215  FVINTPCESAQKYWIGGAAMHATHTVVFSQLHMNGKNEGVHAFIAEI  261



>gb|EAZ36947.1| hypothetical protein OsJ_21282 [Oryza sativa Japonica Group]
Length=685

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 185/233 (79%), Gaps = 7/233 (3%)
 Frame = +3

Query  15   CLSYTPPEVSE-PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERG----GKVF  179
            CL Y PPE +E P    + ++R+L+DGH+L  RDW++ +M QS LF  R  G    G+VF
Sbjct  35   CLGYVPPESNEQPPAFALGDLRRLLDGHDLGVRDWMFRVMEQSTLFCSRHGGPGPAGRVF  94

Query  180  VAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLT--ENGPESELRKLALLDVIALFDHSL  353
             + D+N++ E  R   MRRIG+L   GVF+GWLT  E   E+ELR++ALLD I ++DHSL
Sbjct  95   ASPDFNKDKEGLREAKMRRIGYLARRGVFRGWLTDTEGDAEAELRRIALLDCIGVYDHSL  154

Query  354  SVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTY  533
            ++K+GVHF LWG AI+FLGTKRHHD+WL DTENY +KGCF+MTELGHGSNVRGIETV TY
Sbjct  155  AIKIGVHFFLWGSAIKFLGTKRHHDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATY  214

Query  534  DSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            D +T EFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAF+AQI
Sbjct  215  DIKTREFVINTPCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFVAQI  267



>gb|KJB60308.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60309.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60310.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60311.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
 gb|KJB60312.1| hypothetical protein B456_009G299600 [Gossypium raimondii]
Length=231

 Score =   279 bits (713),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +3

Query  126  IMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESEL  305
            +M QS LFNP  RGGKVFV  +YNQ MEQQR + ++RI +L D G FKGWLTE G E EL
Sbjct  1    MMSQSKLFNPGVRGGKVFVLPNYNQPMEQQREIMLKRIDYLFDIGEFKGWLTEQGEEIEL  60

Query  306  RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTE  485
            +K A  +V   FDHS+   L VHF LWGGA+Q  GTK HHD+WLRDTE + VKGCFAM+E
Sbjct  61   KKFASFEVFGTFDHSMGTMLAVHFFLWGGAVQVFGTKHHHDKWLRDTETHVVKGCFAMSE  120

Query  486  LGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ  665
            LGHGSNVRG+E VTTYDS T EFVINTPCESAQK+WIG AANHATH IVFS L I+G +Q
Sbjct  121  LGHGSNVRGVEIVTTYDSNTQEFVINTPCESAQKFWIGEAANHATHAIVFSPLNINGSNQ  180

Query  666  GVHAFIAQI  692
            GVHAFIAQI
Sbjct  181  GVHAFIAQI  189



>ref|XP_001759376.1| predicted protein [Physcomitrella patens]
 gb|EDQ75678.1| predicted protein [Physcomitrella patens]
Length=680

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 170/229 (74%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEV-SEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            SPCL+Y PPE+  +    D   MR+L+DGH++  RD    +MI S LF  +  G   F  
Sbjct  36   SPCLAYQPPELHCDKSSFDKSVMRELLDGHHVALRDSFANLMISSDLFVNKRVGNLTFAT  95

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             ++N  ME+ R  T+ RI      GVFKGWLT++  +  L++ AL + +  FDHSL++KL
Sbjct  96   PNFNTTMEEHRDKTLDRILFFRSKGVFKGWLTDSSVDHALKRAALFETLGTFDHSLAIKL  155

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVH  LWGGAIQ+LGTKRHHD+WL+ TE+Y V+GCFAM+ELGHGSNVRGIETVTTYD  T
Sbjct  156  GVHIHLWGGAIQYLGTKRHHDKWLKITEDYQVRGCFAMSELGHGSNVRGIETVTTYDPST  215

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EF+I+TPCESAQKYWIGGAA HATHTIVFSQL IDGK++GVHAF+ Q+
Sbjct  216  EEFIIDTPCESAQKYWIGGAAQHATHTIVFSQLLIDGKNEGVHAFVCQL  264



>ref|XP_001772379.1| predicted protein [Physcomitrella patens]
 gb|EDQ62850.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 173/229 (76%), Gaps = 1/229 (0%)
 Frame = +3

Query  9    SPCLSYTPPEV-SEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            SPCL+Y PPE   +    D   MR+L+DGH++  RD    +++ S LF  +  G +VF +
Sbjct  33   SPCLAYQPPEFHCDNSSFDKSIMRELLDGHHVDLRDSFTDLLMSSDLFTSKRVGDRVFAS  92

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             ++N  M +QR  T+ RI  L   GVFKGWL+++  +  L++ AL + + +FDHSL +KL
Sbjct  93   PNFNLTMAEQRDKTLERILFLRSEGVFKGWLSDSSVDDALKRAALFETMGIFDHSLVIKL  152

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVH  LWGG+IQ+LGTKRHHD+WL  TE+Y V+GCFAM+ELGHGSNVRGIETVTTYD+ T
Sbjct  153  GVHIHLWGGSIQYLGTKRHHDKWLDRTEDYQVRGCFAMSELGHGSNVRGIETVTTYDTST  212

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EF+I+TPCESAQKYWIGGAA HATHTIVFSQL IDGK++GVHAF+ Q+
Sbjct  213  EEFIIDTPCESAQKYWIGGAAQHATHTIVFSQLLIDGKNEGVHAFVCQL  261



>gb|EPS62711.1| hypothetical protein M569_12075, partial [Genlisea aurea]
Length=197

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSE--PGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            SPCLS+ P EVSE  P   DV  MRKLMDGHN+ DR WL+ +++QS LFN + RGGKVFV
Sbjct  30   SPCLSFVPAEVSEKQPPSFDVESMRKLMDGHNVDDRVWLFNLLVQSDLFNGKLRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
              DYNQ MEQQR +TM RI +LLD GVFKGWLTE G ESELRKLALL+V+ +FDHSL++K
Sbjct  90   VPDYNQTMEQQREITMERIRYLLDHGVFKGWLTEKGAESELRKLALLEVLGIFDHSLAIK  149

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNV  506
            LGVHF LWGGAIQF GTK HHD+WL  TENY VKGCF+MTELGHGSNV
Sbjct  150  LGVHFFLWGGAIQFFGTKIHHDKWLSPTENYEVKGCFSMTELGHGSNV  197



>emb|CBI21935.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  303  LRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMT  482
            +RK AL +VI ++DHSL+VKLGVH+ LWGGAIQF GTKRHHD+WLRD+ENY +KGCFAMT
Sbjct  1    MRKFALHEVIGMYDHSLAVKLGVHYFLWGGAIQFFGTKRHHDKWLRDSENYVIKGCFAMT  60

Query  483  ELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKD  662
            ELGHGSNVRGIETVTTYDS+TGEFVIN+PCESAQKYWIGGAANHATHTIVFSQL I+GK 
Sbjct  61   ELGHGSNVRGIETVTTYDSKTGEFVINSPCESAQKYWIGGAANHATHTIVFSQLNINGKS  120

Query  663  QGVHAFIAQI  692
            +GVHAFIAQI
Sbjct  121  EGVHAFIAQI  130



>ref|XP_007213791.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
 gb|EMJ14990.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
Length=520

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  387  GGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINT  566
            GGAIQF GTKRHHD+WLRDTENY +KGCFAM+ELGHGSNVRGIETVTTYDS TGEFVINT
Sbjct  1    GGAIQFFGTKRHHDKWLRDTENYTIKGCFAMSELGHGSNVRGIETVTTYDSNTGEFVINT  60

Query  567  PCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            PCESAQKYWIGGAANHATHTIVFSQL I GK+ GVHAFIAQI
Sbjct  61   PCESAQKYWIGGAANHATHTIVFSQLNISGKNHGVHAFIAQI  102



>ref|XP_007213790.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica]
 gb|EMJ14989.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica]
Length=151

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S +PC+ ++PPE+SEP   D  EMRKL+D HNL+DRDWL+G+M QS  FNPRE GG+VFV
Sbjct  25   SPNPCVGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDWLFGLMKQSKPFNPREAGGRVFV  84

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MTM+RI +LLD GVF+GWLTE G E+ELRKLAL +VI ++DHSLSVK
Sbjct  85   SPDYNQSMEQQREMTMKRIAYLLDRGVFEGWLTEKGVEAELRKLALHEVIGIYDHSLSVK  144

Query  363  LGVHFIL  383
            LGVHF L
Sbjct  145  LGVHFFL  151



>gb|EMT28672.1| Acyl-coenzyme A oxidase 3, peroxisomal [Aegilops tauschii]
Length=594

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  387  GGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINT  566
            GGA++FLGTKRHHD+WL DTENY +KGCFAMTELGHGSNVRGIETV TYDS+TGEFVINT
Sbjct  75   GGAVKFLGTKRHHDKWLLDTENYVIKGCFAMTELGHGSNVRGIETVATYDSKTGEFVINT  134

Query  567  PCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            PCESAQKYWIGGAANHATHTIVF+QL I+G+++GVHAFIAQI
Sbjct  135  PCESAQKYWIGGAANHATHTIVFAQLHINGRNEGVHAFIAQI  176



>ref|XP_011037432.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=514

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  405  LGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQ  584
            +GTKRHHD+WLRDTE +A+KGCF+MTELGHGSNVRGIETVTTYDS+TGEFVINTPCESAQ
Sbjct  1    MGTKRHHDKWLRDTETFAIKGCFSMTELGHGSNVRGIETVTTYDSKTGEFVINTPCESAQ  60

Query  585  KYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            KYWIGGAANHATHTIVFSQL I+G ++GVHA IAQI
Sbjct  61   KYWIGGAANHATHTIVFSQLNINGVNEGVHALIAQI  96



>ref|XP_005707013.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 ref|XP_005707014.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
 gb|EME30493.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 gb|EME30494.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
Length=640

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 134/231 (58%), Gaps = 19/231 (8%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA-  188
            PC+ Y PPE + P     +E +KL       D DW           + RER  +VF    
Sbjct  12   PCMEYIPPERASPS--PTFEPKKLYPL--FVDHDW-----------DLRERLFEVFKEPL  56

Query  189  ---DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSV  359
                Y   ME++R +  RR   L + G+ KG LT   P+   R  A  + + ++DHSLSV
Sbjct  57   FQFRYGITMEEERNLLRRRWSRLNELGLLKGTLTSGQPKDRARFDAFFECVEMYDHSLSV  116

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
             + VH+ L+G  I FLGT     +WL   E+ ++ GCFA+TELGHGSNVRGIET  TYD 
Sbjct  117  AMTVHYGLFGSTIAFLGTDEQKQKWLPKVEDCSMHGCFALTELGHGSNVRGIETQATYDK  176

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             T EF+I+TPCE+AQKYWIGGA+ +A    VF+QL ++G   G+H F+ +I
Sbjct  177  STQEFIIHTPCETAQKYWIGGASTNARWATVFAQLSLNGTYYGIHPFVVRI  227



>gb|KHG14872.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=168

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL+Y+PPE+SE    D+ +MRKLMDGH+L++RD L+G++ QS +FNPR RGGKVFV
Sbjct  30   SSNACLNYSPPELSEKYAFDINDMRKLMDGHDLEERDRLFGMITQSKVFNPRVRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +L + GVF+GWLT  G E E+R+ A  +V+ LFDHS+S+K
Sbjct  90   SPDYNQSMEQQREMTWKRIEYLFERGVFQGWLTGEGEEVEMRRFACFEVLGLFDHSISIK  149

Query  363  LGVHFILW  386
            LGVHF LW
Sbjct  150  LGVHFFLW  157



>gb|KJB50145.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=543

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S++ CL+Y+PPE+SE    D+ +MRKLMDGH+L++RD L+G++ QS +FNPR RGGKVFV
Sbjct  30   SSNACLNYSPPELSEKYAFDISDMRKLMDGHDLEERDRLFGMITQSKVFNPRVRGGKVFV  89

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            + DYNQ+MEQQR MT +RI +L + GVF+GWLT  G E E+R+ A  +V+ LFDHS+S+K
Sbjct  90   SPDYNQSMEQQREMTWKRIEYLFERGVFQGWLTGEGEEVEMRRFACFEVLGLFDHSISIK  149

Query  363  LGVHFILW  386
            LGVHF LW
Sbjct  150  LGVHFFLW  157



>ref|XP_005703885.1| acyl-CoA oxidase [Galdieria sulphuraria]
 gb|EME27365.1| acyl-CoA oxidase [Galdieria sulphuraria]
Length=636

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 136/228 (60%), Gaps = 13/228 (6%)
 Frame = +3

Query  12   PCLSYTPPEV-SEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            PC  Y P E  S     +++++R     H+++ R  ++  + +  +F+ R          
Sbjct  6    PCGEYLPAETASTISPFNLFKLRNYFLEHDIEFRYSVFEAL-KEPIFHFR----------  54

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
             Y  ++E++R    +R   L + G  KG LT   P+   +  A  + I ++DHSLSV +G
Sbjct  55   -YGLSLEEERLWLKKRWARLHELGFLKGTLTSVDPKVRSKYDAFFECIEMYDHSLSVAMG  113

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VH+ L+G  I FLGT+    EWL   E+ ++ GCFA+TELGHGSNVRGIET  TYD  + 
Sbjct  114  VHYGLFGSTIAFLGTEDQVREWLPKVEDCSMLGCFALTELGHGSNVRGIETQATYDPVSQ  173

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EF+I TPCE+AQKYWIGGAA  A  + VF+QL ++G + G+H F+ Q+
Sbjct  174  EFIIFTPCETAQKYWIGGAAETARWSTVFAQLTVNGVNYGIHPFLVQL  221



>ref|XP_005716306.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF36487.1| acyl-CoA oxidase [Chondrus crispus]
Length=656

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 128/208 (62%), Gaps = 12/208 (6%)
 Frame = +3

Query  69   EMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHL  248
            +MR+L+D ++ + RD LY  + +  +F PR           YN ++++QR  T++R   +
Sbjct  62   KMRELLDMNSFEVRDRLYE-LFKDPVFAPR-----------YNDSLDEQRARTIQRWSLI  109

Query  249  LDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHD  428
               G+F+  L +  PE   R  A+L+ ++  DHSL +K+ VH+ L+GG +  +G     D
Sbjct  110  AKTGLFRNALRKFTPEGRRRYEAILESVSALDHSLEIKMSVHYGLFGGTVSLMGDDEQGD  169

Query  429  EWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAA  608
            +W+   E+  + GCF+MTELGHGSNV+GI+T   YD  +  F++NTPCE AQKYWIGGA 
Sbjct  170  KWMPKIESCEMLGCFSMTELGHGSNVKGIQTTAIYDIPSQTFIVNTPCEEAQKYWIGGAF  229

Query  609  NHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              A  T +F+QL + G   GVH F+A+I
Sbjct  230  QSARWTALFAQLYVKGVCHGVHPFLARI  257



>ref|XP_004365565.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89168.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
Length=705

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 133/223 (60%), Gaps = 14/223 (6%)
 Frame = +3

Query  27   TPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNM  206
             P   S    + +  + K +D HN   R  ++ ++ +  LF             DYN ++
Sbjct  34   APSATSNSSTVSIDLLNKFVDKHNFATRKAMWELL-KEPLFE-----------LDYNMSI  81

Query  207  EQQRGMTMRRIGHLLDCGVFKGWLTENG-PESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            +Q R +T+RR+  L D G     L  N  PES++   A  D + ++D +L+V++G H  L
Sbjct  82   KQLRDLTLRRLQRLSDLGYPYQMLDPNSTPESQMEVYARTDCMYMYDCNLTVRVGAHVNL  141

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            WGG+++ LGT+ HH+++L+D     + GCFAMTELGHGSNV+G+ET  T+D  T EF+IN
Sbjct  142  WGGSVRNLGTEYHHEKYLKDIAYNRLPGCFAMTELGHGSNVKGLETTATFDKATQEFIIN  201

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP ESAQK+WIG A   A    VF+QL I G ++G+HAFI  +
Sbjct  202  TPTESAQKFWIGNALT-AHAATVFAQLHIGGVNRGIHAFIVPL  243



>ref|XP_010457758.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Camelina sativa]
Length=194

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query  399  QFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTT-YDSRTGEFVINTPCE  575
            +F GTKRHH++WL DTE+Y VKGCFAMTELGHG+NVRGIETVTT YD  + EFVINTPCE
Sbjct  4    KFFGTKRHHEKWLNDTEDYVVKGCFAMTELGHGTNVRGIETVTTYYDPASEEFVINTPCE  63

Query  576  SAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            S+QKYWIG AANHATH IV SQL I+  +QG+H FIAQI
Sbjct  64   SSQKYWIGEAANHATHAIVISQLNINETNQGIHVFIAQI  102



>ref|XP_005712968.1| acyl-CoA oxidase [Chondrus crispus]
 ref|XP_005712969.1| Acyl-COA oxydase [Chondrus crispus]
 emb|CDF33165.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF33166.1| Acyl-COA oxydase [Chondrus crispus]
Length=672

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 127/222 (57%), Gaps = 13/222 (6%)
 Frame = +3

Query  30   PPEVSEPGGL-DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNM  206
            PP V  P  + D+ +MR+L+D +N   RD  Y  + ++ +F PR           YN+++
Sbjct  48   PPGVVAPRPVFDIKKMRELLDMNNFALRDSFYE-LFKNPVFFPR-----------YNESL  95

Query  207  EQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILW  386
             +QR  T++R   +   GVF   L     E   R  A L+ +   +HS+ +K+GVH+ L+
Sbjct  96   AEQRARTIQRWRLIAKTGVFHNTLQTFTAEGRQRYEATLESVGAMEHSMEIKMGVHYGLF  155

Query  387  GGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINT  566
            GG +  +G      +W    EN  + GCFAMTELGHGSNV+GI+T   YD  +  F++NT
Sbjct  156  GGTVSLMGDDEQCAKWTPKIENCQMLGCFAMTELGHGSNVKGIQTKAVYDIPSQTFIVNT  215

Query  567  PCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            PCE AQKYWIGGA   A  T +F+QL + G   GVH F+ +I
Sbjct  216  PCEEAQKYWIGGAFQSARWTALFAQLYVKGVCHGVHPFLVRI  257



>ref|XP_005536533.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80497.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
Length=773

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 129/210 (61%), Gaps = 14/210 (7%)
 Frame = +3

Query  69   EMRKLMDGHNLQDRDWLYGIMIQ-SHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGH  245
             MR L+D H++  RD +Y +  Q + LF PR           Y   + ++R + M R   
Sbjct  87   RMRALLDAHDIAFRDRIYAMFEQHADLFTPR-----------YGLTVPEERELVMARWAV  135

Query  246  LLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHH  425
            + +  + KG L  + PE+  R  A+++     DHSL VK+GVH+ L+G ++  LG ++  
Sbjct  136  IREAQLLKGTLNYS-PEARGRYDAVMESCGYVDHSLEVKMGVHYGLFGSSVALLGDEQQC  194

Query  426  DEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGA  605
              WL+D E+  + GCFA+TELGHGSNVRGIET+ TYD   GEF+I+TP E+AQKYWIGGA
Sbjct  195  RRWLQDIEDARMLGCFALTELGHGSNVRGIETLATYDPGRGEFIIHTPTETAQKYWIGGA  254

Query  606  ANHATHTIVFSQ-LKIDGKDQGVHAFIAQI  692
            A  A   +VF++ L  DG  +G+H F+ ++
Sbjct  255  AETARWAVVFAKLLTPDGVHRGIHPFLVRL  284



>ref|XP_005712270.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF77396.1| acyl-CoA oxidase [Chondrus crispus]
Length=672

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 127/223 (57%), Gaps = 12/223 (5%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            + P  V+     D+ +MR+L+D +N + RD  Y +  ++ +F PR           YN++
Sbjct  47   FPPGVVASRPVFDIKKMRELLDMNNFELRDSFYEL-FKNPVFFPR-----------YNES  94

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            + +QR  T++R   +   GVF   L     E   R  A L+ +   +HS+ +K+GVH+ L
Sbjct  95   LAEQRARTIQRWRLIAKTGVFHKTLQNFTAEGRQRYEATLESVGAMEHSMEIKMGVHYGL  154

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  +G      +W    EN  + GCFAMTELGHGSNV+GI+T   YD  +  F++N
Sbjct  155  FGGTVSMMGDDEQSAKWAPMIENCQMLGCFAMTELGHGSNVKGIQTKAVYDIPSQTFIVN  214

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TPCE AQKYWIGGA   A  T +F+QL + G   GVH F+ +I
Sbjct  215  TPCEEAQKYWIGGAFQSARWTALFAQLYVQGVCHGVHPFLVRI  257



>ref|XP_005712269.1| unnamed protein product [Chondrus crispus]
 emb|CDF77395.1| unnamed protein product [Chondrus crispus]
Length=672

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 127/223 (57%), Gaps = 12/223 (5%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            + P  V+     D  +MR+L+D +N + RD LY  + ++ +F PR           YN+ 
Sbjct  47   FPPGVVAARPAFDTKKMRELLDMNNFELRDSLYE-LFKNPVFVPR-----------YNET  94

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            ++++R  T++R   +   GVF   L     +   R  A L+ +   DHSL +K+GVH+ L
Sbjct  95   LDEERARTIQRWRLIAKTGVFHEALRIFTVKGRQRYEATLESVGAIDHSLDIKMGVHYGL  154

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  +G       W+   E+  + GCF+MTELGHGSNV+GI+T   YD  +  FV+N
Sbjct  155  FGGTVSLMGDDDQGARWMPKIESCEMLGCFSMTELGHGSNVKGIQTTAVYDIPSRTFVVN  214

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TPCE AQKYWIGGA   A  T +F+QL + G   GVH F+ +I
Sbjct  215  TPCEEAQKYWIGGAFQSARWTALFAQLYVKGVCHGVHPFLVRI  257



>gb|EEE65671.1| hypothetical protein OsJ_21283 [Oryza sativa Japonica Group]
Length=195

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            S CLSY PPE SEP       E+R L+DGH+L++RDW +  M +S LF  R  GGKVFV+
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRR+G+L   GVF+GWLTE GP++ELRKLALL+ + ++DHSL++K+
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLAIKI  158

Query  366  GVHFIL  383
            GVHF L
Sbjct  159  GVHFFL  164



>ref|XP_004363191.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG25340.1| putative acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=657

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 135/233 (58%), Gaps = 18/233 (8%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEP-GGLDVWEMRKLMDGHNLQDRDWLYGIM--IQSHLFNPRERGGK  173
            + S  L+ TP + S+P    D  E+R+ ++  N   +     I+  ++  LF PR     
Sbjct  37   NGSEPLNITPDKPSKPISKWDKEELREFLES-NPAYKQHKQAILEALRDPLFAPR-----  90

Query  174  VFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSL  353
                  YN N E+ R +T++R   L+  G+         P    + L  L++ +L D+SL
Sbjct  91   ------YNMNKEEWRELTVKRAVKLIQQGLISITDLNRDPN---KYLMTLELASLADNSL  141

Query  354  SVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTY  533
            SVK+GVHF L+G A+  LGT++HH ++L+D + + + GCF MTELGHGSNV+GIET  TY
Sbjct  142  SVKMGVHFSLFGNAVLNLGTEKHHLKYLKDIDTWKLPGCFGMTELGHGSNVQGIETTATY  201

Query  534  DSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            D  T EFVINTP ESAQK WIG AA H     VF+QL   G + GVH F+  I
Sbjct  202  DKDTEEFVINTPSESAQKSWIGNAAVHGQACSVFAQLITGGVNHGVHVFVVPI  254



>ref|XP_636605.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
 gb|EAL63099.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
Length=652

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 110/167 (66%), Gaps = 3/167 (2%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN N++Q R +T++R   ++  G          P   ++ L  ++++ L D SLSVKLGV
Sbjct  85   YNMNVQQWRELTLQRAMIIIKAGAISLAEFNRDP---MKYLVSMEMLNLVDPSLSVKLGV  141

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            HF L+G A+  LGT++HH ++++D +++ + GCF MTELGHGSNV+G+ET  TYD  T E
Sbjct  142  HFSLFGNAVLNLGTEKHHIKYIKDIDSWKLPGCFGMTELGHGSNVQGVETTATYDKTTQE  201

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            F+INTP +SAQK+WIG AA H     VF+QL ID    GVH F+  I
Sbjct  202  FIINTPSDSAQKFWIGNAACHGQACSVFAQLYIDNVHYGVHVFVVPI  248



>gb|EFA75614.1| putative acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=646

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 109/170 (64%), Gaps = 3/170 (2%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A  YN N EQ R +T++R   +++ G+         P   L  + LL+   L D SLSVK
Sbjct  77   APKYNMNCEQWREVTLQRSIKVINSGLISLAEFNRDPMKYLLSMELLN---LSDPSLSVK  133

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF L+G A+  LGT++HH ++++D + + + GCF MTELGHGSNV+G+ET  TYD  
Sbjct  134  LGVHFSLFGNAVLNLGTEKHHLKYIKDIDTWKLPGCFGMTELGHGSNVQGVETTATYDKD  193

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EF+INTP +SAQK+WIG AA H     VF+QL I G   GVH F+  I
Sbjct  194  TQEFIINTPSDSAQKFWIGNAALHGQACAVFAQLYIGGVHYGVHVFVVPI  243



>ref|XP_003293845.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
 gb|EGC29627.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
Length=648

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 111/170 (65%), Gaps = 3/170 (2%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A  YN N+++ R +T++R   ++  G          P   ++ L  L+++ L D SLSVK
Sbjct  79   APKYNMNVQEWRELTLQRAIKVIKAGAISLAEFNRDP---MKYLVSLEMLNLCDPSLSVK  135

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF L+G A+  LGT++HH ++++D +++ + GCF MTELGHGSNV+G+ET  TYD  
Sbjct  136  LGVHFSLFGNAVLNLGTEKHHLKYIKDIDSWKLPGCFGMTELGHGSNVQGVETTATYDKN  195

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EF+INTP +SAQK+WIG AA H     VF+QL ID    GVH F+  I
Sbjct  196  TEEFIINTPSDSAQKFWIGNAALHGQACSVFAQLYIDNVHYGVHVFVVPI  245



>gb|EEC80572.1| hypothetical protein OsI_22901 [Oryza sativa Indica Group]
Length=195

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPG-GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            S CLSY PPE SEP       E+R L+D H+L++RDW +  M +S LF  R  GGKVFV+
Sbjct  39   SACLSYAPPESSEPAPAFSPLELRSLLDRHHLRERDWAFRAMEESPLFCQRRSGGKVFVS  98

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRR+G+L   GVF+GWLTE GP++ELRKLALL+ + ++DHSL++K+
Sbjct  99   PDYNEGKEGQREATMRRVGYLARRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLAIKI  158

Query  366  GVHFIL  383
            GVHF L
Sbjct  159  GVHFFL  164



>ref|XP_005649112.1| acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
 gb|EIE24568.1| acyl-CoA oxidase [Coccomyxa subellipsoidea C-169]
Length=635

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 3/168 (2%)
 Frame = +3

Query  189  DYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLG  368
            +Y  ++ + R +T+RR+   +D   F  +   N P   LR +A L+ +A  D+SL +K G
Sbjct  63   NYYLSLMEFRDLTLRRLQKFVDQKFFSTFDYLNDP---LRFMAGLETLASVDYSLCIKAG  119

Query  369  VHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTG  548
            VHF L GG I  LGT++HH  +L   +   + GCF MTELGHGSNV GIET  TYD  TG
Sbjct  120  VHFTLCGGTIAKLGTEKHHKTFLPRLDTLELPGCFGMTELGHGSNVMGIETQATYDEETG  179

Query  549  EFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            EFVINTP ++A K+WIGGAA H     VF+QL + GK +G H F+ ++
Sbjct  180  EFVINTPTDTASKFWIGGAAQHGKVCTVFAQLTVRGKWEGPHVFVVRL  227



>dbj|GAM28721.1| hypothetical protein SAMD00019534_118970 [Acytostelium subglobosum 
LB1]
Length=658

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 3/170 (2%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A  YN  +EQ R +T++R   ++  G+         P   ++ L  ++ I + D SLSVK
Sbjct  89   APVYNMTVEQWRELTLQRAVKVIRSGLISISEFNRDP---MKYLISMETINMSDSSLSVK  145

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
            LGVHF L+G A+  LGT++HH ++L+D + + + GCF MTELGHGSNV+G+ET  TYD  
Sbjct  146  LGVHFSLFGNAVLNLGTEKHHLKYLKDIDTWKLPGCFGMTELGHGSNVQGVETTATYDKD  205

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EF+INTP +SAQK+WIG AA H     VF+QL I G   GVH F+  I
Sbjct  206  TQEFIINTPSDSAQKFWIGNAALHGQACSVFAQLYIGGVHYGVHVFVVPI  255



>gb|EMS62186.1| hypothetical protein TRIUR3_06747 [Triticum urartu]
Length=245

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +3

Query  9    SPCLSYTPPEVS-EPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVA  185
            SPCLSY PPE S  P      E+R L+DGH+L++RDW YG M +S LF PR  GGKVFV+
Sbjct  36   SPCLSYAPPESSGAPPAFAPMELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKVFVS  95

Query  186  ADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKL  365
             DYN+  E QR  TMRRIG+L   GVF+GWLTE GP++EL KLALL+ + ++DHSL++K+
Sbjct  96   PDYNEGKEGQREATMRRIGYLTRRGVFRGWLTEPGPDAELHKLALLECLGVYDHSLAIKI  155

Query  366  GV  371
             +
Sbjct  156  EI  157



>gb|KIY97857.1| acyl-CoA oxidase [Monoraphidium neglectum]
Length=223

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 107/185 (58%), Gaps = 9/185 (5%)
 Frame = +3

Query  147  FNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVF--KGWLTENGPESELRKL-A  317
             N    G       DY Q+M + R  T+ R+   L    F  + +LT+       RK  A
Sbjct  6    LNQAPSGPDPLYQPDYYQSMMEFREQTLVRLQRFLQQRFFSIRDYLTDP------RKFQA  59

Query  318  LLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHG  497
             L+ ++  D+SL++K GVH  L GG I  LGTK+HHD +L   ++ A+ GCF MTELGHG
Sbjct  60   ALECLSFCDYSLAIKCGVHMTLCGGTICKLGTKKHHDAFLPGIDSLALPGCFGMTELGHG  119

Query  498  SNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHA  677
            SNV GIET   YD  TGEFVINTP   A K+WIGG+  H    +VF+QL + GK +G H 
Sbjct  120  SNVMGIETTAHYDPSTGEFVINTPNNEASKFWIGGSGQHGKLCVVFAQLTVAGKWEGPHV  179

Query  678  FIAQI  692
            F  +I
Sbjct  180  FAVRI  184



>gb|EMT28673.1| hypothetical protein F775_14360 [Aegilops tauschii]
Length=133

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  69   EMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHL  248
            E+R L+DGH+L++RDW YG M +S LF PR  GGKVFV+ DYN+  E QR  TMRRIG+L
Sbjct  2    ELRALLDGHHLRERDWAYGAMEESPLFCPRRAGGKVFVSPDYNEGKEGQREATMRRIGYL  61

Query  249  LDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILW  386
               GVF+GWLTE GP++ELRKLALL+ + ++DHSL++K+GVHF LW
Sbjct  62   TRRGVFRGWLTEPGPDAELRKLALLECLGVYDHSLAIKVGVHFFLW  107



>ref|XP_009061608.1| hypothetical protein LOTGIDRAFT_127454 [Lottia gigantea]
 gb|ESO87713.1| hypothetical protein LOTGIDRAFT_127454 [Lottia gigantea]
Length=599

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 105/167 (63%), Gaps = 3/167 (2%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN  + ++R + ++R+  + D G+      +N P   LR  A  ++ ++ D +++ K+ V
Sbjct  32   YNLTLREERDVALQRLQRICDAGLISVLDFKNNP---LRIFAAHELASVIDPAMTTKMTV  88

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
             F L+GG I  LGT+RHHD+ L+  +N    GCF +TELG+G+N   +ET  TYDS T E
Sbjct  89   QFNLFGGTILKLGTQRHHDKLLKGIDNLNDVGCFGLTELGYGNNAVEMETTATYDSATKE  148

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            F++NTP   AQKYWI   A HA H IVFSQL +DGK+ G+H  + QI
Sbjct  149  FIVNTPSTLAQKYWITNGAVHAKHCIVFSQLIVDGKNHGIHGVLVQI  195



>gb|EFA78930.1| acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=657

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 126/211 (60%), Gaps = 11/211 (5%)
 Frame = +3

Query  60   DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRI  239
            D+  ++ L+DG   +DR  +  ++  S  F       ++ +    +  + ++R  T++ +
Sbjct  49   DIDMLKHLLDGDFKRDRTQIRQLIQNSKSFE------EIHLIESISPEVHRER--TIQAV  100

Query  240  GHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKR  419
              ++D  +      ++ PE   + L+  + +++ D S+ +K  V + LWGG + FLGTK+
Sbjct  101  REVIDLSIVSVTDMKDNPE---KFLSWFETVSICDLSVVLKFAVQYNLWGGTVLFLGTKK  157

Query  420  HHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIG  599
            HHD++L D  N  + G F +TELGHGSNV+G+ET +TYD+ TGEF+IN+P  ++QKYW G
Sbjct  158  HHDKYLNDISNGKLLGVFGLTELGHGSNVQGLETTSTYDNATGEFIINSPTWTSQKYWPG  217

Query  600  GAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              + H     VF++L +DG D GVHAFI  I
Sbjct  218  NISAHGQMATVFARLIVDGTDHGVHAFIVPI  248



>ref|XP_003288089.1| hypothetical protein DICPUDRAFT_152296 [Dictyostelium purpureum]
 gb|EGC35351.1| hypothetical protein DICPUDRAFT_152296 [Dictyostelium purpureum]
Length=617

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  303  LRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMT  482
             R   +++++ALF++++  KLGVHF L+GG I FLGT+RH  +++ D       GCF+MT
Sbjct  101  FRYAGIVEMLALFNNNICTKLGVHFTLFGGTIMFLGTERHQ-KYIEDANTLKTVGCFSMT  159

Query  483  ELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKD  662
            E+GHGSNVRGIET   YD  T EF+IN+P  ++QK+WIGG+  HAT+T VF+ L I G +
Sbjct  160  EIGHGSNVRGIETTAHYDPSTKEFIINSPTPTSQKFWIGGSYLHATYTTVFANLIIKGVN  219

Query  663  QGVHAFIAQI  692
             GVHAF+  +
Sbjct  220  HGVHAFVVTL  229



>ref|WP_043324301.1| acyl-CoA oxidase, partial [Corallococcus coralloides]
Length=781

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A FD SL +K GVHF L+G +I FLGTKRHH ++L    +  + GCFAM+ELG
Sbjct  238  IAAFETMAFFDLSLVIKAGVHFGLFGSSILFLGTKRHHQQYLPRVASLELPGCFAMSELG  297

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNVR  ETV  YD+ TGEFV++TP E+A+K WIG AA HA    VF+QL++DG+  GV
Sbjct  298  HGSNVRDCETVARYDAATGEFVLHTPSETARKEWIGNAARHARIATVFAQLEVDGERLGV  357

Query  672  HAFIAQI  692
            HA +  +
Sbjct  358  HALLVPL  364



>gb|AFE09438.1| putative acyl-CoA dehydrogenase [Corallococcus coralloides DSM 
2259]
Length=804

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A FD SL +K GVHF L+G +I FLGTKRHH ++L    +  + GCFAM+ELG
Sbjct  238  IAAFETMAFFDLSLVIKAGVHFGLFGSSILFLGTKRHHQQYLPRVASLELPGCFAMSELG  297

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNVR  ETV  YD+ TGEFV++TP E+A+K WIG AA HA    VF+QL++DG+  GV
Sbjct  298  HGSNVRDCETVARYDAATGEFVLHTPSETARKEWIGNAARHARIATVFAQLEVDGERLGV  357

Query  672  HAFIAQI  692
            HA +  +
Sbjct  358  HALLVPL  364



>ref|WP_043394213.1| acyl-CoA oxidase [Cystobacter violaceus]
 gb|KFA92834.1| acyl-CoA oxidase [Cystobacter violaceus Cb vi76]
Length=779

 Score =   148 bits (373),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  306  RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTE  485
            R +A  + ++ FD SL VK GVHF L+GG+I FLGT+ HH ++L    +  + GCFAM+E
Sbjct  234  RFIAAFETLSFFDLSLVVKAGVHFGLFGGSIYFLGTEHHHRQYLPHVASVELPGCFAMSE  293

Query  486  LGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ  665
            LGHGSNVR +ET+  YD+  GEFV++TP ESA+K WIG AA HA    VF+QL++ G+  
Sbjct  294  LGHGSNVRDVETLARYDAERGEFVVHTPSESARKEWIGNAAQHARLATVFAQLEVKGERH  353

Query  666  GVHAFIAQI  692
            GVHA +  +
Sbjct  354  GVHALLVPL  362



>gb|EFA80269.1| hypothetical protein PPL_07095 [Polysphondylium pallidum PN500]
Length=3352

 Score =   150 bits (378),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 70/161 (43%), Positives = 109/161 (68%), Gaps = 4/161 (2%)
 Frame = +3

Query  210   QQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWG  389
             + R + +++I  L   G+F      +G E   +   L+++++ ++++++ KLGVH+ L+G
Sbjct  1295  EYRELVLQQIKDLSKSGLFNITDIRDGVE---KTCGLMEILSSYNNNITTKLGVHYSLFG  1351

Query  390   GAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTP  569
             G +  LGT+RH ++++       + GCF+MTE+GHGSNVRGIET  TYD+ T EF+INTP
Sbjct  1352  GTVLLLGTQRH-EKYIEPANKLDIVGCFSMTEVGHGSNVRGIETTATYDAATKEFIINTP  1410

Query  570   CESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
               S+QK+WIGGA  HA  T VF++L ++ KD GVHAF+  I
Sbjct  1411  TPSSQKFWIGGAYLHAHFTTVFARLILNKKDHGVHAFVVPI  1451



>ref|XP_002159574.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal-like 
[Hydra vulgaris]
Length=665

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 122/213 (57%), Gaps = 15/213 (7%)
 Frame = +3

Query  54   GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMR  233
              +V +M++L+D  N + RD +   +    +F P+           YN ++ ++R + ++
Sbjct  53   SFNVDKMKELIDHDNHEMRDEMRKFL-SDPIFKPK-----------YNISLSEEREIALQ  100

Query  234  RIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGT  413
            R+  + + G       +N P   L+  A  ++ ++ D ++S K+ V F L+GG +  LGT
Sbjct  101  RLKKICEKGFISVLDFKNNP---LKIFAAHEIASIVDPAMSTKMTVQFNLFGGTVLKLGT  157

Query  414  KRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYW  593
            KRHHD +L+  ++    GCFA+TELG+G+N   +ET   YD  + EF+INTP   AQKYW
Sbjct  158  KRHHDRYLKGIDSLEDIGCFALTELGYGNNAVEMETTAVYDIESQEFIINTPSPLAQKYW  217

Query  594  IGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            I   A HA H +VF+QL I+GK  GVH  + +I
Sbjct  218  ITNGAIHAKHCVVFAQLNIEGKSHGVHGILVRI  250



>gb|EMS62187.1| Acyl-coenzyme A oxidase 3, peroxisomal [Triticum urartu]
Length=221

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +3

Query  477  MTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDG  656
            MTELGHGSNVRGIETV TYDS+TGEFVINTPCESAQKYWIGGAANHATHTIVF+QL I+G
Sbjct  1    MTELGHGSNVRGIETVATYDSKTGEFVINTPCESAQKYWIGGAANHATHTIVFAQLHING  60

Query  657  KDQGVHAFIAQI  692
            +++GVHAFIAQI
Sbjct  61   RNEGVHAFIAQI  72



>gb|ELT92145.1| hypothetical protein CAPTEDRAFT_182867 [Capitella teleta]
Length=680

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 115/214 (54%), Gaps = 15/214 (7%)
 Frame = +3

Query  51   GGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTM  230
            G  ++  M +L+D  NL+ R   Y   +      P+           Y+  +   R +  
Sbjct  80   GDFNIPAMTELLDNDNLEMRQK-YRAFLSEGTMTPK-----------YDIPLAAHRELAQ  127

Query  231  RRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLG  410
            +R+  + D G       ++  E+ LR  A  ++ A+ D  ++VK+ V F L+GG +  LG
Sbjct  128  KRLKTICDAGFIS---VKDFIENPLRIFAAHELAAILDPDMAVKMTVQFNLFGGTVLKLG  184

Query  411  TKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKY  590
            TKRHHD  L   ++    GCF +TELG G+N   +ET   YD  +GEFVINTP E AQKY
Sbjct  185  TKRHHDVLLAGIDSLDDVGCFGLTELGFGNNAIEMETTAVYDKESGEFVINTPTELAQKY  244

Query  591  WIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            WI   A HA H +VF+QL +DGK QG+H  + +I
Sbjct  245  WITNGAVHAKHCVVFAQLSVDGKQQGIHGILVRI  278



>ref|XP_002950277.1| hypothetical protein VOLCADRAFT_104659 [Volvox carteri f. nagariensis]
 gb|EFJ48478.1| hypothetical protein VOLCADRAFT_104659 [Volvox carteri f. nagariensis]
Length=629

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 117/208 (56%), Gaps = 15/208 (7%)
 Frame = +3

Query  69   EMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHL  248
            EM+  +   N + R+ +Y  + +  L+ P           ++ Q + + R  T++R+   
Sbjct  33   EMKDFLVHDNKELREAIYEFL-KDDLYRP-----------NHYQGLMEFREQTLQRLKKF  80

Query  249  LDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHD  428
            +    F      N P    R +A L+ +   D+SL++K GVHF L GG I  LGT  HH+
Sbjct  81   VAQKFFSVRDYTNEPR---RFMAALESLMYADYSLAIKAGVHFTLCGGTIAKLGTAYHHN  137

Query  429  EWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAA  608
            ++L   ++  + GCF MTELGHGSNV GIET   YD  +G+F+INTP + A KYWIGG+ 
Sbjct  138  KYLPGMDDLTLPGCFGMTELGHGSNVMGIETTAVYDKASGQFIINTPNDEASKYWIGGSG  197

Query  609  NHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             H     VF+QL ++G+ QG H F+ +I
Sbjct  198  QHGKICAVFAQLTVNGQWQGPHVFVVRI  225



>ref|WP_013937938.1| acyl-CoA dehydrogenase [Myxococcus fulvus]
 gb|AEI64784.1| putative acyl-CoA dehydrogenase [Myxococcus fulvus HW-1]
Length=777

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 126/232 (54%), Gaps = 14/232 (6%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S  P  S T  E  EP   D   +R ++D    + R       ++  L +P  R      
Sbjct  142  SLVPAASPTRFEQREPTSFDPVALRAVLDRTYPETR-----AQVRQWLADPAYRYTDTRD  196

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRK-LALLDVIALFDHSLS  356
             A Y       R   +  +  L D G+ +  +  +N   S+L   +   + +A FD SL 
Sbjct  197  TAKY-------RDQVLAWLKALADQGLGRIAFPQDNETGSDLGAFITAFETLAYFDLSLV  249

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GVHF L+G +I FLGT++HH ++L    +  + GCFAM+ELGHGSNVR +ETV  YD
Sbjct  250  VKAGVHFGLFGASILFLGTQKHHQQYLPRVASLELPGCFAMSELGHGSNVRDVETVARYD  309

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            + TGEFV++TP E+A+K WIG AA H     VF+QL++ G+  GVHA +  +
Sbjct  310  AETGEFVVHTPSETARKEWIGNAARHGRIATVFAQLEVGGQALGVHALLVPL  361



>ref|WP_015352554.1| acyl-CoA dehydrogenase [Myxococcus stipitatus]
 ref|YP_007363984.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
 gb|AGC48300.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=780

 Score =   145 bits (365),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A FD SL VK+GVHF L+G ++ FLGT+RHH E+L    +  + GCFAM+ELG
Sbjct  238  IAAFETLAFFDLSLVVKVGVHFGLFGASVLFLGTERHHREYLPKVASLELPGCFAMSELG  297

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNVR ++TV  YD+  G FV++TP +SA+K WIG AA H     VF+QL++ GK  GV
Sbjct  298  HGSNVRDVKTVARYDAEAGNFVVHTPSDSARKEWIGNAAKHGRIATVFAQLEVGGKALGV  357

Query  672  HAFIAQI  692
            HA +  +
Sbjct  358  HALLVPL  364



>ref|XP_003288045.1| hypothetical protein DICPUDRAFT_78883 [Dictyostelium purpureum]
 gb|EGC35432.1| hypothetical protein DICPUDRAFT_78883 [Dictyostelium purpureum]
Length=663

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 125/220 (57%), Gaps = 13/220 (6%)
 Frame = +3

Query  33   PEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQ  212
            P ++E   L    ++ ++DG    DRD L  +  +S  F+      ++F+  + + + ++
Sbjct  28   PHLNETPNLKT--LKSILDGEYHFDRDRLKELFEESSTFD------EIFL--NKSIHTDE  77

Query  213  QRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGG  392
             R  T++    ++   + K    E  P+   + L   + I+L D S+S+K  V + LWGG
Sbjct  78   HREQTLKACKEIIQLQIVKLSDMEKNPK---KFLNWFETISLCDPSVSLKFAVQYNLWGG  134

Query  393  AIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPC  572
             I FLGTK+HH+ +L   EN ++ G F +TELGHGSNV G+ET  TYD    EF+IN+P 
Sbjct  135  TILFLGTKKHHERYLDGIENGSILGVFGLTELGHGSNVNGLETTATYDEANQEFIINSPT  194

Query  573  ESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             ++QKYW G  + H     VF++L + G D+G+HAF+  I
Sbjct  195  WNSQKYWPGNISRHGQMATVFARLILRGVDKGIHAFVVPI  234



>ref|WP_011404446.1| acyl-CoA oxidase [Salinibacter ruber]
 ref|YP_445820.1| acyl-coenzyme A oxidase I [Salinibacter ruber DSM 13855]
 gb|ABC46051.1| acyl-coenzyme A oxidase I, putative [Salinibacter ruber DSM 13855]
Length=786

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 121/223 (54%), Gaps = 14/223 (6%)
 Frame = +3

Query  30   PPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNME  209
            P  V      D   MR+L+DG + + R+      I++ L +P      VF   D     E
Sbjct  156  PSPVEPEAPFDTDAMRRLLDGPHAELRE-----DIRTLLQDP------VFEYQD-GLGTE  203

Query  210  QQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRK-LALLDVIALFDHSLSVKLGVHFIL  383
              R   +R   HL D G+    +    G   ++ K +   + +A  D SL VK GV F L
Sbjct  204  AYREQVLRWCEHLADQGLGALAYPDAYGGGGDMEKFIVAFETLAYHDLSLVVKFGVQFGL  263

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG+I  LGT+RHH+E+L       + GCFAMTE GHGSNVR +ET   YD  T EFVIN
Sbjct  264  FGGSIHHLGTERHHEEYLDRVGTLDLPGCFAMTEWGHGSNVRELETTARYDPTTEEFVIN  323

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP + A+K WIG AA H     VF+QL+ DG++ GVHAF+  I
Sbjct  324  TPHDGARKEWIGNAAAHGQVATVFAQLRTDGEEHGVHAFLVPI  366



>ref|WP_013062161.1| acyl-CoA oxidase [Salinibacter ruber]
 emb|CBH24828.1| acyl-Coenzyme A oxidase [Salinibacter ruber M8]
Length=768

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 121/223 (54%), Gaps = 14/223 (6%)
 Frame = +3

Query  30   PPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNME  209
            P  V      D   MR+L+DG + + R+ +   ++Q  +F  ++  G            E
Sbjct  138  PSPVEPEAPFDTDAMRRLLDGPHAELREDIR-TLLQDPVFEYQDGLG-----------TE  185

Query  210  QQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRK-LALLDVIALFDHSLSVKLGVHFIL  383
              R   +R   HL D G+    +    G   ++ K +   + +A  D SL VK GV F L
Sbjct  186  AYREQVLRWCEHLADQGLGALAYPDAYGGGGDMEKFIVAFETLAYHDLSLVVKFGVQFGL  245

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG+I  LGT+RHH+E+L       + GCFAMTE GHGSNVR +ET   YD  T EFVIN
Sbjct  246  FGGSIHHLGTERHHEEYLDRVGTLDLPGCFAMTEWGHGSNVRELETTARYDPTTEEFVIN  305

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP + A+K WIG AA H     VF+QL+ DG++ GVHAF+  I
Sbjct  306  TPHDGARKEWIGNAAAHGQVATVFAQLRTDGEEHGVHAFLVPI  348



>ref|XP_002677851.1| acyl-coenzyme A oxidase [Naegleria gruberi]
 gb|EFC45107.1| acyl-coenzyme A oxidase [Naegleria gruberi]
Length=750

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 128/234 (55%), Gaps = 16/234 (7%)
 Frame = +3

Query  6    ASPCLSYT-PPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLF----NPRERGG  170
            A+P L YT P E ++      +      D   +Q   WL G   +  ++    NP     
Sbjct  57   ANPTLGYTYPNEENDRYSSISYNYNHTFDVKKMQA--WLNGSFDKKAMYKFLDNP-----  109

Query  171  KVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHS  350
             + +    N   E+ R +T++++  L   G+++    +  PE  L +L   +   L + S
Sbjct  110  -LLLKRSTNMPKEEARELTLQQVAFLCKSGLYRISDMKKTPELILNRL---ENTGLIESS  165

Query  351  LSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTT  530
             +VKLGV  +L+ G+I  LGTK+HHD++L+  E   + G FAMTE+ HGSNVR ++T  T
Sbjct  166  SNVKLGVQLVLFAGSILNLGTKKHHDKYLKAAECIELPGMFAMTEIEHGSNVRQLQTTAT  225

Query  531  YDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +D  T EF+INTP + A K+W+G AA H     VF++L + GKD GVHAF+  I
Sbjct  226  FDENTNEFIINTPNKGAVKWWLGNAACHGVMATVFARLILKGKDYGVHAFLCPI  279



>ref|WP_044187894.1| acyl-CoA oxidase [Hyalangium minutum]
 gb|KFE69122.1| Acyl-coenzyme A oxidase 1, peroxisomal [Hyalangium minutum]
Length=781

 Score =   144 bits (362),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A FD SL VK+GV+F L+GG+I FLGT+RHH + L    +  + GCFAM+EL 
Sbjct  238  IAAFETLASFDLSLVVKVGVNFGLFGGSIYFLGTERHHRQVLPKVASLELPGCFAMSELA  297

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNVR +ETV  YD  TGEFV++TP E A+K WIG AA HA    VF+QL++ G+  GV
Sbjct  298  HGSNVRDVETVAIYDDITGEFVVHTPSEGARKEWIGNAAQHARLATVFAQLEVKGERHGV  357

Query  672  HAFIAQI  692
            HA +  +
Sbjct  358  HALLVPL  364



>ref|WP_002637005.1| acyl-CoA dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90529.1| Acyl-coenzyme A oxidase 1, peroxisomal protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=777

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 127/232 (55%), Gaps = 14/232 (6%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S  P  S +  E   P   D   +R+++D    + R       ++  L +P       F 
Sbjct  142  SLVPAASPSRVEPRAPTSFDPEALRQVLDRTYPETR-----AQVRKWLADP------AFR  190

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRK-LALLDVIALFDHSLS  356
              D  ++  + R   +  +  L D G+ +  +  +N   S+L   L   + +A FD SL 
Sbjct  191  YTD-TRDTTKYRDQVLTWLKALADQGLGRIAFPKDNETRSDLGPFLTAFETMAYFDLSLV  249

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            +K GVHF L+G +I FLGT++HH ++L    +  + GCFAM+ELGHGSNVR +ETV  YD
Sbjct  250  IKAGVHFGLFGASILFLGTEKHHQKYLPQVASLELPGCFAMSELGHGSNVRDVETVARYD  309

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV++TP E+A+K WIG AA H     VF+QL++ G+  GVHA +  +
Sbjct  310  VETGEFVVHTPTETARKEWIGNAARHGRIATVFAQLEVGGRSLGVHALLVPL  361



>ref|XP_003294150.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
 gb|EGC29318.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
Length=638

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 114/178 (64%), Gaps = 3/178 (2%)
 Frame = +3

Query  162  RGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALF  341
            +  K+ +   +  ++E +R  +  +   L++  V +   +    E   RKLA+      F
Sbjct  61   KTDKLLLKDSFGLSLEGEREQSFIQFKRLME--VLRQNFSLYDLERNPRKLAVFTQSYRF  118

Query  342  -DHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIE  518
             + S++  +GVHF L+G +I FLG+    +++++  E   V GCF++TELGHGSNV+ IE
Sbjct  119  VNISVTTLIGVHFSLFGASILFLGSNEQREKYIKKIETLEVVGCFSLTELGHGSNVQQIE  178

Query  519  TVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T+  YD  T EF+IN+P  ++QKY+IGGAA +A+HTI+ +QLK+ GK +GVHAF+A+I
Sbjct  179  TIAEYDHNTQEFIINSPTITSQKYFIGGAAKNASHTIIMAQLKVAGKMEGVHAFVARI  236



>ref|XP_643323.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL69332.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=628

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +3

Query  306  RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTE  485
            R   ++++ +L+++++  KLGVH+ L+GG I FLGT RH ++++ D       GCFAMTE
Sbjct  110  RYAGVVEMFSLYNNNVCTKLGVHYTLFGGTIMFLGTSRH-EKYIEDANTLKTMGCFAMTE  168

Query  486  LGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ  665
            +GHGSNVRGIET   YD +T EF+I++P  +++K+WIGG+  HAT+T VF+ L IDG + 
Sbjct  169  IGHGSNVRGIETTAHYDKQTKEFIIHSPTPTSEKFWIGGSYLHATYTTVFANLIIDGTNY  228

Query  666  GVHAFIAQI  692
            GVHA +  +
Sbjct  229  GVHALVVPL  237



>ref|XP_002128280.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Ciona intestinalis]
Length=654

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 118/213 (55%), Gaps = 15/213 (7%)
 Frame = +3

Query  54   GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMR  233
            G D+ E+  L+D  N + RD  +   +   +  P+           YN  + ++R + ++
Sbjct  59   GFDINELATLLDHDNHEMRDE-FRKFVSDPIMTPK-----------YNIPLAEERDVALK  106

Query  234  RIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGT  413
            R+  + D G       ++ P   LR  A  ++ A+ D ++S K+ V F L+GG +  LGT
Sbjct  107  RLKRICDGGFISVLDFQHNP---LRIFAAHELAAIIDPAMSTKMTVQFNLFGGTVLKLGT  163

Query  414  KRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYW  593
            +RHH++ L+  +     GCF +TELG+G+N   +ET   YD  + EF+INTP   AQKYW
Sbjct  164  ERHHEKLLKGIDTLDDVGCFGLTELGYGNNAVEMETTAVYDKESKEFIINTPTTLAQKYW  223

Query  594  IGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            I   A HA H IVF+QLK+  ++ G+H F+ +I
Sbjct  224  ITNGAVHAKHIIVFAQLKVGDEEHGIHGFMVRI  256



>ref|XP_003287521.1| hypothetical protein DICPUDRAFT_97730 [Dictyostelium purpureum]
 gb|EGC35948.1| hypothetical protein DICPUDRAFT_97730 [Dictyostelium purpureum]
Length=690

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 123/203 (61%), Gaps = 19/203 (9%)
 Frame = +3

Query  93   HNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKG  272
            HN+  RD L  IM    LF+            D N   E+QR  T++++  +   G+F  
Sbjct  66   HNI--RDELNRIMSDKSLFH-----------GDVNLGKEEQRVQTLKQLLAIAQ-GIFDK  111

Query  273  WLTE--NGPESELRKLALLDVIALFDH-SLSVKLGVHFILWGGAIQFLGTKRHHDEWLRD  443
             L +  +  E   + LA++D+++ FD  SL  KL V+  L+G A+  LGT+RHH + L +
Sbjct  112  GLVQITDLREDPSKILAMMDIVSQFDDDSLMTKLIVNNFLFGAAVFNLGTERHH-KLLPE  170

Query  444  TENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATH  623
             ++  + GCFAMTELGHGSNVR +ET  TYD +T EF+INTP  ++ K+WIG A  HAT 
Sbjct  171  IQSGRLLGCFAMTELGHGSNVRSLETTATYDPKTNEFIINTPLRTSTKWWIGNAG-HATI  229

Query  624  TIVFSQLKIDGKDQGVHAFIAQI  692
            + VF++L IDGKDQ VH F+  I
Sbjct  230  SSVFARLIIDGKDQEVHCFLVPI  252



>ref|WP_007237397.1| acyl-CoA oxidase [Gordonia otitidis]
 dbj|GAB33138.1| putative acyl-CoA oxidase [Gordonia otitidis NBRC 100426]
Length=681

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 129/235 (55%), Gaps = 23/235 (10%)
 Frame = +3

Query  21   SYTPPEVSEPGGLD----VWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAA  188
            S TP + SE  G D    V  +R ++DG     RD            + R R  +  +  
Sbjct  26   STTPDDASELFGADRELLVDNLRYVLDGRWRATRD------------DVRTRSNRADLLP  73

Query  189  DYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVIALFDHSLSVK  362
            D ++ +EQ R   +  +  L   G    G+  ++G   ++   +  ++++   D SL VK
Sbjct  74   DPSRTLEQARTRILDEMRELSAQGFASAGFGADHGGTGDIGASITAIEMLGYADLSLMVK  133

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
             GV + LWGGA++ LGT RHH++++ DT N  + GCFAMTE GHGSNV+ +ET  TYD+ 
Sbjct  134  AGVQWGLWGGAVENLGTARHHEKYVADTINLDLLGCFAMTETGHGSNVQALETTATYDAA  193

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVHAFIAQI  692
            T EFVI++P  SA+K +IGGAA HA +  VF+QL   G  Q     GVH F+  I
Sbjct  194  TKEFVIHSPTPSARKDYIGGAAEHARYAAVFAQLITAGPGQEPESYGVHCFVVPI  248



>dbj|GAM20274.1| hypothetical protein SAMD00019534_034490, partial [Acytostelium 
subglobosum LB1]
Length=662

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 118/211 (56%), Gaps = 11/211 (5%)
 Frame = +3

Query  60   DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRI  239
            DV  ++ L+DG    DRD +  +M  S  F+      ++ +    +Q  E QR  T+   
Sbjct  49   DVNLLKHLLDGGYSNDRDRIRKLMQTSSAFD------ELHLTQLLSQ--EVQRERTLIAA  100

Query  240  GHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKR  419
              +++  +       + P    + L+  + +A  D S+ +K  V + LWGG I  LGTK+
Sbjct  101  KEVINESIVSVTDMIDNPA---KFLSWFETVAFCDPSVVLKFAVQYNLWGGTILLLGTKK  157

Query  420  HHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIG  599
            HHD++L D  N  + G F +TELGHGSNV+G+ET +T+D RT EF+IN+P  ++QKYW G
Sbjct  158  HHDKYLNDITNGKLLGVFGLTELGHGSNVQGLETTSTFDPRTQEFIINSPTWTSQKYWPG  217

Query  600  GAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              A H     VF++L I   D GVHAF+  I
Sbjct  218  NIATHGQMATVFARLIIGDTDHGVHAFVVPI  248



>ref|XP_002672633.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
 gb|EFC39889.1| peroxisomal acyl-CoA oxidase [Naegleria gruberi]
Length=601

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 103/166 (62%), Gaps = 4/166 (2%)
 Frame = +3

Query  195  NQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVH  374
            N   E+ R + ++++  L   G F     +  PE  L+++       + D S++VKLGV 
Sbjct  16   NITKEEAREVALKQVIFLCQSGYFNVTDMKKNPELFLQRME----AGIIDASMNVKLGVQ  71

Query  375  FILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEF  554
             +L+ G+I  LGTK+HHD +L+  E   + G FAMTE+ HGSNVR ++T   +D +T EF
Sbjct  72   LLLFAGSIMNLGTKKHHDLYLKRAERCELPGAFAMTEIEHGSNVRELKTTAIFDEQTNEF  131

Query  555  VINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            V+NTP + A K+W+G AA HAT   VF++L + GKD GVHAF+  I
Sbjct  132  VLNTPNKGAIKWWLGNAACHATMATVFARLILKGKDYGVHAFLCPI  177



>gb|EFA78532.1| putative acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=669

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 107/165 (65%), Gaps = 6/165 (4%)
 Frame = +3

Query  201  NMEQQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRKLALLDVIALFDHSLSVKLGVHF  377
            N+ +QR +T++R+  +   G+ K G + E       R +A  + + L D SL+VK  V +
Sbjct  85   NVPEQRDLTLKRLKMVASLGILKMGEVAEQFK----RFVAFQESLVLSDMSLAVKSSVQW  140

Query  378  ILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFV  557
             L+ G+I FLGT +H  ++ +DT+   + GCFA+TELGHGSNV+G+ET+  YD  T EFV
Sbjct  141  GLFAGSIVFLGTDKHK-KYYQDTDCLNILGCFALTELGHGSNVKGVETLAEYDHSTREFV  199

Query  558  INTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            I+TP +SAQK WIG A  H T+  VF+ L + G++ G+H F+ QI
Sbjct  200  IHTPNDSAQKMWIGNAGQHGTYATVFANLVVKGENHGLHPFLVQI  244



>ref|XP_004360048.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG22197.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=1655

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 118/215 (55%), Gaps = 12/215 (6%)
 Frame = +3

Query  51   GGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD-YNQNMEQQRGMT  227
            G  +V  +  L+DG   QDRD L+       LF   E   + F+    Y     ++R + 
Sbjct  45   GSPNVEYLTSLLDGDFKQDRDHLF------RLFQNNEEFDEPFLTEPGYTNYKHRERTLI  98

Query  228  MRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFL  407
              ++  + D  +      +N P+   + LA  + I+  D S+S+K  V + LWGG I FL
Sbjct  99   ASKL--IADQEIVTLEDMKNRPD---KFLAWFETISYADLSVSLKFAVQYNLWGGTILFL  153

Query  408  GTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQK  587
            GT++HH ++L   ++    G F +TELGHGSNV G+ET  TYD  T EF++N+P  ++QK
Sbjct  154  GTEKHHSKYLSGIQDCTKLGVFGLTELGHGSNVNGLETTATYDQETKEFIVNSPTWTSQK  213

Query  588  YWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            YW G  A H     VF++L + G+D GVHAF+  I
Sbjct  214  YWPGNIATHGQFCTVFARLILKGRDHGVHAFVVPI  248



>emb|CCO32276.1| hypothetical protein BN14_06332 [Rhizoctonia solani AG-1 IB]
Length=532

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 122/223 (55%), Gaps = 20/223 (9%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            Y PP    P    V E++++ D  N   RD  Y  +    LF PR           +N +
Sbjct  4    YAPP----PASFKVEELKRVFDHDNFDKRD-AYRALADEPLFVPR-----------HNVS  47

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            +  +R + + R+  + +  +   +  E  P   L  +A  ++  + D S + K+ V + L
Sbjct  48   LSYERELALDRLKRVSETKMISVFDFEKNP---LNVMAAHELSGMLDPSFTTKMTVQYNL  104

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  LGT RH  ++L   ++ +V GCFA+TELG+G+N   +ET   +D +T EF+IN
Sbjct  105  FGGTVLKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIIN  163

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP   AQKYWI  +A HA + +VF+QL  +G ++G+HAF+ +I
Sbjct  164  TPSVIAQKYWITNSAVHANYAVVFAQLIFEGTNEGIHAFLVRI  206



>gb|ELU16781.1| hypothetical protein CAPTEDRAFT_177414 [Capitella teleta]
Length=594

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            M +L+D  N + R      + + ++  P+           Y+  +   R +  +R+  + 
Sbjct  1    MTQLLDNDNFEMRQKYRAFLSEGNM-TPK-----------YDIPLAVHRDLAQQRLKAIC  48

Query  252  DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDE  431
            D G        +  E+ LR  A  ++ A+ D  +++K+ V F L+GG +  LGTKRHHDE
Sbjct  49   DAGFIS---VLDFIENPLRIFAAHELAAVLDPDMTIKMTVQFNLFGGTVLKLGTKRHHDE  105

Query  432  WLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAAN  611
             L   ++    GCFA+TELG G+N   +ET   YD  T EFVINTP E AQKYWI   A 
Sbjct  106  LLAGIDSLDDVGCFALTELGFGNNAIEMETTAVYDKDTDEFVINTPTELAQKYWITNGAV  165

Query  612  HATHTIVFSQLKIDGKDQGVHAFIAQI  692
            HA H +VF+QL +DG  QG+H  + +I
Sbjct  166  HAKHCVVFAQLSVDGTHQGIHGILVRI  192



>ref|WP_030226700.1| acyl-CoA oxidase [Streptomyces lavendulae]
Length=656

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 127/241 (53%), Gaps = 36/241 (15%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYG-IMIQSHLFNP--------  155
            S++P  +Y  PE+      DV  +  ++DG     RD + G +   S + +         
Sbjct  6    SSAPATAYAQPEI------DVPALTAVLDGEYAGIRDLVRGNLTTYSSILDEADELGIDA  59

Query  156  -RERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESEL-RKLALLDV  329
             RER  +V V          Q GM               G+  E G   ++   +A  + 
Sbjct  60   YRERVREVVV----KMAATGQTGM---------------GFPVEYGGGGDVGASIAAFET  100

Query  330  IALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVR  509
            +A  D S+ VK+GV F L+GGAI  LGT RHH+ +L       + G FAMTE GHGSNV+
Sbjct  101  LAFGDLSVLVKVGVQFGLFGGAILHLGTGRHHEAYLPGLITGELMGSFAMTETGHGSNVQ  160

Query  510  GIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQ  689
             + TV TYDS TGEFVI TP + A+K +IG AA HA   +VF+QL++DG+ QGVHAF+  
Sbjct  161  ALGTVATYDSATGEFVITTPDDDARKDYIGNAARHAELAVVFAQLEVDGRSQGVHAFVVP  220

Query  690  I  692
            +
Sbjct  221  L  221



>ref|WP_033400952.1| acyl-CoA oxidase, partial [Actinokineospora enzanensis]
Length=634

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = +3

Query  150  NPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFK-GWLTENGPESEL-RKLALL  323
            + RER       + ++   EQ R   +  +  L   G  + G+ T  G E +    L   
Sbjct  24   DARERMAAFPSPSTHDLTTEQHRAQVLDELRALAKAGYPRHGFPTRYGGEGDTGATLTSF  83

Query  324  DVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSN  503
            +++   D SL VK GV + L+GGA++ LGT+RHH+ +LRD  +  + GCFAMTE GHGS+
Sbjct  84   EMLGFGDLSLMVKAGVQWGLFGGAVEALGTERHHERYLRDIISLDLPGCFAMTETGHGSD  143

Query  504  VRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFI  683
            V+ + T  T+D  TGEFVINTP E+A+K +IG AA      +VF+QL +DG+++GVHA  
Sbjct  144  VQHLRTTATHDPDTGEFVINTPHEAARKDYIGNAARDGRAAVVFAQLIVDGRERGVHALF  203

Query  684  AQI  692
            A+I
Sbjct  204  ARI  206



>gb|ABF87186.1| putative acyl-CoA dehydrogenase [Myxococcus xanthus DK 1622]
Length=660

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +3

Query  321  LDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGS  500
             + +A FD SL +K GVHF L+G +I FLGT++HH ++L    +  + GCFAM+ELGHGS
Sbjct  121  FETLAYFDLSLVIKAGVHFGLFGASILFLGTEKHHRKYLPQVASLELPGCFAMSELGHGS  180

Query  501  NVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAF  680
            NVR +ETV  YD+  GEFV++TP E+A+K WIG AA H     VF+QL++ G+  GVHA 
Sbjct  181  NVRDVETVARYDAEAGEFVVHTPTETARKEWIGNAARHGRIATVFAQLEVGGRVLGVHAL  240

Query  681  IAQI  692
            +  +
Sbjct  241  LVPL  244



>ref|XP_001732973.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EDR41097.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=629

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  306  RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTE  485
            R +  L++ AL+++++  KL V + L+GG I FLGT RH ++++ D       GCFAMTE
Sbjct  111  RYIGALEMFALYNNNILTKLSVQYTLFGGPIIFLGTSRH-EKYIEDANTLKTMGCFAMTE  169

Query  486  LGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ  665
            +GHGSNVRGIET   YD +T EF+I++P  +++K+WIG A  HAT+ +VF+ L IDG + 
Sbjct  170  IGHGSNVRGIETTAHYDKQTKEFIIHSPTPTSEKFWIGCAYLHATYAVVFANLIIDGTNY  229

Query  666  GVHAFIAQI  692
            G+HAFI  +
Sbjct  230  GIHAFIVPL  238



>ref|WP_020478009.1| acyl-CoA dehydrogenase [Myxococcus xanthus]
Length=777

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +3

Query  321  LDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGS  500
             + +A FD SL +K GVHF L+G +I FLGT++HH ++L    +  + GCFAM+ELGHGS
Sbjct  238  FETLAYFDLSLVIKAGVHFGLFGASILFLGTEKHHRKYLPQVASLELPGCFAMSELGHGS  297

Query  501  NVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAF  680
            NVR +ETV  YD+  GEFV++TP E+A+K WIG AA H     VF+QL++ G+  GVHA 
Sbjct  298  NVRDVETVARYDAEAGEFVVHTPTETARKEWIGNAARHGRIATVFAQLEVGGRVLGVHAL  357

Query  681  IAQI  692
            +  +
Sbjct  358  LVPL  361



>ref|XP_642669.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL68701.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=638

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 129/231 (56%), Gaps = 12/231 (5%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            S + CLS   P+          E+++  D + L    + Y + ++  L +         +
Sbjct  17   SNNDCLSEIDPQY--------MEIKQSFDANLLNKYLFPYELELKESL-STFWNNENFLL  67

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDH-SLSV  359
               +  ++EQ R +T  +   L++       L +   E   +K+A+      F + S++ 
Sbjct  68   QPSFGLSLEQDRELTFNQFKKLMELATKHFGLID--LERNPKKIAVFTQGYRFQNPSVTT  125

Query  360  KLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDS  539
             +GVHF L+G +I FLG++    ++    E   + GCF++TELGHGSNV+ IET+  YD 
Sbjct  126  LMGVHFSLFGASIVFLGSEEQRKKYTEKVEKLEIIGCFSLTELGHGSNVQSIETIAEYDH  185

Query  540  RTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
               EF+IN+P  ++QKY+IGG+A +ATHTI+ +QLK+ GK +GVHAF+A+I
Sbjct  186  DKEEFIINSPTITSQKYFIGGSAKNATHTIIMAQLKVSGKMEGVHAFVARI  236



>emb|CEL63350.1| hypothetical protein RSOLAG1IB_05394 [Rhizoctonia solani AG-1 
IB]
Length=638

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 122/223 (55%), Gaps = 20/223 (9%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            Y PP    P    V E++++ D  N   RD  Y  +    LF PR           +N +
Sbjct  4    YAPP----PASFKVEELKRVFDHDNFDKRD-AYRALADEPLFVPR-----------HNVS  47

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            +  +R + + R+  + +  +   +  E  P   L  +A  ++  + D S + K+ V + L
Sbjct  48   LSYERELALDRLKRVSETKMISVFDFEKNP---LNVMAAHELSGMLDPSFTTKMTVQYNL  104

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  LGT RH  ++L   ++ +V GCFA+TELG+G+N   +ET   +D +T EF+IN
Sbjct  105  FGGTVLKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIIN  163

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP   AQKYWI  +A HA + +VF+QL  +G ++G+HAF+ +I
Sbjct  164  TPSVIAQKYWITNSAVHANYAVVFAQLIFEGTNEGIHAFLVRI  206



>ref|XP_004339964.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR17948.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=742

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  339  FDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIE  518
            +D S+++K GVHF+L+GG++  LGT+RH  +W   T N A  GCFAMTELGHGSNV+GI 
Sbjct  165  YDGSIAIKAGVHFLLFGGSVVNLGTERHQ-KWYDATNNLAEGGCFAMTELGHGSNVQGIG  223

Query  519  TVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T   YD  TGEFVINTP +  +K+WIG AA HA + +VF+QL +DG++ GVHAF+  +
Sbjct  224  TTAVYDKATGEFVINTPTDVDRKWWIGHAA-HAKNAVVFAQLNVDGQEHGVHAFVVPL  280



>ref|XP_004350494.1| hypothetical protein DFA_11547 [Dictyostelium fasciculatum]
 gb|EGG13786.1| hypothetical protein DFA_11547 [Dictyostelium fasciculatum]
Length=2331

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +3

Query  321  LDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGS  500
            +++++ +++++  KLGVH+ LWGG I  LGTKRH ++++  ++  ++ G F+MTE+GHGS
Sbjct  164  IEILSTYNNNICTKLGVHYSLWGGTILLLGTKRH-EKYIEPSDKLSIVGSFSMTEMGHGS  222

Query  501  NVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAF  680
            NVRG+ET  T+D  T EFV+++P  SA K WIGG A HA +T VF++L ID KD GVHAF
Sbjct  223  NVRGLETTATFDRATKEFVVHSPSPSAYKVWIGGTALHAHYTTVFARLVIDSKDYGVHAF  282

Query  681  IAQI  692
            +  I
Sbjct  283  VVPI  286



>ref|XP_007537568.1| PREDICTED: acyl-coenzyme A oxidase-like protein, partial [Erinaceus 
europaeus]
Length=402

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 120/216 (56%), Gaps = 15/216 (7%)
 Frame = +3

Query  54   GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMR  233
            GL    + + +DG     +D L  ++  S LF  R           Y+ ++++ R +T +
Sbjct  8    GLQDSALNRYLDGDFWSLKDELCRLLGGSPLFRQR-----------YDLSLDEMRALTFQ  56

Query  234  RIGHLLDCGVFKGWLTENGPESE---LRKLALLDVIALFDHSLSVKLGVHFILWGGAIQF  404
            R+   +   + K  + E   + +    R L + +VI++ D +  VK G+ + L+GGA++ 
Sbjct  57   RVKFTMGLPLLKRAIQEQAEKKKNFVSRSLVIGEVISIADMATGVKCGIIYWLFGGAVRN  116

Query  405  LGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQ  584
            LG+ RH  +WL+  +     G FAMTE GHGSNVRGI+T  T+D  T EFVI+TPCE A+
Sbjct  117  LGSPRHVTKWLQPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDLSTQEFVIDTPCEDAE  176

Query  585  KYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            K +IG A     +  VF+QL I+GK QG H FI  +
Sbjct  177  KMYIGNAM-QGNYAAVFAQLIINGKSQGPHCFIVPV  211



>ref|XP_001639738.1| predicted protein [Nematostella vectensis]
 gb|EDO47675.1| predicted protein [Nematostella vectensis]
Length=594

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 116/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            M +L+D  N + R+    I+ +  L  P+           YN +++++R + ++R+  L 
Sbjct  1    MTRLLDHDNHEKREKFRKILSEDPLMKPK-----------YNISVDEERALALKRLKKLC  49

Query  252  DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDE  431
            D G        + P       A  ++ A+ D S++ K+ V F L+GG +  LGT+RHH +
Sbjct  50   DQGFISVLDFRHNPR---WIFAAHELAAVVDGSMATKMTVQFNLFGGTVLKLGTERHHSK  106

Query  432  WLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAAN  611
             L+  ++    GCF +TELG+G+N   +ET  TYD+ T EF++NTP   AQKYWI   A 
Sbjct  107  LLKGIDSLEDVGCFGLTELGYGNNAVQMETTATYDNETQEFIVNTPSTLAQKYWITNGAC  166

Query  612  HATHTIVFSQLKIDGKDQGVHAFIAQI  692
             A H +VF+QL ++GK++G+H  +  I
Sbjct  167  DAHHIVVFAQLYVNGKNEGIHGVLVPI  193



>dbj|GAM18567.1| hypothetical protein SAMD00019534_017420 [Acytostelium subglobosum 
LB1]
Length=672

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 134/235 (57%), Gaps = 26/235 (11%)
 Frame = +3

Query  12   PCLSYTPPEVSEPGGLDVWEMRKLM-------DGHNLQDRDWLYGIMIQSHLFNPRERGG  170
            P  + TP E   P  LD +++ KL        D  N+++R  L   M +  LF P+    
Sbjct  31   PLKTSTPLEWRIPV-LDDFKVEKLKSTILGHPDEENIENRRLLLEAM-RDPLFRPQ----  84

Query  171  KVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRKLALLDVIALFDH  347
                       + +QR +T++R+  + +  + K G + +       R ++  + + L D 
Sbjct  85   -------LYATVPEQRELTLKRLRKVSELRILKMGEIAQKFK----RFVSFQESLVLCDM  133

Query  348  SLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVT  527
            SLSVK  VH+ L+ G++ FLGT++H  ++  D +   + GCFA+TE+GHGSNV+GIET+ 
Sbjct  134  SLSVKSSVHWGLFAGSVVFLGTEKHR-QYFDDIDICNILGCFALTEMGHGSNVKGIETLA  192

Query  528  TYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             YD+RT EFVI+TP ++AQK WIG A  H T   VF+ L ++G++ G+H F+ QI
Sbjct  193  EYDNRTREFVIHTPNDTAQKMWIGNAGVHGTMATVFANLVVNGENHGLHPFLVQI  247



>ref|XP_005843308.1| hypothetical protein CHLNCDRAFT_59273 [Chlorella variabilis]
 gb|EFN51206.1| hypothetical protein CHLNCDRAFT_59273 [Chlorella variabilis]
Length=642

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 102/170 (60%), Gaps = 4/170 (2%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVK  362
            A +Y+ +M   R +T +R+   +    F  +     P   L+  A L+ +   D+SL++K
Sbjct  65   APNYHLSMAGFRELTSQRMAKFVGQRFFSVFDYTRDP---LKFQAALECLNFCDYSLAIK  121

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
             GVHF L GG I  LGT++HH   LR  +   + GCFAMTELGHGSNV GIET   YD  
Sbjct  122  DGVHFTLCGGTIAKLGTEKHH-PILRKMDTLELPGCFAMTELGHGSNVMGIETTAQYDPA  180

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            T EFVINTP   A K+WIGG A  A  + VF+QL ++GK +G H F+ ++
Sbjct  181  TREFVINTPNNEASKFWIGGMAQTAKVSAVFAQLTVNGKWEGPHVFVVRL  230



>ref|WP_010639493.1| acyl-CoA oxidase [Streptomyces sp. S4]
Length=653

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_030389344.1| acyl-CoA oxidase [Streptomyces sp. NRRL S-241]
Length=654

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 130/233 (56%), Gaps = 20/233 (9%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMI--QSHLFNPRERGGKV  176
            S++P   Y  PE+      DV  + +++DG     RD +   ++   S L    E G   
Sbjct  7    SSTPATGYVQPEI------DVSALAEVLDGEYAGIRDLVRTNLVTYASVLEEADELGLDA  60

Query  177  FVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESEL-RKLALLDVIALFDHSL  353
            F         E+ R + ++ +      G+  G+ TE G   ++   +A  + +A  D S+
Sbjct  61   F--------RERVREIVVK-MAATGQTGM--GFPTEYGGGGDVGASIAAFETLAFGDLSV  109

Query  354  SVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTY  533
             VK+GV F L+GGAI  LGT+RHHD +L       + GCFAMTE GHGSNV+ + TV  Y
Sbjct  110  LVKVGVQFGLFGGAILHLGTERHHDTYLPGLITGELMGCFAMTETGHGSNVQALGTVARY  169

Query  534  DSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            DS + EFVI TP + A+K +IG AA HA   +VF+QL++DG+ +GVHAF+  +
Sbjct  170  DSASREFVITTPDDRARKDYIGNAARHAELAVVFAQLEVDGRSRGVHAFVVPV  222



>gb|EUC54225.1| acyl-coenzyme A oxidase 3, peroxisomal protein, partial [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=610

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 122/223 (55%), Gaps = 20/223 (9%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            YTPP    P   +V E++++ D  N   RD  +  +    LF PR           +N +
Sbjct  4    YTPP----PATFNVNELKRVFDHDNFDKRD-AFRALADEPLFVPR-----------HNVS  47

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            +  +R + + R+  + +  +   +  E  P   L  +A  +   + D S + K+ V + L
Sbjct  48   LSYERELALDRLKRVSETKMISVFDFEKNP---LNVMAAHEFAGMLDPSFTTKMTVQYNL  104

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  LGT RH  ++L   ++ +V GCFA+TELG+G+N   +ET   +D +T EF+IN
Sbjct  105  FGGTVLKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIIN  163

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP   AQKYWI  +A HA + +VF+QL   G ++G+HAF+ +I
Sbjct  164  TPSVIAQKYWITNSAVHANYAVVFAQLIFQGTNEGIHAFLVRI  206



>ref|XP_004354454.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
 gb|EGG15712.1| acyl-CoA oxidase [Dictyostelium fasciculatum]
Length=476

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 116/215 (54%), Gaps = 12/215 (6%)
 Frame = +3

Query  51   GGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAAD-YNQNMEQQRGMT  227
            G  +V  +  L+DG   QDRD LY       LF   E   + F+    Y     ++R + 
Sbjct  46   GSPNVEYLTSLLDGDFKQDRDHLY------RLFQNNEEFDEPFLTEPGYTNYKHRERTLI  99

Query  228  MRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFL  407
              ++  + D  +      +N P+   + LA  + I+  D S+S+K  V + LWGG I FL
Sbjct  100  ASKL--IADQEIVTLEDMKNRPD---KFLAWFETISYADLSVSLKFAVQYNLWGGTILFL  154

Query  408  GTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQK  587
            GT++HH ++L   ++    G F +TELGHGSNV G+ET  T D    EF++N+P  ++QK
Sbjct  155  GTEKHHSKYLSGIQDCTKLGAFGLTELGHGSNVNGLETTATIDQDRKEFIVNSPTWTSQK  214

Query  588  YWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            YW G  A H     VF++L + G+D GVHAF+  I
Sbjct  215  YWPGNIATHGQFCTVFARLILKGRDHGVHAFVVPI  249



>ref|WP_031177408.1| acyl-CoA oxidase [Streptomyces sp. NRRL B-3253]
Length=653

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|XP_002166799.2| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Hydra 
vulgaris]
Length=641

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 118/212 (56%), Gaps = 15/212 (7%)
 Frame = +3

Query  57   LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRR  236
             +V +M +L+D  N + R   +   +   +F P+           YN ++ ++R + ++R
Sbjct  47   FNVEKMTELLDHDNHKMRKD-FRKFLSDPIFTPK-----------YNISLVEEREVALKR  94

Query  237  IGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTK  416
            +  + D G    +     P   L+  A  ++ ++ D +++ K+ V F L+GG +  LGT 
Sbjct  95   LKKICDAGFISVFDFHKNP---LKIFAAHELASIMDPAMATKMTVQFNLFGGTVLKLGTD  151

Query  417  RHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWI  596
            RHH + L+  ++    GCF +TELG+G+N   +ET+  YD  T EF+INTP   AQKYWI
Sbjct  152  RHHKQLLKGIDSLEDIGCFGLTELGYGNNAVEMETIAVYDKTTDEFIINTPSTLAQKYWI  211

Query  597  GGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
               A HA H +VF+QL ++G + G+H F+ +I
Sbjct  212  TNGAVHAKHCVVFAQLNVEGTEHGIHGFLVRI  243



>ref|WP_003946657.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|EFE79776.1| acyl-CoA oxidase domain-containing protein [Streptomyces albus 
J1074]
 gb|EKC93763.1| acyl-CoA dehydrogenase [Streptomyces sp. SM8]
 gb|AGI92041.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces albus J1074]
Length=653

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_018894104.1| acyl-CoA oxidase [Streptomyces sp. CNY228]
Length=653

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_033238735.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_018471012.1| acyl-CoA oxidase [Streptomyces sp. LaPpAH-202]
Length=653

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDVYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTPGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>gb|KEP51916.1| acyl-coenzyme A oxidase 3, peroxisomal protein [Rhizoctonia solani 
123E]
Length=671

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 122/223 (55%), Gaps = 20/223 (9%)
 Frame = +3

Query  24   YTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQN  203
            YTPP    P   +V E++++ D  N   RD  +  +    LF PR           +N +
Sbjct  36   YTPP----PATFNVNELKRVFDHDNFDKRD-AFRALADEPLFVPR-----------HNVS  79

Query  204  MEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            +  +R + + R+  + +  +   +  E  P   L  +A  +   + D S + K+ V + L
Sbjct  80   LSYERELALDRLKRVSETKMISVFDFEKNP---LNVMAAHEFAGMLDPSFTTKMTVQYNL  136

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG +  LGT RH  ++L   ++ +V GCFA+TELG+G+N   +ET   +D +T EF+IN
Sbjct  137  FGGTVLKLGTSRHR-KYLHGVDDMSVIGCFALTELGYGNNAVEMETTAIWDPKTKEFIIN  195

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP   AQKYWI  +A HA + +VF+QL   G ++G+HAF+ +I
Sbjct  196  TPSVIAQKYWITNSAVHANYAVVFAQLIFQGTNEGIHAFLVRI  238



>gb|EFA77956.1| acyl-CoA oxidase [Polysphondylium pallidum PN500]
Length=617

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 126/214 (59%), Gaps = 15/214 (7%)
 Frame = +3

Query  54   GLDVWEMRKLMDGHNLQD-RDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTM  230
             +++ +++ L+D     + +D +   +  + LF+    G     +A+Y Q +       +
Sbjct  35   SVEIQKLKTLLDTPKYTEFKDRVRTFIQNNPLFHGSVSG---ISSAEYKQRV-------L  84

Query  231  RRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLG  410
             ++  L   G+F      + PE   +  A ++VI+ F+++++ K  VH+ L+GG I  LG
Sbjct  85   LQLKSLATSGLFNITDIRDNPE---KTCAFIEVISEFNNNINTKFAVHYSLFGGTILLLG  141

Query  411  TKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKY  590
            T+RH + +L   +   + GCF+MTE+GHGSNVR +ET  TY  + G F+I++P  ++QK+
Sbjct  142  TERH-EIYLPKADCLDIVGCFSMTEIGHGSNVRSLETTATYCPKAGGFIIHSPTPTSQKF  200

Query  591  WIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            WIGGA  HA +T VF++L + GKD GVHAF+  I
Sbjct  201  WIGGAGLHAHYTTVFARLILGGKDHGVHAFVVPI  234



>ref|WP_015360696.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis]
 gb|AGC75198.1| acyl-CoA oxidase domain-containing protein [Nonlabens dokdonensis 
DSW-6]
Length=768

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 127/223 (57%), Gaps = 6/223 (3%)
 Frame = +3

Query  36   EVSEPGGLDVWEMRKLMDGHNLQDRDWL--YGIMIQSHLFNPRERGGKVFVAADYNQNME  209
            E +   G   + + K   G+++Q +  L  Y   +++ + N  ++  +   +  Y+ ++ 
Sbjct  135  ETNPVQGYQTFTINKPKKGYSVQLKTLLQHYNADLKTRVQNILDKHKEAIES--YDDDLI  192

Query  210  QQRGMTMRRIGHLLDCGVFKGWLTE--NGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
             ++    +    L D G+ K        G +S ++  A+ + +A +D SL++K GVHF L
Sbjct  193  TRKEKVFKWTKELADAGLGKLAYPSAYGGSDSMVQYAAVFEELAKYDLSLTIKFGVHFGL  252

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GG+++ LGT  HHD++L+D    A+ GCFAMTE+ HGSNV+ ++T   Y   T  F+IN
Sbjct  253  FGGSVESLGTTYHHDKYLKDIGTMALPGCFAMTEMYHGSNVKALQTTAIYQPETNSFIIN  312

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP +  +K +IG A  HA    VF+QL +DG++ G+HAF+  I
Sbjct  313  TPSQHDRKTYIGNAGLHAQMATVFAQLIVDGEEHGIHAFLVPI  355



>ref|XP_006500336.1| PREDICTED: acyl-coenzyme A oxidase-like protein isoform X1 [Mus 
musculus]
Length=655

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 119/219 (54%), Gaps = 21/219 (10%)
 Frame = +3

Query  54   GLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMR  233
            GL    + + +DG     ++ L   +  S LF PR           Y+ ++E+ R +T +
Sbjct  8    GLGDSSLFRYLDGELWSLKNELRRALESSPLFQPR-----------YDLSLEEMRALTNQ  56

Query  234  RIGHLLDCGVFKGWLTENGPESELRK------LALLDVIALFDHSLSVKLGVHFILWGGA  395
            R+  +L   V K  L +   + E RK      L L +V+ + D S+S+K G+ F+L+GGA
Sbjct  57   RVKFVLSLPVVKHVLLD---QEEKRKSFISQILILGEVLCMVDVSMSIKCGILFLLFGGA  113

Query  396  IQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCE  575
            I  LG+  H  +W    +     G FAMTE GHGSNVRGI+T  T+D    EFVI+ PCE
Sbjct  114  ISNLGSPEHVTKWFWPLKEQKYTGMFAMTERGHGSNVRGIQTEATFDLDNQEFVIDMPCE  173

Query  576  SAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +A K +IG A  H  +  VF+QL I+GK QG H FI  I
Sbjct  174  NAHKMYIGNAM-HGNYAAVFAQLIIEGKSQGPHCFIVPI  211



>ref|XP_639137.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL65771.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=687

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 120/226 (53%), Gaps = 26/226 (12%)
 Frame = +3

Query  60   DVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRI  239
            +V  +R ++DG    DRD L  +   S+ FN R      F+    +   ++ R  T++  
Sbjct  36   NVKLLRSILDGEFHFDRDRLRELFQSSNTFNER------FLMEPLST--DEHREQTLQAC  87

Query  240  GHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKR  419
              ++   + +    E  P+   + L+  + I++ D S+S+K  V + LWGG I FLGTK+
Sbjct  88   LEIIQLQLVQLNDMEKNPK---KFLSWFESISMCDPSVSLKFAVQYNLWGGTILFLGTKK  144

Query  420  HHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIG  599
            HHD++L D     + G F +TELGHGSNV G+ET  TYD  T EF+IN+P   +QKYW G
Sbjct  145  HHDKYLSDIATGKLLGVFGLTELGHGSNVNGLETTATYDRNTQEFIINSPTWESQKYWPG  204

Query  600  GAANHATHTIVFSQLKIDG---------------KDQGVHAFIAQI  692
              + H     +F++L I+                KD G+HAF+ QI
Sbjct  205  NISKHGKMATIFARLLINDNDIGSGSGSGDSGIKKDMGIHAFVVQI  250



>ref|XP_002991925.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii]
 gb|EFJ07036.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii]
Length=694

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 100/169 (59%), Gaps = 10/169 (6%)
 Frame = +3

Query  207  EQQRGMTMRRIGHLL-DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            ++ R + MR++  ++ + G+    L  N P S        + I   D SL++KLGV F L
Sbjct  99   DKHRELCMRQLTAVVREAGIRPMELLLNDPAS---YFVFTEAIGHIDLSLAIKLGVQFSL  155

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            WGG++  LGTK+H D++L    N    GCFAMTEL HGSNV+ ++T  T+D  T EFVIN
Sbjct  156  WGGSVINLGTKKHRDKYLAGISNLDYPGCFAMTELHHGSNVQALQTTATFDRLTDEFVIN  215

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDG------KDQGVHAFIAQI  692
            TP E A K+WIG AA H     VF++LK+        KD GVHAFI  I
Sbjct  216  TPDEGATKWWIGNAAVHGKFATVFARLKLPSPDSHLDKDMGVHAFIVPI  264



>ref|WP_016696079.1| hypothetical protein, partial [Rhodococcus rhodochrous]
Length=304

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = +3

Query  156  RERGGKVFV----AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLA  317
            RER  K       A  Y    ++ R +T+ ++  L + G    G+  E+G   +    +A
Sbjct  20   RERARKDLAHEKFAPHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVA  79

Query  318  LLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHG  497
             ++++A+ D SL VK GV + L+GGA++ LGT+RHH+++++   +  V GCFAMTE GHG
Sbjct  80   SIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTERHHEKYVKRLIDLDVLGCFAMTETGHG  139

Query  498  SNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHA  677
            S+V+ +ET  TYD  T EFVI++P  S++K +IGGAA HA    VF+QL   G+  GVH 
Sbjct  140  SDVQSLETTATYDPDTQEFVIHSPTPSSRKDYIGGAAQHARFASVFAQLVTQGETHGVHC  199

Query  678  FIAQI  692
            F+  I
Sbjct  200  FVVPI  204



>ref|XP_004351613.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR22836.1| acylCoA dehydrogenase, middle domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=690

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 114/214 (53%), Gaps = 17/214 (8%)
 Frame = +3

Query  51   GGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTM  230
            G  DV  M  L+DG     R       I+       ER   +  A  Y++  EQ R   M
Sbjct  59   GSFDVRAMTHLLDGGEEITR-------IKEEYVALLEREPLMLDAGFYDRTREQARYRVM  111

Query  231  RRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLG  410
            +++              E  PE  LR     D++AL D S S ++GVH+ L+ GA+    
Sbjct  112  QKMKRF----------GELKPEDPLRSKIFNDLVALHDASFSTRMGVHYTLFIGALTGQA  161

Query  411  TKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKY  590
            TK   ++++ D     V G F+MTE+GHGS +R  ET   +D ++  FVINTP  +A K+
Sbjct  162  TKELQEKYVPDARKLRVIGSFSMTEMGHGSAIRHFETTAHFDKQSDTFVINTPTLTATKW  221

Query  591  WIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            WIGGAA+ +THTI F++L ID KD GVH+F+ Q+
Sbjct  222  WIGGAAHISTHTICFARLIIDEKDYGVHSFLMQL  255



>ref|WP_030112305.1| acyl-CoA oxidase, partial [Streptomyces californicus]
Length=345

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  309  KLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTEL  488
             +A  + +AL D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE 
Sbjct  94   SIAAFETLALGDLSVLVKVGVQFGLFGGAILHLGTERHHDAYLPDLITGKLMGCFAMTET  153

Query  489  GHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQG  668
            GHGSNV+ + TV  YD+   EFVI T  + A+K +IG AA H    +VF+QL+IDG  +G
Sbjct  154  GHGSNVQALGTVARYDAAAQEFVITTEGDQARKDYIGNAARHGELAVVFAQLEIDGTSEG  213

Query  669  VHAFIAQI  692
            VHAF+  I
Sbjct  214  VHAFVVPI  221



>ref|WP_002612916.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca]
 gb|EAU67561.1| acyl-coenzyme A oxidase, peroxisomal [Stigmatella aurantiaca 
DW4/3-1]
 gb|ADO74925.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca DW4/3-1]
Length=777

 Score =   137 bits (344),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A FD SL +K GV F L+GG++ FLGT+RHH E L    +  + GCFAM+ELG
Sbjct  234  IAAFETLAFFDLSLVIKAGVQFGLFGGSVFFLGTERHHRELLPKIASLELPGCFAMSELG  293

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNVR + TV  YD + G+FV+ TP E A+K WIG AA H     VF+QL++ G+  GV
Sbjct  294  HGSNVRDVGTVARYDEQRGDFVVETPSEGARKEWIGNAALHGRMATVFAQLEVKGERHGV  353

Query  672  HAFIAQI  692
            HA +  +
Sbjct  354  HALLVPL  360



>ref|XP_002979998.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii]
 gb|EFJ18868.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii]
Length=694

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 100/169 (59%), Gaps = 10/169 (6%)
 Frame = +3

Query  207  EQQRGMTMRRIGHLL-DCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            ++ R + MR++  ++ + G+    L  N P S        + I   D SL++KLGV F L
Sbjct  99   DKHRELCMRQLTAVVREAGIRPMDLLLNDPAS---YFVFTEAIGHIDLSLAIKLGVQFSL  155

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            WGG++  LGTK+H D++L    N    GCFAMTEL HGSNV+ ++T  T+D  T EFVIN
Sbjct  156  WGGSVINLGTKKHRDKYLAGISNLDYPGCFAMTELHHGSNVQALQTTATFDRLTDEFVIN  215

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDG------KDQGVHAFIAQI  692
            TP E A K+WIG AA H     VF++LK+        KD GVHAFI  I
Sbjct  216  TPDEGATKWWIGNAAVHGKFATVFARLKLPSPDSHLDKDMGVHAFIVPI  264



>ref|WP_037233366.1| acyl-CoA oxidase [Rhodococcus wratislaviensis]
 dbj|GAF46127.1| putative acyl-CoA oxidase [Rhodococcus wratislaviensis NBRC 100605]
Length=648

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++   +  + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>ref|XP_005718655.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF38750.1| acyl-CoA oxidase [Chondrus crispus]
Length=642

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 96/167 (57%), Gaps = 0/167 (0%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            YN+ +  +R  T  RI  +   G+ +  ++        R   L+DV+AL DHSL ++ GV
Sbjct  52   YNETVAMERSRTTARIARVRQAGLLRDTVSRANEAGSRRYDVLIDVLALLDHSLEIRFGV  111

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGE  551
            +  L+   I+ LG++  +  WL   E+    GCFA+TELGHGSNVRGI+T   Y     +
Sbjct  112  NLGLFCATIRRLGSEEQYTHWLPRIEDGRDVGCFALTELGHGSNVRGIQTTARYLPDVQQ  171

Query  552  FVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            F I+TP + AQK+WIG AA  A   +VF+QL +D    G+H FI  +
Sbjct  172  FEIHTPHDLAQKFWIGAAAETANVAVVFAQLTVDAVHHGIHIFIVPL  218



>ref|WP_009474726.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|ABG93854.1| acyl-CoA oxidase [Rhodococcus jostii RHA1]
 gb|EJI99874.1| acyl-CoA oxidase domain protein [Rhodococcus sp. JVH1]
Length=648

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++   +  + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>ref|WP_028643473.1| acyl-CoA oxidase [Nocardioides sp. URHA0020]
Length=658

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  309  KLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTEL  488
             +A  + +A  D S+ VK+GV F L+GGAI  LGTKRHHD +L+D     + GCFAMTE 
Sbjct  95   SIAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTKRHHDAYLQDLVTGRLMGCFAMTET  154

Query  489  GHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQG  668
            GHGSNV+ + TV TYD  T EFVI T  ++A+K +IG AA HA   +VF+QL++ G+ +G
Sbjct  155  GHGSNVQALGTVATYDVATREFVITTHGDAARKDYIGNAAKHAEVAVVFAQLEVGGRSEG  214

Query  669  VHAFIAQI  692
            VHAF+  I
Sbjct  215  VHAFVVPI  222



>gb|AII09135.1| acyl-CoA oxidase [Rhodococcus opacus]
Length=648

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++   +  + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>gb|KJF23120.1| Acyl-CoA dehydrogenase, short-chain specific [Rhodococcus sp. 
AD45]
Length=643

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  +  N+   R  T+ ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  33   APHFTPNLAIARAKTLEQMRVLADLGYAANGFAVAHGGTGDAGGAVTSIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLELLGCFAMTETGHGSDVQELETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            + TGEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  153  AATGEFVIDSPTPSSRKDYIGGAAEHATVAAVFAQLITGGESQGVHCFVVPI  204



>ref|WP_005251993.1| acyl-CoA oxidase [Rhodococcus opacus]
 gb|EHI40654.1| acyl-CoA oxidase [Rhodococcus opacus PD630]
 gb|AHK33409.1| Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus opacus PD630]
Length=648

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++   +  + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVDLDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>ref|WP_023420722.1| MULTISPECIES: Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces]
 gb|ESP96104.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces sp. GBA 
94-10]
 gb|ESQ02024.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces sp. PVA 
94-07]
Length=653

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAYGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+++ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDAQSQEFVLTTPGEQARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_033235472.1| acyl-CoA oxidase [Rhodococcus rhodochrous]
Length=643

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  +  N+   R  T+ ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  33   APHFTPNLAIARSKTLEQMRVLADLGYAANGFAVAHGGTGDAGGAVTSIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLELLGCFAMTETGHGSDVQELETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            + TGEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  153  AATGEFVIDSPTPSSRKDYIGGAAEHATVAAVFAQLITGGESQGVHCFVVPI  204



>ref|WP_017576371.1| acyl-CoA oxidase [Nocardiopsis kunsanensis]
Length=659

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 120/221 (54%), Gaps = 21/221 (10%)
 Frame = +3

Query  45   EPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQ----NMEQ  212
            +P  +D  E+R L+DG       W Y           RER   V    D+      ++++
Sbjct  4    QPLRVDEAELRGLLDGQ------WAY----------VRERARDVLQGEDFAPVTGLSLQE  47

Query  213  QRGMTMRRIGHLLDCGVFK-GWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWG  389
             R +T  R+G L   G+   G+  E G   ++    +   + + D SL VK+GV + L+G
Sbjct  48   HRALTTERLGKLATTGMQTYGFPEEVGGSGDVGASVVAFEMLVPDLSLMVKMGVQWGLFG  107

Query  390  GAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTP  569
            GAI  LGT+RHH E+L    +  + GCFAMTE GHGS+V+ + T  TYD +T EFV++TP
Sbjct  108  GAISALGTERHHREYLPGVMSLDLPGCFAMTETGHGSDVQSLRTTATYDPKTEEFVLHTP  167

Query  570  CESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             ESA+K +IG AA      +VF+QL   G D GVHA +  I
Sbjct  168  DESARKDYIGNAARDGRMAVVFAQLHSAGIDHGVHALMVPI  208



>ref|WP_006797234.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
 gb|EAS19960.1| acyl-CoA oxidase [Flavobacteria bacterium BBFL7]
Length=768

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +3

Query  288  GPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKG  467
            G +S ++  A+ + +A +D SL++K GVHF L+GG+++ LGT  HHD++L+D  N  + G
Sbjct  221  GSDSMVQYAAVFEELAKYDLSLTIKFGVHFGLFGGSVESLGTTYHHDKYLKDIGNMTLPG  280

Query  468  CFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLK  647
            CFAMTE+ HGSNV+ ++T   Y   +  F+I+TP +  +K +IG AA HA    VF+QL 
Sbjct  281  CFAMTEMHHGSNVKALQTTAIYQPDSNSFIIHTPSQHDRKTYIGNAAMHAQMATVFAQLI  340

Query  648  IDGKDQGVHAFIAQI  692
            +DG++ G+HAF+  I
Sbjct  341  VDGEEHGIHAFLVPI  355



>gb|EME62368.1| acyl-CoA oxidase [Rhodococcus ruber BKS 20-38]
Length=634

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLAL--LDVIALFDHSLS  356
            A  Y  ++++ R +T++++  L + G  +    +          A+  ++++A+ D SL 
Sbjct  24   APHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLM  83

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT RHHD ++    +  + GCFAMTE GHGS+V+ +ET  +YD
Sbjct  84   VKAGVQWGLFGGAIENLGTARHHDRYINPLIDLDLLGCFAMTETGHGSDVQSLETTASYD  143

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFVI++P  S++K +IGGAA HAT   VF+QL   GK QGVH F+  I
Sbjct  144  PGTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFVVPI  195



>ref|WP_020172265.1| acyl-CoA oxidase [Gordonia polyisoprenivorans]
Length=684

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 121/214 (57%), Gaps = 19/214 (9%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            +R+ +DG     RD +            RER  +  +  D ++ +++ R   +  +  L 
Sbjct  50   LRRTLDGRWRATRDSV------------RERANRSDLLPDPSRTLDEARARVLEEMRELS  97

Query  252  DCG-VFKGWLTENGPESEL-RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHH  425
              G    G+ +++G   ++   +  ++++   D SL VK GV + L+GGA++ LGTKRHH
Sbjct  98   SQGFAAAGFASDHGGTGDVGASITAIEMLGYADLSLMVKAGVQWGLFGGAVENLGTKRHH  157

Query  426  DEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGA  605
            D+++ D  +  + GCFAMTE GHGSNV+ +ET  TYD +T EFVI++P  SA+K +IGGA
Sbjct  158  DKYVSDIISLDLLGCFAMTETGHGSNVQALETTATYDPQTQEFVIDSPTPSARKDYIGGA  217

Query  606  ANHATHTIVFSQLKIDGKDQ-----GVHAFIAQI  692
            A HA    VF+QL   G  Q     GVH F+  I
Sbjct  218  AQHARVAAVFAQLITAGPGQEPESHGVHCFVVPI  251



>ref|WP_033948443.1| acyl-CoA oxidase [Streptomyces sp. CNQ431]
Length=653

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAYGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+++ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDAQSQEFVLTTPGEQARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|XP_001754596.1| predicted protein [Physcomitrella patens]
 gb|EDQ80566.1| predicted protein [Physcomitrella patens]
Length=682

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 85/139 (61%), Gaps = 6/139 (4%)
 Frame = +3

Query  294  ESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCF  473
            E   R   + + I   D SL VKLGV F LWGG++  LGT++H D++L    N    GCF
Sbjct  114  EDPARYFTITEAIGFIDVSLGVKLGVQFSLWGGSVVNLGTQKHRDKYLEGISNLKFPGCF  173

Query  474  AMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKID  653
            AMTEL HGSNV+GI+T  T+D  T EFVINTP + A K+WIG AA H     VF++LK+ 
Sbjct  174  AMTELHHGSNVQGIQTTATFDRMTDEFVINTPNDGATKWWIGNAAVHGKFASVFARLKLP  233

Query  654  ------GKDQGVHAFIAQI  692
                    D GVHAFI  I
Sbjct  234  CPDSHLDTDMGVHAFIVPI  252



>ref|XP_005846795.1| hypothetical protein CHLNCDRAFT_135324 [Chlorella variabilis]
 gb|EFN54693.1| hypothetical protein CHLNCDRAFT_135324 [Chlorella variabilis]
Length=479

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 118/208 (57%), Gaps = 15/208 (7%)
 Frame = +3

Query  69   EMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHL  248
            E+++L++  + ++R  +  +M +S LF PR           Y   + ++R + ++R+  L
Sbjct  52   ELQRLLEHDSFEERRRMKELM-KSELFIPR-----------YAVPLAEERELALQRLRVL  99

Query  249  LDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHD  428
               G F+    E+     +R  A  +  A  D S++ K+ V F L+GG I  LGT+RHHD
Sbjct  100  CHSGNFR---IEDFRVDPMRIFAAHECAAFADPSMATKMTVQFNLFGGTILKLGTQRHHD  156

Query  429  EWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAA  608
              LR   +    GCFA+TELG+G+N   +ET  T+D+ T EF+I+TP   AQKYWI  +A
Sbjct  157  LLLRGITSLDDIGCFALTELGYGNNAVEMETTATFDAATDEFIIHTPTPLAQKYWITNSA  216

Query  609  NHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             HA   +VF+QL I G + G+H F+  I
Sbjct  217  IHAHWAVVFAQLLIGGTNHGIHGFLVPI  244



>ref|WP_040783005.1| acyl-CoA oxidase [Rhodococcus ruber]
Length=643

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLAL--LDVIALFDHSLS  356
            A  Y  ++++ R +T++++  L + G  +    +          A+  ++++A+ D SL 
Sbjct  33   APHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT RHHD ++    +  + GCFAMTE GHGS+V+ +ET  +YD
Sbjct  93   VKAGVQWGLFGGAIENLGTARHHDRYINPLIDLDLLGCFAMTETGHGSDVQSLETTASYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFVI++P  S++K +IGGAA HAT   VF+QL   GK QGVH F+  I
Sbjct  153  PGTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFVVPI  204



>ref|WP_030332097.1| acyl-CoA oxidase [Streptomyces sp. NRRL B-1381]
Length=655

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +AL D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLALGDLSVLVKVGVQFGLFGGAILHLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+   EFVI T  + A+K +IG AA H    +VF+QL+IDGK +GV
Sbjct  155  HGSNVQALGTVARYDAAAQEFVITTEGDQARKDYIGNAARHGELAVVFAQLEIDGKSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_030697375.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+++ EFV+ TP E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQKLGTVARYDAQSQEFVLTTPDEQARKDYIGNAARHGEVAVVFAQLEVDGASEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_028638761.1| acyl-CoA oxidase [Nocardioides sp. URHA0032]
Length=653

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 127/240 (53%), Gaps = 34/240 (14%)
 Frame = +3

Query  3    SASPCLSYTPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFV  182
            +A P   Y  PEV      DV  +  L+DG   + RD     +++++L            
Sbjct  6    AAPPTTGYVQPEV------DVPALTALLDGRYAEVRD-----LVRANL------------  42

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFK---------GWLTENGPESEL-RKLALLDVI  332
             A Y   +EQ   +++      +   V +         G+  E G   ++   +A  + +
Sbjct  43   -ATYADILEQAEELSVDDFRERVREVVVEMAATGQTGMGFPEEYGGGGDIGASIAAFETL  101

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A  D S+ VK+GV F L+GGAI  LG+K HHD +L D  +  V GCFAMTE GHGSNV+ 
Sbjct  102  AYGDLSVLVKVGVQFGLFGGAILQLGSKHHHDAYLADLVSGKVMGCFAMTETGHGSNVQA  161

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            + TV TYD+   EFVI T  ESA+K +IG AA HA   +VF+QL++ G  +GVHAF+  I
Sbjct  162  LGTVATYDADAQEFVITTTTESARKDYIGNAAKHAELAVVFAQLEVGGTSEGVHAFVVPI  221



>ref|WP_026126958.1| acyl-CoA oxidase [Nocardiopsis xinjiangensis]
Length=658

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 121/221 (55%), Gaps = 21/221 (10%)
 Frame = +3

Query  45   EPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQ----NMEQ  212
            +P  +D  E+R L+DG       W       +H+   RER   V    D+      +ME 
Sbjct  4    QPLRVDDDELRGLLDGQ------W-------AHV---RERARDVLQGEDFAPVTGLSMED  47

Query  213  QRGMTMRRIGHLLDCGVFK-GWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWG  389
             R +T  R+G L   G+   G+  E G   ++    +   + + D SL VK+GV + L+G
Sbjct  48   HRALTTERLGKLAQTGMQTYGFPEEVGGSGDVGASVVAFEMLVPDLSLMVKMGVQWGLFG  107

Query  390  GAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTP  569
            GAI  LGT+RHH E+L    +  + GCFAMTE GHGS+V+ + T  TYD +T EFV++TP
Sbjct  108  GAISALGTERHHREYLPGVMSLDLPGCFAMTETGHGSDVQNLRTTATYDPKTEEFVVHTP  167

Query  570  CESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             ESA+K +IG AA      +VF+QL   G D GVHA +  I
Sbjct  168  DESARKDYIGNAARDGRAAVVFAQLHSAGIDHGVHALMVPI  208



>ref|WP_005258360.1| acyl-CoA oxidase [Rhodococcus opacus]
 gb|EKT81370.1| acyl-CoA oxidase [Rhodococcus opacus M213]
Length=648

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++      + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVALDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>ref|WP_006552333.1| acyl-CoA oxidase [Rhodococcus pyridinivorans]
 gb|EHK83492.1| acyl-CoA oxidase [Rhodococcus pyridinivorans AK37]
Length=648

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = +3

Query  156  RERGGKVFV----AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLA  317
            RER  K       A  Y    ++ R +T+ ++  L + G    G+  E+G   +    +A
Sbjct  20   RERARKDLAHEKFAPHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVA  79

Query  318  LLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHG  497
             ++++A+ D SL VK GV + L+GGAI+ LGT+RHH+++++   +  V GCFAMTE GHG
Sbjct  80   SIEMLAMSDLSLMVKAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHG  139

Query  498  SNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHA  677
            S+V+ +ET  TYD  T EFVI++P  S++K +IGGAA HA    VF+QL   G+  GVH 
Sbjct  140  SDVQSLETTATYDPDTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHC  199

Query  678  FIAQI  692
            F+  I
Sbjct  200  FVVPI  204



>ref|WP_005566484.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|EID73630.1| acyl-CoA oxidase [Rhodococcus imtechensis RKJ300 = JCM 13270]
 gb|ELB91355.1| acyl-CoA oxidase [Rhodococcus wratislaviensis IFP 2016]
Length=648

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +3

Query  159  ERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVI  332
            E  G    A  Y  ++++ R  T+ ++  L   G    G+  ++G   +    +  ++++
Sbjct  26   ELSGSPDFAPHYTPDLDEARAKTLAQLRLLASNGYAADGFAKDHGGTGDAGAAVTSIEML  85

Query  333  ALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRG  512
            A+ D SL VK GV + L+GGAI+ LGT RHH+ +++      + GCFAMTE GHGS+V+ 
Sbjct  86   AMSDLSLMVKAGVQWGLFGGAIENLGTARHHEAYVKRLVALDLLGCFAMTETGHGSDVQA  145

Query  513  IETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            +ET  TYD+  GEFVI++P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  146  LETTATYDADAGEFVIHSPTPSSRKDYIGGAAQHATMAAVFAQLITGGESQGVHCFVVPI  205



>ref|WP_024101715.1| acyl-CoA oxidase [Rhodococcus pyridinivorans]
 gb|AHD20855.1| acyl-CoA oxidase [Rhodococcus pyridinivorans SB3094]
Length=648

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = +3

Query  156  RERGGKVFV----AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLA  317
            RER  K       A  Y    ++ R +T+ ++  L + G    G+  E+G   +    +A
Sbjct  20   RERARKDLAHEKFAPHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVA  79

Query  318  LLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHG  497
             ++++A+ D SL VK GV + L+GGAI+ LGT+RHH+++++   +  V GCFAMTE GHG
Sbjct  80   SIEMLAMSDLSLMVKAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHG  139

Query  498  SNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHA  677
            S+V+ +ET  TYD  T EFVI++P  S++K +IGGAA HA    VF+QL   G+  GVH 
Sbjct  140  SDVQSLETTATYDPDTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHC  199

Query  678  FIAQI  692
            F+  I
Sbjct  200  FVVPI  204



>ref|WP_019291205.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|KHJ72238.1| acyl-CoA oxidase [Rhodococcus sp. Chr-9]
Length=648

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 6/185 (3%)
 Frame = +3

Query  156  RERGGKVFV----AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLA  317
            RER  K       A  Y    ++ R +T+ ++  L + G    G+  E+G   +    +A
Sbjct  20   RERARKDLAHEKFAPHYTPETDKARAITLEQMRILAEHGYAAAGFSVESGGTGDAGGAVA  79

Query  318  LLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHG  497
             ++++A+ D SL VK GV + L+GGAI+ LGT+RHH+++++   +  V GCFAMTE GHG
Sbjct  80   SIEMLAMSDLSLMVKAGVQWGLFGGAIENLGTERHHEKYVKQLIDLDVLGCFAMTETGHG  139

Query  498  SNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHA  677
            S+V+ +ET  TYD  T EFVI++P  S++K +IGGAA HA    VF+QL   G+  GVH 
Sbjct  140  SDVQSLETTATYDPDTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHC  199

Query  678  FIAQI  692
            F+  I
Sbjct  200  FVVPI  204



>dbj|BAH32371.1| putative acyl-CoA oxidase [Rhodococcus erythropolis PR4]
Length=662

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  52   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  111

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  112  VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  171

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  172  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  223



>ref|XP_002123442.2| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Ciona intestinalis]
Length=663

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 113/212 (53%), Gaps = 15/212 (7%)
 Frame = +3

Query  57   LDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRR  236
             D  +M KL+D  N + R      M    +  PR           Y+  + ++R + ++R
Sbjct  63   FDPSKMTKLLDHDNHEMRKKFREFM-SDPVMTPR-----------YDIPLAEEREVALQR  110

Query  237  IGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTK  416
            +  + D            P   LR  A  ++ A+ D +++ K+ V F L+GG++  LGTK
Sbjct  111  LQRICDAKFISVTDFWTNP---LRIFAAHEISAIIDPAMATKMTVQFNLFGGSVVKLGTK  167

Query  417  RHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWI  596
            RHHD+ ++  +     GCF +TELG+G+N   +ET   YD  + EF+INTP   AQKYWI
Sbjct  168  RHHDQLIKGIDTLDDVGCFGLTELGYGNNAVEMETTAVYDKESKEFIINTPTTLAQKYWI  227

Query  597  GGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
               A HA H IVF+QL IDG ++G+H  + +I
Sbjct  228  TNGAVHAKHIIVFAQLLIDGDNKGIHGILVRI  259



>ref|WP_041815718.1| acyl-CoA oxidase [Rhodococcus erythropolis]
Length=643

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  33   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  153  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  204



>ref|WP_042377454.1| acyl-CoA oxidase [Gordonia alkanivorans]
Length=683

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 126/229 (55%), Gaps = 12/229 (5%)
 Frame = +3

Query  27   TPPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNM  206
            TPP VS    L   E   L+D  NL  R  L G    +  F  RE   +  +  D ++ +
Sbjct  27   TPPGVSADDDLSADERALLVD--NL--RFALDGRWRATREF-VRENSNRADLLPDPSRTL  81

Query  207  EQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVIALFDHSLSVKLGVHFI  380
            E+ R  T+  +  L   G    G+  ++G   ++   +  ++++   D SL VK GV + 
Sbjct  82   EEARTHTLEVMRELASQGFASAGFAADHGGTGDIGSSITAIEMLGYADLSLMVKAGVQWG  141

Query  381  LWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVI  560
            L+GGA++ LGTKRHHD+++    N  + GCFAMTE GHGSNV+ IET  TYD    EFVI
Sbjct  142  LFGGAVENLGTKRHHDKYVPGIINLDILGCFAMTETGHGSNVQAIETTATYDRDAREFVI  201

Query  561  NTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVHAFIAQI  692
            ++P  S++K +IGGAA HA    VF+QL   G D+     GVH F+  I
Sbjct  202  HSPTPSSRKDYIGGAAEHARFAAVFAQLITGGPDEEPEGRGVHCFVVPI  250



>ref|WP_005169429.1| putative acyl-CoA oxidase [Gordonia aichiensis]
 dbj|GAC46989.1| putative acyl-CoA oxidase [Gordonia aichiensis NBRC 108223]
Length=685

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 127/242 (52%), Gaps = 26/242 (11%)
 Frame = +3

Query  9    SPCLSYTPPEVSEPGGLD-------VWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERG  167
            +P     P    + G L        V  +R ++DG     RD            + R R 
Sbjct  15   APVDETRPASADDAGALSDDERELLVDNLRYVLDGRWRATRD------------DVRRRA  62

Query  168  GKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVIALF  341
             +  +  D ++ +EQ R   +  +  L + G    G+  ++G   ++   +  ++++   
Sbjct  63   NRADLLPDPSRTLEQARARVLDEMRELSEEGFAAAGFGADHGGTGDVGASITAIEMLGYA  122

Query  342  DHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIET  521
            D SL VK GV + LWGGA++ LGT RHH++++ DT +  + GCFAMTE GHGSNV+ +ET
Sbjct  123  DLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNVQELET  182

Query  522  VTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVHAFIA  686
              TYD+ T EFVI++P  SA+K +IGGAA HA    VF+QL   G  Q     GVH F+ 
Sbjct  183  TATYDAATKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGVHCFVV  242

Query  687  QI  692
             I
Sbjct  243  PI  244



>ref|WP_024487810.1| MULTISPECIES: acyl-CoA oxidase [Rhodococcus]
 gb|KDQ01145.1| acyl-CoA oxidase [Rhodococcus qingshengii]
Length=643

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  33   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  153  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  204



>ref|WP_037129939.1| acyl-CoA oxidase [Rhodococcus erythropolis]
Length=643

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  33   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  153  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  204



>gb|EEN88202.1| acyl-CoA dehydrogenase, middle domain protein [Rhodococcus erythropolis 
SK121]
Length=660

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  50   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  109

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  110  VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  169

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  170  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  221



>ref|WP_008735487.1| acyl-CoA oxidase [Streptomyces sp. Mg1]
 gb|EDX20833.1| acyl-CoA oxidase domain containing protein [Streptomyces sp. 
Mg1]
Length=653

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  309  KLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTEL  488
             +A  + +A  D S+ VK+GV F L+GGAI  LGT RHH  +L D     + GCFAMTE 
Sbjct  94   SIAAFETLAFGDLSVLVKVGVQFGLFGGAILHLGTGRHHAAYLPDLITGELMGCFAMTET  153

Query  489  GHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQG  668
            GHGSNV+ + TV  YD+ + EFVI TP + A+K +IG AA HA   +VF+QL++DG+ QG
Sbjct  154  GHGSNVQALGTVARYDTASREFVITTPGDHARKDYIGNAARHAELAVVFAQLEVDGRSQG  213

Query  669  VHAFIAQI  692
            VHAF+  I
Sbjct  214  VHAFVVPI  221



>ref|WP_014359023.1| acyl-CoA oxidase [Gordonia polyisoprenivorans]
 gb|AFA72118.1| acyl-CoA oxidase [Gordonia polyisoprenivorans VH2]
Length=684

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 119/214 (56%), Gaps = 19/214 (9%)
 Frame = +3

Query  72   MRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLL  251
            +R+ +DG     RD +            RER  +  +  D +  +++ R   +  +  L 
Sbjct  50   LRRTLDGRWRATRDGV------------RERANRSDLLPDPSHTLDEARARVLEEMRELS  97

Query  252  DCG-VFKGWLTENGPESEL-RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHH  425
              G    G+ +++G   ++   +  ++++   D SL VK GV + L+GGA++ LGTKRHH
Sbjct  98   SQGFAAAGFASDHGGTGDVGASITAIEMLGYADLSLMVKAGVQWGLFGGAVENLGTKRHH  157

Query  426  DEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGA  605
            D ++ D  +  + GCFAMTE GHGSNV+ +ET  TYD +T EFVI++P  SA+K +IGGA
Sbjct  158  DRYVSDIISLDLLGCFAMTETGHGSNVQALETTATYDPQTQEFVIDSPTPSARKDYIGGA  217

Query  606  ANHATHTIVFSQLKIDGKDQ-----GVHAFIAQI  692
            A HA    VF+QL   G  Q     GVH F+  I
Sbjct  218  AQHARVAAVFAQLITAGPGQEPESHGVHCFVVPI  251



>gb|AGT91460.1| acyl-CoA oxidase [Rhodococcus erythropolis CCM2595]
 gb|EQM31223.1| acyl-CoA oxidase [Rhodococcus erythropolis DN1]
Length=662

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  52   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  111

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  112  VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  171

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  172  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  223



>gb|EME15692.1| acyl-CoA oxidase [Rhodococcus qingshengii BKS 20-40]
 gb|ERB54143.1| acyl-CoA oxidase [Rhodococcus sp. P27]
Length=660

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESELR-KLALLDVIALFDHSLS  356
            A  Y  N    R   + ++  L D G    G+   +G   +    +  ++++A+ D SL 
Sbjct  50   APHYTPNTAIARSKALEQMRVLADLGYAANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLM  109

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH  +++   +  + GCFAMTE GHGS+V+ +ET  TYD
Sbjct  110  VKAGVQWGLFGGAIENLGTERHHQAYVKPLIDLDLLGCFAMTETGHGSDVQELETTATYD  169

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              TGEFV+N+P  S++K +IGGAA HAT   VF+QL   G+ QGVH F+  I
Sbjct  170  VETGEFVVNSPTPSSRKDYIGGAAQHATVAAVFAQLITGGESQGVHCFVVPI  221



>ref|XP_503244.1| YALI0D24750p [Yarrowia lipolytica]
 sp|O74936.1|ACOX3_YARLI RecName: Full=Acyl-coenzyme A oxidase 3; Short=Acyl-CoA oxidase 
3 [Yarrowia lipolytica CLIB122]
 emb|CAA04661.1| Acyl-CoA oxidase 3 [Yarrowia lipolytica]
 emb|CAG81448.1| YALI0D24750p [Yarrowia lipolytica CLIB122]
Length=700

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 105/191 (55%), Gaps = 11/191 (6%)
 Frame = +3

Query  126  IMIQSHLFNPRERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESEL  305
            + +   L    ER   + V+ DY+   EQ R   + RI  L        W  +   E+ L
Sbjct  52   VTMIERLMTELERDPVLNVSGDYDMPKEQLRETAVARIAALSG-----HWKKDTEKEALL  106

Query  306  RKLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRD--TENYAVKGCFAM  479
            R      +  + D    ++LGVH  L+ GAI+  GTK  +D W+R    +     GCFAM
Sbjct  107  RS----QLHGIVDMGTRIRLGVHTGLFMGAIRGSGTKEQYDYWVRKGAADVKGFYGCFAM  162

Query  480  TELGHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGK  659
            TELGHGSNV G+ET  TY   T EF+INTP   A K+WIGGAA+ ATHT  F++L +DGK
Sbjct  163  TELGHGSNVAGLETTATYIQDTDEFIINTPNTGATKWWIGGAAHSATHTACFARLLVDGK  222

Query  660  DQGVHAFIAQI  692
            D GV  F+ Q+
Sbjct  223  DYGVKIFVVQL  233



>ref|XP_010269210.1| PREDICTED: acyl-coenzyme A oxidase 2, peroxisomal [Nelumbo nucifera]
Length=688

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 104/171 (61%), Gaps = 14/171 (8%)
 Frame = +3

Query  207  EQQRGMTMRRIGHLL-DCGV--FKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHF  377
            ++ R + MR++  L+ + G+  FK  L + G     +  A+ + +   D SL +K+GV +
Sbjct  93   DEHRDLCMRQLLALVREAGIRPFKYVLEDPG-----KYFAIAEAVGSVDMSLGIKMGVQY  147

Query  378  ILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFV  557
             LWGG++  LGTK+H D++    +N    GCFAMTEL HGSNV+GI+TV T+D  T EF+
Sbjct  148  SLWGGSVLNLGTKKHRDKYYDGIDNLEYPGCFAMTELHHGSNVQGIQTVATFDPSTDEFI  207

Query  558  INTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ------GVHAFIAQI  692
            INTP + A K+WIG AA H     VF++L +  KD       GVHAFI  I
Sbjct  208  INTPNDGAIKWWIGNAAVHGKFATVFAKLMLPCKDNEGVSDMGVHAFIVPI  258



>dbj|GAB38637.1| putative acyl-CoA oxidase [Gordonia sputi NBRC 100414]
Length=724

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 7/186 (4%)
 Frame = +3

Query  156  RERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDV  329
            R R  +  +  D ++ +EQ R   +  +  L + G    G+  ++G   ++   +  +++
Sbjct  98   RRRANRADLLPDPSRTLEQARARILDEMRELSEEGFAAAGFGADHGGTGDVGASITAIEM  157

Query  330  IALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVR  509
            +   D SL VK GV + LWGGA++ LGT RHH++++ DT +  + GCFAMTE GHGSNV+
Sbjct  158  LGYADLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNVQ  217

Query  510  GIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVH  674
             +ET  TYD+ T EFVI++P  SA+K +IGGAA HA    VF+QL   G  Q     GVH
Sbjct  218  ELETTATYDATTKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGVH  277

Query  675  AFIAQI  692
             F+  I
Sbjct  278  CFVVPI  283



>ref|WP_016932641.1| acyl-CoA oxidase [Rhodococcus sp. R1101]
Length=648

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDVIALFDHSLS  356
            A  Y    ++ R + + ++  L + G    G+  E+G   +    +A ++++A+ D SL 
Sbjct  33   APHYTPETDKARAIALEQMRLLAEHGYAAAGFSVESGGTGDAGSAVASIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT+RHH++++R   +  V GCFAMTE GHGS+V+ +ET  TYD
Sbjct  93   VKAGVQWGLFGGAIENLGTERHHEKYVRRLIDLDVLGCFAMTETGHGSDVQSLETTATYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFVI++P  S++K +IGGAA HA    VF+QL   G+  GVH F+  I
Sbjct  153  PDTQEFVIHSPTPSSRKDYIGGAAQHARFAAVFAQLVTQGETHGVHCFVVPI  204



>ref|WP_039855121.1| acyl-CoA oxidase [Gordonia sputi]
Length=683

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 7/186 (4%)
 Frame = +3

Query  156  RERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDV  329
            R R  +  +  D ++ +EQ R   +  +  L + G    G+  ++G   ++   +  +++
Sbjct  57   RRRANRADLLPDPSRTLEQARARILDEMRELSEEGFAAAGFGADHGGTGDVGASITAIEM  116

Query  330  IALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVR  509
            +   D SL VK GV + LWGGA++ LGT RHH++++ DT +  + GCFAMTE GHGSNV+
Sbjct  117  LGYADLSLMVKAGVQWGLWGGAVENLGTARHHEKYVADTISLDLLGCFAMTETGHGSNVQ  176

Query  510  GIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVH  674
             +ET  TYD+ T EFVI++P  SA+K +IGGAA HA    VF+QL   G  Q     GVH
Sbjct  177  ELETTATYDATTKEFVIHSPTPSARKDYIGGAAEHARMASVFAQLITAGPGQEPESYGVH  236

Query  675  AFIAQI  692
             F+  I
Sbjct  237  CFVVPI  242



>ref|XP_004813510.1| PREDICTED: acyl-coenzyme A oxidase-like protein isoform X5 [Mustela 
putorius furo]
Length=544

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 124/222 (56%), Gaps = 15/222 (7%)
 Frame = +3

Query  36   EVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQ  215
            E + P G+    + + +DG     +  L+ ++    LF  R           Y+ N+++ 
Sbjct  2    EPASPSGIGDTSLNRYLDGEFWSLKKELHRVLGGCPLFRHR-----------YDLNLDEI  50

Query  216  RGMTMRRIGHLLDCGVFKGWLTENGPESE---LRKLALLDVIALFDHSLSVKLGVHFILW  386
            R +T +R+  ++   V K  + +   +++    R L + +V+++ D +  VK G+ + L+
Sbjct  51   RALTFQRVKFVMGLPVLKRAIQDQAEKTKNFVSRSLVIGEVLSIADMATGVKCGIIYWLF  110

Query  387  GGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINT  566
            GGA++ LG+  H  +WL+  +     G FAMTE GHGSNVRGI+T  T+D    EFVI+T
Sbjct  111  GGAVRNLGSPGHVTKWLQPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDLSAQEFVIDT  170

Query  567  PCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            PCE+A+K +IG A  +  +  VF+QL I+G+ QG H FI  +
Sbjct  171  PCENAEKMYIGNAM-YGNYAAVFAQLIINGRSQGPHCFIVPV  211



>ref|WP_006935934.1| MULTISPECIES: Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus]
 emb|CCW11442.1| Acyl-coenzyme A oxidase 3, peroxisomal [Rhodococcus sp. EsD8]
 gb|ETT23206.1| Acyl-CoA oxidase [Rhodococcus rhodochrous ATCC 21198]
 gb|KDE11924.1| acyl-CoA oxidase [Rhodococcus sp. BCP1]
Length=645

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLAL--LDVIALFDHSLS  356
            A  Y  +++  R +T++++  L + G  +   ++          A+  ++++A+ D SL 
Sbjct  33   APHYTPDLDAARAITLKQMRMLAESGYARAGFSKAVGGGGDAGGAVASIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT RHH+ +L    +  + GCFAMTE GHGS+V+ +ET  +YD
Sbjct  93   VKAGVQWGLFGGAIENLGTTRHHERYLGPLIDLDLLGCFAMTETGHGSDVQSLETTASYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFVI++P  S++K +IGGAA HAT   VF+QL   GK QGVH F+  I
Sbjct  153  PGTEEFVIHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFVVPI  204



>ref|WP_030768335.1| acyl-CoA oxidase [Streptomyces griseus]
Length=653

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  312  LALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELG  491
            +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE G
Sbjct  95   IAAFETLAFGDLSVLVKVGVQFGLFGGAILQLGTERHHDAYLPDLITGKLMGCFAMTETG  154

Query  492  HGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGV  671
            HGSNV+ + TV  YD+R+ EFV+ T  E A+K +IG AA H    +VF+QL++DG  +GV
Sbjct  155  HGSNVQALGTVARYDARSQEFVLTTLGEEARKDYIGNAARHGEVAVVFAQLEVDGTSEGV  214

Query  672  HAFIAQI  692
            HAF+  I
Sbjct  215  HAFVVPI  221



>ref|WP_017680041.1| acyl-CoA oxidase [Rhodococcus ruber]
 emb|CDZ88808.1| putative acyl-CoA oxidase [Rhodococcus ruber]
Length=645

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLAL--LDVIALFDHSLS  356
            A  Y  ++++ R +T++++  L + G  +    +          A+  ++++A+ D SL 
Sbjct  33   APHYTPDLDEARAITLKQMRMLAESGYARAGFAKAVGGGGDAGGAVASIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT RHHD ++    +  + GCFAMTE GHGS+V+ +ET  +YD
Sbjct  93   VKAGVQWGLFGGAIENLGTARHHDRYIGPLIDLDLLGCFAMTETGHGSDVQSLETTASYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFV+++P  S++K +IGGAA HAT   VF+QL   GK QGVH F+  I
Sbjct  153  PGTEEFVVHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFVVPI  204



>ref|XP_008053271.1| PREDICTED: acyl-coenzyme A oxidase-like protein [Tarsius syrichta]
Length=722

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 102/170 (60%), Gaps = 4/170 (2%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESEL---RKLALLDVIALFDHSLSVK  362
            Y+ ++++ R +T+ R+  +L   + K  + E   ++     R L + +VIA  D + +VK
Sbjct  43   YDLSLDETRALTVERVKFILGLPLVKRAIQEQAEKTRNFLGRSLIIGEVIAFVDMATAVK  102

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
             G+ + L+GGAI+ LG+ RH  +W    +     G FAMTE GHGSNVRGI+T  T+D  
Sbjct  103  CGIIYWLFGGAIRNLGSPRHVTKWFLPLQEQKYTGMFAMTERGHGSNVRGIQTEATFDLS  162

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              EFVINTPCE A+K +IG A  H  +  VF+QL ++G  QG H FI  I
Sbjct  163  AQEFVINTPCEDAEKMYIGNAM-HGNYATVFAQLILNGTSQGPHCFIVPI  211



>ref|WP_014773637.1| acyl-CoA oxidase [Belliella baltica]
 gb|AFL85697.1| acyl-CoA dehydrogenase [Belliella baltica DSM 15883]
Length=763

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 99/163 (61%), Gaps = 4/163 (2%)
 Frame = +3

Query  213  QRGMTMRRIGHLLDCGVFKGWL---TENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            QR   ++   +L D G F  W    + NG +       +++ ++  D S+ +K GV F L
Sbjct  188  QREQVLQWCKNLADQG-FGAWAFPKSANGKDDMEGYFTIMETLSYHDLSMVIKFGVQFGL  246

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            WG ++ FLGT +HH ++L+D  +  + GCFAMTE GHGSNVRG+ET  TYD  +  F I+
Sbjct  247  WGMSVFFLGTDKHHQKYLKDIGSLKLPGCFAMTETGHGSNVRGLETTATYDHNSKTFTIH  306

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP   A+K +IG AA H     VF++L IDG+D GV+AFI  +
Sbjct  307  TPNPEARKEYIGNAAMHGQMATVFAKLIIDGEDYGVNAFIVPL  349



>ref|WP_017614281.1| acyl-CoA oxidase [Nocardiopsis salina]
Length=658

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 120/223 (54%), Gaps = 21/223 (9%)
 Frame = +3

Query  39   VSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQ----NM  206
              +P   D  E+R L+DG       W       +H+   RER   +    D+      +M
Sbjct  2    TEQPLRADDSELRGLLDGR------W-------AHV---RERARDLLQGEDFAPVNGLSM  45

Query  207  EQQRGMTMRRIGHLLDCGVFK-GWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFIL  383
            E  R +T  R+  L + G+   G+  E G   ++    +   + + D SL VK+GV + L
Sbjct  46   EDHRALTTERLAKLAETGMQTYGFPEEVGGSGDVGASVVAFEMLVTDLSLMVKMGVQWGL  105

Query  384  WGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVIN  563
            +GGAI  LGT+RHH E+L    +  + GCFAMTE GHGS+V+ + T  TYD +T EFV++
Sbjct  106  FGGAINALGTERHHHEYLPGAMSLDIPGCFAMTETGHGSDVQSLRTTATYDPKTEEFVVH  165

Query  564  TPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
            TP ESA+K +IG AA      +VF+QL   G D GVHA +  I
Sbjct  166  TPDESARKDYIGNAARDGRMAVVFAQLHSAGIDHGVHALMVPI  208



>ref|XP_002953234.1| hypothetical protein VOLCADRAFT_93964 [Volvox carteri f. nagariensis]
 gb|EFJ45833.1| hypothetical protein VOLCADRAFT_93964 [Volvox carteri f. nagariensis]
Length=689

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 116/221 (52%), Gaps = 16/221 (7%)
 Frame = +3

Query  30   PPEVSEPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNME  209
            PP  S     DV E+++++D  N + R  +   M    L+ P+           Y+ ++ 
Sbjct  20   PPSASR-YPFDVKELQRILDHDNHEHRQAMKEFM-NDDLYVPQ-----------YDISLR  66

Query  210  QQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGVHFILWG  389
             +R + ++R+  +   G          P    R  A  +V AL D S+  K+ V F L+G
Sbjct  67   DERELALQRLKRVCRAGFISVTDFRTNP---FRIFAAHEVAALCDPSMGTKMTVQFNLFG  123

Query  390  GAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTP  569
            G +  LGT+RHH  +LRD +     GCFA+TELG G+N   ++T   YD  T EFVI+TP
Sbjct  124  GTVLKLGTERHHGAFLRDIDQLDAVGCFALTELGFGNNAVEMQTTAEYDKDTQEFVIHTP  183

Query  570  CESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
               AQKYWI  +A HA   +VF+QL +  + +G+H F+ +I
Sbjct  184  GSLAQKYWITNSAVHAQWAVVFAQLTVAARQEGIHGFLVRI  224



>ref|WP_010592066.1| acyl-CoA oxidase [Rhodococcus sp. P14]
Length=645

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  AADYNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLAL--LDVIALFDHSLS  356
            A  Y  ++++ R +T++++  L + G  +    +          A+  ++++A+ D SL 
Sbjct  33   APHYTPDLDEARAITLKQMRMLAESGYARSGFAKAVGGGGDAGGAVASIEMLAMSDLSLM  92

Query  357  VKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYD  536
            VK GV + L+GGAI+ LGT RHHD ++    +  + GCFAMTE GHGS+V+ +ET  +YD
Sbjct  93   VKAGVQWGLFGGAIENLGTARHHDRYIGPLIDLDLLGCFAMTETGHGSDVQSLETTASYD  152

Query  537  SRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              T EFV+++P  S++K +IGGAA HAT   VF+QL   GK QGVH F+  I
Sbjct  153  PGTEEFVVHSPTPSSRKDYIGGAAQHATVAAVFAQLITGGKSQGVHCFVVPI  204



>ref|XP_505264.1| YALI0F10857p [Yarrowia lipolytica]
 sp|O74935.1|ACOX2_YARLI RecName: Full=Acyl-coenzyme A oxidase 2; Short=Acyl-CoA oxidase 
2 [Yarrowia lipolytica CLIB122]
 emb|CAA04660.1| Acyl-CoA oxidase 2 [Yarrowia lipolytica]
 emb|CAG78071.1| YALI0F10857p [Yarrowia lipolytica CLIB122]
 gb|AGJ89973.1| acyl-CoA oxidase 2, partial [synthetic construct]
Length=700

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 99/169 (59%), Gaps = 11/169 (7%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTENGPESELRKLALLDVIALFDHSLSVKLGV  371
            Y+ N EQ R +TM R+  L            + PE +++K   L  I + D     +LGV
Sbjct  73   YDLNKEQIRELTMERVAKL-------SLFVRDQPEDDIKKRFAL--IGIADMGTYTRLGV  123

Query  372  HFILWGGAIQFLGTKRHHDEWLRDTENYAVK--GCFAMTELGHGSNVRGIETVTTYDSRT  545
            H+ L+ GA++  GT      W+        K  GCF+MTELGHGSN+ G+ET   YD  T
Sbjct  124  HYGLFFGAVRGTGTAEQFGHWISKGAGDLRKFYGCFSMTELGHGSNLAGLETTAIYDEET  183

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
             EF+INTP  +A K+WIGGAA+ ATHT+VF++L + GKD GV  F+ Q+
Sbjct  184  DEFIINTPHIAATKWWIGGAAHTATHTVVFARLIVKGKDYGVKTFVVQL  232



>ref|WP_035104505.1| acyl-CoA oxidase [Corynebacterium camporealensis]
 gb|KGL65610.1| acyl-CoA oxidase [Corynebacterium camporealensis]
Length=701

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 121/221 (55%), Gaps = 18/221 (8%)
 Frame = +3

Query  45   EPGGLDVWEMRKLMDGHNLQDRDWLYGIMIQSHLFNPRERGGKVFVAADYNQNMEQQRGM  224
            +P    V E++ L++G N + R  +            RE G    +    +  +E+QR  
Sbjct  45   KPDPAIVPELQALLEGENPEFRARM------------REFGENPDLYPRSDLPLEEQRRH  92

Query  225  TMRRIGHLLDCGVF-KGWLTENGPESELR-KLALLDVIALFDHSLSVKLGVHFILWGGAI  398
            TM  +  + + G F  G+  ENG  S  R  L  L+ +A  + SL++K GV + LWGGA+
Sbjct  93   TMEGVRAVGEEGYFLAGFREENGGSSNPRDALTTLEALASINGSLAIKSGVQWGLWGGAV  152

Query  399  QFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRTGEFVINTPCES  578
              LGT+RH  EW R   +  V GCFAMTE GHGS+V+ +ETV TYD  T EFVI+TP +S
Sbjct  153  DQLGTERH-SEWARKAASLEVPGCFAMTEHGHGSDVQSLETVATYDVETQEFVIDTPRDS  211

Query  579  AQKYWIGGAANHATHTIVFSQL---KIDGKDQGVHAFIAQI  692
            A K +IG AA       VF+QL     DG+  GVH FI  I
Sbjct  212  AVKNYIGNAAADGRAAAVFAQLVTPDSDGRSNGVHCFIVPI  252



>ref|WP_006437568.1| putative acyl-CoA oxidase [Gordonia amicalis]
 dbj|GAC54509.1| putative acyl-CoA oxidase [Gordonia amicalis NBRC 100051 = JCM 
11271]
Length=683

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 110/186 (59%), Gaps = 7/186 (4%)
 Frame = +3

Query  156  RERGGKVFVAADYNQNMEQQRGMTMRRIGHLLDCG-VFKGWLTENGPESEL-RKLALLDV  329
            RE   +  +  D ++ + + R  T+  +  L   G    G+ +++G   ++   +  +++
Sbjct  65   RENSNRADLLPDSSRTLGESRAHTLEVMRELASQGFAAAGFASDHGGTGDIGASITAIEM  124

Query  330  IALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVR  509
            +   D SL VK GV + L+GGA++ LGTKRHHD+++    N  V GCFAMTE GHGSNV+
Sbjct  125  LGYADLSLMVKAGVQWGLFGGAVENLGTKRHHDKYVPGIINMDVLGCFAMTETGHGSNVQ  184

Query  510  GIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQ-----GVH  674
             IET  TYD  T EFVI++P  S++K +IGGAA HA    VF+QL   G D+     GVH
Sbjct  185  AIETTATYDRDTREFVIHSPTPSSRKDYIGGAAEHARFAAVFAQLITGGPDEEPEGRGVH  244

Query  675  AFIAQI  692
             F+  I
Sbjct  245  CFVVPI  250



>gb|AAH22268.1| ACOXL protein, partial [Homo sapiens]
Length=333

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 102/170 (60%), Gaps = 4/170 (2%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGW---LTENGPESELRKLALLDVIALFDHSLSVK  362
            Y+ ++++ R +T++R+   +D  + K     L E       R L + +V+++ D +  VK
Sbjct  48   YDLSLDEMRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVK  107

Query  363  LGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSR  542
             G+ + L+GGAI+ LG+  H  +W +  +     G FAMTE GHGSN RGI+T  T+D  
Sbjct  108  CGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLS  167

Query  543  TGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              EFVI+TPCE+A+K +IG A  +  +  VF+QL IDG+ QG H FI  +
Sbjct  168  AQEFVIDTPCENAEKMYIGNAM-YGNYAAVFAQLIIDGRSQGPHCFIVPV  216



>ref|WP_018550940.1| acyl-CoA oxidase [Streptomyces sp. ATexAB-D23]
Length=653

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  309  KLALLDVIALFDHSLSVKLGVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTEL  488
             +A  + +A  D S+ VK+GV F L+GGAI  LGT+RHHD +L D     + GCFAMTE 
Sbjct  94   SIAAFETLAFGDLSVLVKVGVQFGLFGGAILHLGTRRHHDAYLPDLITGRLMGCFAMTET  153

Query  489  GHGSNVRGIETVTTYDSRTGEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQG  668
            GHGSNV+ + TV TYD+   EFVI T  E A K +IG AA HA   +VF+QL++ GK +G
Sbjct  154  GHGSNVQALGTVATYDAAAQEFVITTRGEEAGKDYIGNAARHAELAVVFAQLEVGGKGEG  213

Query  669  VHAFIAQI  692
            VHAF+  +
Sbjct  214  VHAFVVPV  221



>ref|WP_042246211.1| acyl-CoA oxidase [Nonlabens ulvanivorans]
 dbj|GAK99398.1| acyl-coenzyme A oxidase 1 [Nonlabens ulvanivorans]
Length=768

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 105/169 (62%), Gaps = 2/169 (1%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTE--NGPESELRKLALLDVIALFDHSLSVKL  365
            +++++  +R   ++    L D G+ K        G +S ++  A+ + +A +D SL++K 
Sbjct  187  HSEDLYSRREKVLQWTQELADAGLGKLAYPSAYGGSDSMVQYAAVFEEMAKYDLSLTIKF  246

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF L+GG+++ LGT  HHD++L+D    A+ GCFAMTE+ HGSNV+ ++T   Y    
Sbjct  247  GVHFGLFGGSVESLGTNYHHDKYLKDIGTMALPGCFAMTEMHHGSNVKALQTTAIYQPDD  306

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              F+INTP  + +K +IG AA HA    VF+QL +D ++ G+HAF+  I
Sbjct  307  QSFIINTPTHNDRKTYIGNAAMHAQMATVFAQLIVDDEEHGIHAFLVPI  355



>ref|WP_042270257.1| acyl-CoA oxidase [Nonlabens ulvanivorans]
 dbj|GAK75894.1| acyl-coenzyme A oxidase 1, peroxisomal [Nonlabens ulvanivorans]
Length=768

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 105/169 (62%), Gaps = 2/169 (1%)
 Frame = +3

Query  192  YNQNMEQQRGMTMRRIGHLLDCGVFKGWLTE--NGPESELRKLALLDVIALFDHSLSVKL  365
            +++++  +R   ++    L D G+ K        G +S ++  A+ + +A +D SL++K 
Sbjct  187  HSEDLYSRREKVLQWTQELADAGLGKLAYPSAYGGSDSMVQYAAVFEEMAKYDLSLTIKF  246

Query  366  GVHFILWGGAIQFLGTKRHHDEWLRDTENYAVKGCFAMTELGHGSNVRGIETVTTYDSRT  545
            GVHF L+GG+++ LGT  HHD++L+D    A+ GCFAMTE+ HGSNV+ ++T   Y    
Sbjct  247  GVHFGLFGGSVESLGTNYHHDKYLKDIGTMALPGCFAMTEMHHGSNVKALQTTAIYQPDD  306

Query  546  GEFVINTPCESAQKYWIGGAANHATHTIVFSQLKIDGKDQGVHAFIAQI  692
              F+INTP  + +K +IG AA HA    VF+QL +D ++ G+HAF+  I
Sbjct  307  QSFIINTPTHNDRKTYIGNAAMHAQMATVFAQLIVDDEEHGIHAFLVPI  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520