BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019O14

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     121   1e-29   Nicotiana tomentosiformis
ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     120   2e-29   Nicotiana sylvestris
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     119   5e-29   Solanum tuberosum [potatoes]
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     109   1e-25   Solanum lycopersicum
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     108   5e-25   Nicotiana sylvestris
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             105   5e-24   
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    108   6e-24   
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     104   8e-24   Populus euphratica
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     103   2e-23   Nicotiana tomentosiformis
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    103   3e-23   
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    103   3e-23   Brassica rapa
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          102   4e-23   Camelina sativa [gold-of-pleasure]
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                102   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 102   5e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     102   7e-23   Eucalyptus grandis [rose gum]
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                     102   8e-23   Eucalyptus grandis [rose gum]
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     101   2e-22   
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          100   2e-22   Solanum lycopersicum
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     100   2e-22   Camelina sativa [gold-of-pleasure]
gb|AAG60153.1|AC074360_18  lipase, putative                             100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174440.2|  GDSL esterase/lipase                                  100   3e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43309.1|  BnaC03g58810D                                          100   3e-22   Brassica napus [oilseed rape]
emb|CDX90163.1|  BnaA08g18210D                                          100   3e-22   
dbj|BAD95190.1|  hypothetical protein                                   100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031122.1|  GDSL esterase/lipase                               100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     100   3e-22   Tarenaya hassleriana [spider flower]
gb|KJB63192.1|  hypothetical protein B456_009G437100                  99.4    3e-22   Gossypium raimondii
emb|CDO96753.1|  unnamed protein product                                100   3e-22   Coffea canephora [robusta coffee]
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  99.8    5e-22   Sesamum indicum [beniseed]
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   99.8    6e-22   Cucumis melo [Oriental melon]
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890    102   7e-22   
gb|KJB63193.1|  hypothetical protein B456_009G437100                  99.0    1e-21   Gossypium raimondii
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  99.0    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_010316802.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  98.2    1e-21   Solanum lycopersicum
ref|XP_010316801.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  98.2    1e-21   Solanum lycopersicum
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  98.2    2e-21   
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  98.6    2e-21   Camelina sativa [gold-of-pleasure]
ref|NP_001031103.1|  GDSL esterase/lipase                             97.8    2e-21   
emb|CDP21061.1|  unnamed protein product                              98.2    2e-21   Coffea canephora [robusta coffee]
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  98.2    2e-21   Solanum lycopersicum
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   97.8    2e-21   Brassica rapa
ref|NP_174182.1|  GDSL esterase/lipase                                97.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65183.1|  lipase, putative                                      97.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   97.8    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   97.1    6e-21   
ref|NP_174186.1|  GDSL esterase/lipase                                96.7    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg           96.7    7e-21   Eutrema salsugineum [saltwater cress]
ref|NP_180304.1|  GDSL esterase/lipase                                96.3    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174181.1|  GDSL esterase/lipase                                96.3    1e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44668.1|  putative lipase                                      96.3    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893540.1|  predicted protein                                99.0    1e-20   
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                  99.0    1e-20   Arabis alpina [alpine rockcress]
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                   96.3    1e-20   Eucalyptus grandis [rose gum]
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580        95.9    1e-20   Vitis vinifera
dbj|BAF02148.1|  putative lipase                                      95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   95.9    1e-20   Eucalyptus grandis [rose gum]
emb|CDO96750.1|  unnamed protein product                              95.9    1e-20   Coffea canephora [robusta coffee]
gb|EYU28061.1|  hypothetical protein MIMGU_mgv11b014990mg             96.7    1e-20   Erythranthe guttata [common monkey flower]
gb|AAF24548.2|AC007508_11  F1K23.17                                   98.2    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  95.1    3e-20   Camelina sativa [gold-of-pleasure]
emb|CDX94633.1|  BnaC07g10250D                                        95.1    3e-20   
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  95.1    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg           97.1    3e-20   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   94.7    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879083.1|  predicted protein                                94.7    3e-20   
ref|XP_002893538.1|  predicted protein                                97.1    3e-20   
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   94.7    4e-20   Cucumis sativus [cucumbers]
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg           94.7    4e-20   
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   94.4    4e-20   Phoenix dactylifera
ref|NP_174179.3|  GDSL esterase/lipase                                94.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   94.4    4e-20   Phoenix dactylifera
gb|KHG23842.1|  hypothetical protein F383_29871                       94.0    5e-20   Gossypium arboreum [tree cotton]
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3     94.0    5e-20   
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  94.0    6e-20   Elaeis guineensis
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  94.0    7e-20   Elaeis guineensis
emb|CDO96749.1|  unnamed protein product                              94.0    7e-20   Coffea canephora [robusta coffee]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   94.0    8e-20   Camelina sativa [gold-of-pleasure]
emb|CDY63997.1|  BnaA07g36510D                                        93.2    8e-20   Brassica napus [oilseed rape]
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   94.0    8e-20   Solanum tuberosum [potatoes]
ref|NP_564313.1|  GDSL esterase/lipase                                92.4    9e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62807.1|  hypothetical protein B456_009G437300                  93.6    9e-20   Gossypium raimondii
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   93.6    9e-20   Setaria italica
emb|CBI30663.3|  unnamed protein product                              96.3    1e-19   Vitis vinifera
ref|NP_001043722.1|  Os01g0650000                                     90.5    2e-19   
gb|AAF24544.2|AC007508_7  F1K23.13                                    95.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912621.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   90.5    2e-19   
gb|EYU28066.1|  hypothetical protein MIMGU_mgv1a009376mg              92.4    2e-19   Erythranthe guttata [common monkey flower]
gb|KJB62806.1|  hypothetical protein B456_009G437200                  92.8    2e-19   Gossypium raimondii
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   92.4    2e-19   Brassica rapa
emb|CDY64716.1|  BnaCnng44670D                                        92.4    2e-19   Brassica napus [oilseed rape]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252  95.1    2e-19   
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   92.4    3e-19   Fragaria vesca subsp. vesca
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg           91.7    3e-19   
emb|CDY15657.1|  BnaA07g08280D                                        92.4    3e-19   Brassica napus [oilseed rape]
emb|CDY30819.1|  BnaC05g21950D                                        92.4    3e-19   Brassica napus [oilseed rape]
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...  92.0    3e-19   Brassica napus [oilseed rape]
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   92.0    3e-19   Brassica rapa
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   92.0    3e-19   Prunus mume [ume]
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   92.4    3e-19   Camelina sativa [gold-of-pleasure]
ref|NP_174185.2|  GDSL esterase/lipase                                91.7    4e-19   Arabidopsis thaliana [mouse-ear cress]
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...  91.7    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   91.7    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   91.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670        91.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|NP_973932.1|  GDSL esterase/lipase                                91.3    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078           91.3    6e-19   
emb|CDX90162.1|  BnaA08g18220D                                        91.3    6e-19   
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   90.5    6e-19   
ref|XP_008777732.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   90.1    7e-19   Phoenix dactylifera
gb|AAX62802.1|  lipase 2                                              90.9    7e-19   Brassica napus [oilseed rape]
emb|CDY63998.1|  BnaA07g36520D                                        90.9    7e-19   Brassica napus [oilseed rape]
dbj|BAD68800.1|  lipase-like                                          89.4    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969325.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.9    8e-19   Setaria italica
emb|CDP22023.1|  unnamed protein product                              88.6    8e-19   Coffea canephora [robusta coffee]
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   90.9    8e-19   Nelumbo nucifera [Indian lotus]
gb|EEE55086.1|  hypothetical protein OsJ_02828                        89.7    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   90.9    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.5    1e-18   
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   90.1    1e-18   
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592  92.8    1e-18   
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  90.5    1e-18   
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   90.5    1e-18   Brassica rapa
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  90.5    1e-18   Brassica rapa
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  90.5    1e-18   
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg           90.5    1e-18   
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   90.1    1e-18   Brassica rapa
ref|NP_174188.1|  lipase ARAB-1                                       90.1    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   90.1    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE55085.1|  hypothetical protein OsJ_02827                        90.1    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAX59709.1|  lipase 1                                              89.7    2e-18   Brassica napus [oilseed rape]
emb|CDY15658.1|  BnaA07g08290D                                        90.1    2e-18   Brassica napus [oilseed rape]
ref|NP_001043721.1|  Os01g0649900                                     90.1    2e-18   
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   90.5    2e-18   
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925  92.0    2e-18   
dbj|BAC41872.1|  unknown protein                                      88.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83549.1|  unnamed protein product                              89.7    2e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   89.7    2e-18   Cucumis melo [Oriental melon]
ref|NP_174180.1|  GDSL esterase/lipase                                89.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EMT22154.1|  GDSL esterase/lipase                                  89.7    2e-18   
ref|XP_003593736.1|  GDSL esterase/lipase                             89.7    2e-18   Medicago truncatula
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   89.7    2e-18   
ref|NP_001043724.1|  Os01g0650200                                     89.0    2e-18   
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650        89.0    3e-18   
gb|EEC75320.1|  hypothetical protein OsI_11693                        89.0    3e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   89.0    4e-18   Phoenix dactylifera
gb|EAY90131.1|  hypothetical protein OsI_11697                        89.0    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   89.0    4e-18   Elaeis guineensis
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   89.0    4e-18   Setaria italica
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479  91.3    4e-18   
emb|CDX94632.1|  BnaC07g10260D                                        89.0    4e-18   
gb|EAY75181.1|  hypothetical protein OsI_03071                        89.0    5e-18   Oryza sativa Indica Group [Indian rice]
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                  89.0    5e-18   Arabis alpina [alpine rockcress]
ref|XP_006844514.1|  hypothetical protein AMTR_s00016p00146420        85.9    5e-18   
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg           88.6    5e-18   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                   88.2    5e-18   Eucalyptus grandis [rose gum]
gb|EEE59101.1|  hypothetical protein OsJ_10956                        88.2    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_564314.1|  GDSL esterase/lipase                                88.2    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   88.2    7e-18   Cicer arietinum [garbanzo]
ref|NP_001050175.1|  Os03g0365800                                     88.2    7e-18   
ref|NP_849723.1|  GDSL esterase/lipase                                88.2    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658887.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   88.2    7e-18   Oryza brachyantha
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320        88.2    8e-18   Amborella trichopoda
gb|EPS71267.1|  hypothetical protein M569_03493                       88.6    8e-18   Genlisea aurea
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   88.2    8e-18   Nelumbo nucifera [Indian lotus]
gb|EAY90132.1|  hypothetical protein OsI_11698                        88.2    8e-18   Oryza sativa Indica Group [Indian rice]
gb|EAZ27028.1|  hypothetical protein OsJ_10957                        88.2    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KEH36573.1|  GDSL-like lipase/acylhydrolase                        87.4    9e-18   Medicago truncatula
emb|CDP15060.1|  unnamed protein product                              87.8    9e-18   Coffea canephora [robusta coffee]
ref|XP_002274810.1|  PREDICTED: GDSL esterase/lipase At3g48460        87.8    1e-17   Vitis vinifera
ref|XP_006645636.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   87.8    1e-17   
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   88.2    1e-17   Brassica rapa
emb|CAN62554.1|  hypothetical protein VITISV_031355                   87.8    1e-17   Vitis vinifera
gb|KJB62810.1|  hypothetical protein B456_009G437600                  87.8    1e-17   Gossypium raimondii
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   87.8    1e-17   Cucumis sativus [cucumbers]
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  87.4    1e-17   
emb|CBI14877.3|  unnamed protein product                              87.8    1e-17   Vitis vinifera
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   87.8    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU19966.1|  unknown                                               85.9    1e-17   Glycine max [soybeans]
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   87.4    1e-17   
gb|AFK42362.1|  unknown                                               87.4    2e-17   Medicago truncatula
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   87.4    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003593737.1|  GDSL esterase/lipase                             87.0    2e-17   Medicago truncatula
ref|XP_004959854.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   87.4    2e-17   Setaria italica
dbj|BAD68794.1|  lipase-like                                          87.0    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   87.4    2e-17   Oryza brachyantha
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   87.0    2e-17   
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   86.7    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001060434.1|  Os07g0642200                                     87.0    2e-17   
gb|EAZ04881.1|  hypothetical protein OsI_27063                        87.0    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002461107.1|  hypothetical protein SORBIDRAFT_02g040890        87.0    2e-17   
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   86.7    3e-17   Camelina sativa [gold-of-pleasure]
gb|KJB51165.1|  hypothetical protein B456_008G204600                  86.7    3e-17   Gossypium raimondii
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  87.0    3e-17   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...  86.3    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   87.0    3e-17   
gb|EMT20589.1|  GDSL esterase/lipase                                  85.9    3e-17   
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  86.7    4e-17   
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   86.3    4e-17   
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878  88.2    5e-17   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   85.9    5e-17   Cicer arietinum [garbanzo]
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280        85.9    5e-17   Amborella trichopoda
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   85.9    6e-17   Brachypodium distachyon [annual false brome]
ref|XP_002456053.1|  hypothetical protein SORBIDRAFT_03g029590        85.9    6e-17   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600        85.9    7e-17   Glycine max [soybeans]
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  85.9    7e-17   Camelina sativa [gold-of-pleasure]
gb|EMT30306.1|  GDSL esterase/lipase                                  85.1    7e-17   
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  85.9    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   85.5    7e-17   
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   85.9    8e-17   Setaria italica
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940        85.5    8e-17   
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   85.1    9e-17   
emb|CDO99485.1|  unnamed protein product                              85.5    9e-17   Coffea canephora [robusta coffee]
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like   85.1    9e-17   Glycine max [soybeans]
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g           85.1    1e-16   Phaseolus vulgaris [French bean]
emb|CDY43308.1|  BnaC03g58800D                                        85.1    1e-16   Brassica napus [oilseed rape]
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  85.1    1e-16   
tpg|DAA58331.1|  TPA: hypothetical protein ZEAMMB73_278814            84.0    1e-16   
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924  86.7    1e-16   
ref|XP_007148067.1|  hypothetical protein PHAVU_006G177800g           84.0    1e-16   Phaseolus vulgaris [French bean]
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   84.7    2e-16   
ref|XP_006651409.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   84.3    2e-16   Oryza brachyantha
gb|KHG00751.1|  hypothetical protein F383_21550                       84.3    2e-16   Gossypium arboreum [tree cotton]
ref|NP_001241470.1|  uncharacterized protein LOC100816865             84.3    2e-16   Glycine max [soybeans]
ref|XP_010518794.1|  PREDICTED: GDSL esterase/lipase At5g45910        83.6    2e-16   Tarenaya hassleriana [spider flower]
dbj|BAJ94075.1|  predicted protein                                    84.3    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95195.1|  predicted protein                                    84.3    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   84.0    2e-16   
emb|CDX94634.1|  BnaC07g10240D                                        84.3    2e-16   
emb|CDO96748.1|  unnamed protein product                              82.8    2e-16   Coffea canephora [robusta coffee]
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   83.2    2e-16   
ref|NP_001130974.1|  uncharacterized protein LOC100192079             84.3    3e-16   Zea mays [maize]
emb|CDY15655.1|  BnaA07g08260D                                        84.0    3e-16   Brassica napus [oilseed rape]
gb|KDO77811.1|  hypothetical protein CISIN_1g018031mg                 82.4    3e-16   Citrus sinensis [apfelsine]
gb|EEC75319.1|  hypothetical protein OsI_11692                        82.8    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004980345.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   83.6    3e-16   Setaria italica
ref|XP_006651410.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   83.6    3e-16   
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   84.0    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_011072984.1|  PREDICTED: GDSL esterase/lipase At3g48460        83.6    3e-16   Sesamum indicum [beniseed]
gb|ACN28025.1|  unknown                                               83.6    4e-16   Zea mays [maize]
gb|KJB57433.1|  hypothetical protein B456_009G164000                  83.6    4e-16   Gossypium raimondii
ref|NP_001149094.1|  LOC100282715 precursor                           83.6    4e-16   Zea mays [maize]
gb|KJB62808.1|  hypothetical protein B456_009G437400                  82.8    4e-16   Gossypium raimondii
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                   83.2    4e-16   Eucalyptus grandis [rose gum]
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   83.2    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580        83.6    4e-16   
ref|XP_009383572.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   83.2    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   83.2    5e-16   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910        83.2    5e-16   Fragaria vesca subsp. vesca
gb|KHN08454.1|  GDSL esterase/lipase                                  84.7    5e-16   Glycine soja [wild soybean]
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   83.6    5e-16   Oryza brachyantha
emb|CDO96755.1|  unnamed protein product                              83.2    5e-16   Coffea canephora [robusta coffee]
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   82.8    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  82.8    7e-16   Setaria italica
ref|XP_004983111.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   82.8    7e-16   Setaria italica
gb|KDO77810.1|  hypothetical protein CISIN_1g018031mg                 82.0    7e-16   Citrus sinensis [apfelsine]
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.8    7e-16   Sesamum indicum [beniseed]
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...  82.8    8e-16   
gb|EMT27195.1|  GDSL esterase/lipase                                  82.8    8e-16   
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.4    8e-16   Brachypodium distachyon [annual false brome]
ref|XP_002467296.1|  hypothetical protein SORBIDRAFT_01g023210        83.2    8e-16   
ref|XP_009414901.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   82.0    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT09180.1|  GDSL esterase/lipase                                  81.6    1e-15   
ref|XP_010054331.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.3    1e-15   
gb|EAZ15960.1|  hypothetical protein OsJ_31404                        80.9    1e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDM83548.1|  unnamed protein product                              82.8    1e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  84.0    1e-15   
ref|NP_001064519.1|  Os10g0393500                                     80.9    1e-15   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.0    1e-15   Citrus sinensis [apfelsine]
dbj|BAJ86481.1|  predicted protein                                    82.0    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC66886.1|  hypothetical protein OsI_33440                        81.3    1e-15   Oryza sativa Indica Group [Indian rice]
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                 81.6    1e-15   Citrus sinensis [apfelsine]
ref|XP_006351456.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   82.0    1e-15   Solanum tuberosum [potatoes]
tpg|DAA58958.1|  TPA: hypothetical protein ZEAMMB73_908344            80.1    1e-15   
gb|KHG30334.1|  hypothetical protein F383_10781                       81.6    1e-15   Gossypium arboreum [tree cotton]
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   82.0    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_007037866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  82.0    1e-15   
gb|AAP53581.2|  GDSL-like Lipase/Acylhydrolase family protein, ex...  81.3    2e-15   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   82.0    2e-15   
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...  82.4    2e-15   
ref|XP_009791093.1|  PREDICTED: GDSL esterase/lipase At3g48460        81.6    2e-15   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850        81.6    2e-15   
ref|XP_008647410.1|  PREDICTED: uncharacterized protein LOC100193...  80.9    2e-15   
gb|AFK33964.1|  unknown                                               80.5    2e-15   
ref|XP_002438722.1|  hypothetical protein SORBIDRAFT_10g025030        81.3    2e-15   
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...  82.4    2e-15   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910        81.6    2e-15   
dbj|BAK06933.1|  predicted protein                                    82.0    2e-15   
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                   81.3    2e-15   
gb|ABF96122.1|  GDSL-like Lipase/Acylhydrolase family protein         81.3    2e-15   
gb|EMT01150.1|  GDSL esterase/lipase                                  81.3    2e-15   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.3    2e-15   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                   81.3    2e-15   
ref|XP_010925698.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  80.9    2e-15   
gb|EAY78349.1|  hypothetical protein OsI_33438                        81.6    2e-15   
dbj|BAJ93079.1|  predicted protein                                    82.0    2e-15   
gb|AAM22734.1|AC092388_18  putative lipase                            81.6    2e-15   
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   81.3    2e-15   
ref|XP_010925697.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  80.9    2e-15   
gb|EMT29920.1|  GDSL esterase/lipase                                  77.4    2e-15   
ref|XP_002463272.1|  hypothetical protein SORBIDRAFT_02g040950        81.3    2e-15   
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   81.6    2e-15   
ref|XP_010251983.1|  PREDICTED: acetylajmalan esterase-like           80.9    3e-15   
ref|NP_001149156.1|  esterase precursor                               80.9    3e-15   
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  80.9    3e-15   
gb|KJB66735.1|  hypothetical protein B456_010G156100                  80.1    3e-15   
ref|XP_003560003.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   80.9    3e-15   
dbj|BAJ98364.1|  predicted protein                                    81.3    3e-15   
emb|CDM83418.1|  unnamed protein product                              81.3    3e-15   
ref|XP_009596313.1|  PREDICTED: GDSL esterase/lipase At3g48460        80.9    3e-15   
ref|NP_001132231.1|  uncharacterized protein LOC100193666 precursor   80.9    3e-15   
gb|AFW76565.1|  hypothetical protein ZEAMMB73_187768                  80.9    3e-15   
ref|XP_010243820.1|  PREDICTED: acetylajmalan esterase-like           78.6    3e-15   
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  81.3    3e-15   
ref|NP_973930.1|  GDSL esterase/lipase                                80.1    4e-15   
gb|AAM22723.1|AC092388_7  putative lipase                             80.9    4e-15   
tpg|DAA58335.1|  TPA: hypothetical protein ZEAMMB73_102185            81.3    4e-15   
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  80.9    4e-15   
ref|XP_008675273.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  81.3    4e-15   
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.5    4e-15   
dbj|BAD44794.1|  lipase-like                                          78.6    4e-15   
dbj|BAJ98811.1|  predicted protein                                    79.7    4e-15   
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  80.9    4e-15   
ref|XP_003563800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.5    4e-15   
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880        80.5    4e-15   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   80.5    5e-15   
ref|XP_010232088.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  80.9    5e-15   
ref|XP_010314861.1|  PREDICTED: acetylajmalan esterase-like           80.5    5e-15   
ref|XP_003569457.2|  PREDICTED: GDSL esterase/lipase At1g28600-li...  80.9    5e-15   
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                 80.5    5e-15   
ref|XP_002456055.1|  hypothetical protein SORBIDRAFT_03g029610        80.1    5e-15   
dbj|BAK05815.1|  predicted protein                                    80.1    6e-15   
ref|XP_003566943.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   80.1    6e-15   
emb|CDM83767.1|  unnamed protein product                              79.7    6e-15   
ref|XP_009353234.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   80.1    6e-15   
gb|EAZ12674.1|  hypothetical protein OsJ_02589                        80.5    6e-15   
ref|XP_004236316.1|  PREDICTED: GDSL esterase/lipase At3g48460        80.1    6e-15   
emb|CDO98569.1|  unnamed protein product                              80.1    6e-15   
gb|KJB58921.1|  hypothetical protein B456_009G234500                  80.1    6e-15   
ref|XP_010696197.1|  PREDICTED: GDSL esterase/lipase At3g48460        80.5    6e-15   
dbj|BAJ99647.1|  predicted protein                                    80.1    7e-15   
emb|CDM82194.1|  unnamed protein product                              79.7    7e-15   
gb|KJB58920.1|  hypothetical protein B456_009G234500                  80.1    7e-15   
ref|XP_006342691.1|  PREDICTED: acetylajmalan esterase-like           80.1    7e-15   
emb|CAN64953.1|  hypothetical protein VITISV_042282                   81.6    8e-15   
ref|XP_002321669.1|  GDSL-motif lipase/hydrolase family protein       79.7    8e-15   
gb|KCW64327.1|  hypothetical protein EUGRSUZ_G01959                   79.7    8e-15   
gb|EMT16275.1|  GDSL esterase/lipase                                  79.7    8e-15   
ref|XP_007020870.1|  GDSL esterase/lipase                             78.6    9e-15   
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   79.7    9e-15   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g           79.7    9e-15   
ref|XP_010066434.1|  PREDICTED: acetylajmalan esterase                79.7    9e-15   
ref|XP_011024095.1|  PREDICTED: GDSL esterase/lipase At3g48460        79.7    9e-15   
ref|XP_010666442.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   80.1    9e-15   
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910        79.3    1e-14   
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   80.1    1e-14   
ref|XP_002511260.1|  Esterase precursor, putative                     79.7    1e-14   
gb|AFW80396.1|  hypothetical protein ZEAMMB73_584405                  78.2    1e-14   
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.3    1e-14   
gb|KJB66738.1|  hypothetical protein B456_010G156100                  79.3    1e-14   
gb|KJB66739.1|  hypothetical protein B456_010G156100                  79.3    1e-14   
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   79.7    1e-14   
emb|CDY30822.1|  BnaC05g21980D                                        79.7    1e-14   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.3    1e-14   
ref|XP_010248800.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   79.3    1e-14   
gb|EMT27686.1|  GDSL esterase/lipase                                  79.3    1e-14   
gb|KFK44740.1|  hypothetical protein AALP_AA1G296800                  78.2    1e-14   
dbj|BAA94228.1|  putative esterase                                    79.0    1e-14   
gb|EEE54111.1|  hypothetical protein OsJ_00875                        79.0    1e-14   
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    1e-14   
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970        79.3    2e-14   
ref|NP_001042396.1|  Os01g0215700                                     79.0    2e-14   
ref|XP_006476962.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   79.3    2e-14   
gb|KDP21068.1|  hypothetical protein JCGZ_21539                       79.0    2e-14   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   79.0    2e-14   
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg           79.7    2e-14   
dbj|BAJ97312.1|  predicted protein                                    79.3    2e-14   
ref|XP_006440021.1|  hypothetical protein CICLE_v10020570mg           79.0    2e-14   
dbj|BAJ92568.1|  predicted protein                                    79.0    2e-14   
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.6    2e-14   
gb|EMS58229.1|  Malate dehydrogenase 1, mitochondrial                 79.0    2e-14   
gb|ACJ84905.1|  unknown                                               77.4    2e-14   
ref|NP_001140937.1|  hypothetical protein                             79.3    2e-14   
gb|EMT23218.1|  GDSL esterase/lipase                                  78.2    2e-14   
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770        79.3    2e-14   
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   78.6    2e-14   
ref|XP_011084056.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   78.6    2e-14   
gb|EAY99508.1|  hypothetical protein OsI_21478                        79.0    2e-14   
ref|XP_004959853.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   78.2    3e-14   
dbj|BAK04206.1|  predicted protein                                    78.2    3e-14   
ref|XP_008367797.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   75.9    3e-14   
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg           78.2    3e-14   
ref|NP_001185228.1|  GDSL esterase/lipase                             78.2    3e-14   
dbj|BAD73008.1|  putative esterase                                    77.4    3e-14   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.2    3e-14   
gb|EMT05392.1|  GDSL esterase/lipase                                  78.2    3e-14   
ref|XP_009773454.1|  PREDICTED: acetylajmalan esterase-like           76.6    3e-14   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                   78.2    3e-14   
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   78.2    3e-14   
tpg|DAA58338.1|  TPA: hypothetical protein ZEAMMB73_636863            75.9    4e-14   
gb|EMT29449.1|  GDSL esterase/lipase                                  77.4    4e-14   
gb|EMT08653.1|  GDSL esterase/lipase                                  78.6    4e-14   
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  77.4    4e-14   
gb|EYU40119.1|  hypothetical protein MIMGU_mgv1a021460mg              78.2    4e-14   
gb|EMT25207.1|  GDSL esterase/lipase                                  77.8    4e-14   
ref|XP_008466915.1|  PREDICTED: acetylajmalan esterase-like           75.5    4e-14   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   78.2    4e-14   
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820        77.8    4e-14   
ref|XP_004301038.1|  PREDICTED: GDSL esterase/lipase At3g48460        77.8    5e-14   
gb|AFW80395.1|  esterase                                              77.4    5e-14   
ref|XP_006662320.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   76.3    5e-14   
ref|XP_010915615.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  75.9    5e-14   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   77.8    6e-14   
gb|EEC80750.1|  hypothetical protein OsI_23233                        77.4    6e-14   
gb|EEE54110.1|  hypothetical protein OsJ_00874                        77.4    6e-14   
ref|NP_001057785.1|  Os06g0531600                                     77.4    6e-14   
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   76.6    6e-14   
ref|NP_190416.1|  GDSL esterase/lipase                                77.4    6e-14   
gb|EAZ12915.1|  hypothetical protein OsJ_02838                        76.3    6e-14   
gb|AES91099.2|  GDSL-like lipase/acylhydrolase                        77.4    7e-14   
ref|XP_008383651.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   75.5    7e-14   
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650        77.4    7e-14   
ref|XP_006645637.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   76.6    7e-14   
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880        77.0    8e-14   
ref|XP_007209226.1|  hypothetical protein PRUPE_ppa006897mg           77.4    8e-14   
gb|EEC70171.1|  hypothetical protein OsI_00893                        77.0    8e-14   
gb|EEC70172.1|  hypothetical protein OsI_00897                        75.5    8e-14   
gb|EMT11816.1|  GDSL esterase/lipase                                  74.3    8e-14   
ref|XP_010683532.1|  PREDICTED: acetylajmalan esterase-like           77.0    9e-14   
ref|XP_008454485.1|  PREDICTED: GDSL esterase/lipase At5g03980-like   77.0    9e-14   
ref|XP_003572041.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.0    9e-14   
gb|EEE65824.1|  hypothetical protein OsJ_21563                        77.4    9e-14   
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                   76.6    9e-14   
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980        76.6    1e-13   
ref|XP_009773453.1|  PREDICTED: acetylajmalan esterase-like           76.6    1e-13   
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   77.0    1e-13   
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  76.6    1e-13   
gb|KHG07034.1|  Acetylajmalan esterase                                76.6    1e-13   
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  76.6    1e-13   
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  76.6    1e-13   
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  76.6    1e-13   
emb|CDO96754.1|  unnamed protein product                              76.6    1e-13   
emb|CDX71574.1|  BnaC04g18090D                                        76.6    1e-13   
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   76.3    1e-13   
gb|EMT16273.1|  GDSL esterase/lipase                                  77.0    1e-13   
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   76.3    1e-13   
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910        76.3    1e-13   
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  76.6    1e-13   
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  76.3    1e-13   
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   76.3    1e-13   
gb|ADN33970.1|  lipase                                                76.3    1e-13   
gb|ABK24921.1|  unknown                                               76.3    2e-13   
ref|XP_010101939.1|  GDSL esterase/lipase                             76.3    2e-13   
gb|EAY75193.1|  hypothetical protein OsI_03085                        76.3    2e-13   
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                   76.3    2e-13   
ref|XP_008439284.1|  PREDICTED: GDSL esterase/lipase At3g48460        76.3    2e-13   
ref|XP_010915614.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  75.5    2e-13   
ref|XP_008351751.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  74.3    2e-13   
gb|EAZ11035.1|  hypothetical protein OsJ_00879                        76.3    2e-13   
ref|NP_001042399.1|  Os01g0216400                                     75.9    2e-13   
ref|XP_009333827.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   76.3    2e-13   
ref|XP_011073879.1|  PREDICTED: acetylajmalan esterase-like           75.1    2e-13   
ref|XP_003593744.1|  GDSL esterase/lipase                             75.9    2e-13   
ref|XP_004152298.1|  PREDICTED: acetylajmalan esterase-like           75.9    2e-13   
ref|XP_010026792.1|  PREDICTED: GDSL esterase/lipase At3g48460        75.9    2e-13   
ref|XP_004156989.1|  PREDICTED: LOW QUALITY PROTEIN: acetylajmala...  75.9    2e-13   
ref|XP_004152509.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   76.3    2e-13   
gb|EAZ12911.1|  hypothetical protein OsJ_02834                        75.9    2e-13   
ref|XP_008393854.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   75.9    2e-13   
ref|NP_199403.1|  GDSL esterase/lipase                                75.9    2e-13   
gb|AFW83240.1|  hypothetical protein ZEAMMB73_837402                  75.5    2e-13   
ref|XP_003566944.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   75.5    2e-13   
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   75.9    2e-13   
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein              75.9    2e-13   
ref|XP_009602651.1|  PREDICTED: acetylajmalan esterase {ECO:00003...  75.9    2e-13   
gb|AFW71084.1|  esterase                                              75.5    2e-13   
ref|XP_010696564.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   75.9    3e-13   
ref|XP_008351750.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   73.9    3e-13   
dbj|BAJ85333.1|  predicted protein                                    75.5    3e-13   
dbj|BAB89203.1|  lipase-like                                          75.5    3e-13   
ref|XP_009123458.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...  75.5    3e-13   
ref|NP_001043731.1|  Os01g0651300                                     73.6    3e-13   
ref|NP_001042398.1|  Os01g0216300                                     75.5    3e-13   
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein       75.5    3e-13   
ref|XP_002979200.1|  hypothetical protein SELMODRAFT_110510           75.9    3e-13   
ref|XP_002442352.1|  hypothetical protein SORBIDRAFT_08g018740        75.5    3e-13   
gb|KDP30982.1|  hypothetical protein JCGZ_11358                       73.9    3e-13   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   75.5    3e-13   
ref|XP_002992321.1|  hypothetical protein SELMODRAFT_135139           75.5    3e-13   
dbj|BAK01569.1|  predicted protein                                    75.5    3e-13   
gb|EMT01182.1|  GDSL esterase/lipase                                  75.5    3e-13   
gb|EMT00808.1|  GDSL esterase/lipase                                  75.5    3e-13   
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   75.5    3e-13   
dbj|BAJ90990.1|  predicted protein                                    75.5    3e-13   
gb|EPS63670.1|  hypothetical protein M569_11113                       75.1    4e-13   
ref|XP_004971835.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   75.1    4e-13   
ref|XP_008360766.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   73.6    4e-13   



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            YI L+L  S G V G CY++I+SFGDSLTD GNLIR+SKS N++V S+  PYGETFFHHP
Sbjct  11   YIILMLIASFGLVLG-CYESIISFGDSLTDTGNLIRLSKS-NSHVASSVPPYGETFFHHP  68

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG  409
            TGR+SDGRL+IDF+A SMG P + PY G
Sbjct  69   TGRFSDGRLVIDFIAESMGFPLIPPYAG  96



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            YI L+L  S G V G CY++I+SFGDSLTD GNLIR+SKS N +V S+  PYGETFFHHP
Sbjct  10   YIILLLISSFGLVLG-CYESIISFGDSLTDTGNLIRLSKS-NKHVASSVPPYGETFFHHP  67

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG  409
            TGR+SDGRLIIDF+A SMG P + PY G
Sbjct  68   TGRFSDGRLIIDFIAESMGFPLIPPYAG  95



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            + ++L  S GHV G CY++I+SFGDSL D GNLIR+SKS N  V S+ LPYGETFFHHPT
Sbjct  14   VIILLITSFGHVHG-CYESIISFGDSLADTGNLIRLSKS-NKIVASSVLPYGETFFHHPT  71

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFG  409
            GR+SDGRL+IDF+A  MG P V PY G
Sbjct  72   GRFSDGRLVIDFIAEGMGFPLVPPYVG  98



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            G Y++I+SFGDSL D GNLIR+SKS N  V S+ LPYGETFFHHPTGR+SDGRL+IDF+A
Sbjct  24   GSYESIISFGDSLADTGNLIRLSKS-NKIVASSVLPYGETFFHHPTGRFSDGRLVIDFIA  82

Query  371  LSMGLPFVEPYFG  409
              MG P V PY G
Sbjct  83   EGMGFPLVPPYVG  95



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            TAI + I L+ F        GC+ +I+SFGDSL D GN + +S+        A  PYGET
Sbjct  15   TAIAFIILLLNFF---QATKGCFNSIISFGDSLADTGNKLHLSQYKTHLPHFAVRPYGET  71

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            FFHHPTGR+SDGRL+IDF+A S+GLP V PY GGK
Sbjct  72   FFHHPTGRFSDGRLVIDFIAESLGLPLVPPYLGGK  106



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F VL +ST     GCY +I SFGDSL D GN   +S   N    S  LPYGETFFHHP
Sbjct  57   FLFNVLILSTVSCTTGCYTSIFSFGDSLADTGNSRNLSPPDNLPHYS-FLPYGETFFHHP  115

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGG  412
            TGR SDGRL+IDF+A  +GLPFV PYFGG
Sbjct  116  TGRCSDGRLVIDFIAEYLGLPFVPPYFGG  144



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   108 bits (269),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
             + Y I L+L  S   +A GCY +I+SFGDSL D GNL+ +S  +N   +    PYG TF
Sbjct  4    GVGYAIILILVASISRLASGCYDSIISFGDSLADTGNLLLLSPPNNP-PLCGRPPYGRTF  62

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR  430
            FH  TGRYSDGRL+IDF+A S+GLP VEPY   K   ++
Sbjct  63   FHRTTGRYSDGRLVIDFIAESLGLPLVEPYAAWKIAAEK  101


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  155  LVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            L+L       +  C+ +I+SFGDS+ D GN   +S  S         PYGETFF+HPTGR
Sbjct  408  LILSHKLSFASASCFTSIISFGDSIADTGNAPYLSPESGRPPFYTLPPYGETFFNHPTGR  467

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
             SDGRLIIDF+A    LPFV P+  G   G+
Sbjct  468  CSDGRLIIDFIAEEFELPFVAPFLQGGRNGN  498



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F VL +ST     GCY +I SFGDSL D GN   +S   N    S  LPYGETFFHHP
Sbjct  13   FLFNVLILSTISCTIGCYTSIFSFGDSLADTGNSRNLSPPDNLPHFS-FLPYGETFFHHP  71

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGG  412
            TGR SDGRL+IDF+A  +GLPFV PYFGG
Sbjct  72   TGRCSDGRLVIDFIAEYLGLPFVPPYFGG  100



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +2

Query  119  FSQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLP  298
            ++  TAI   I ++ F        GC+ +I+SFGDSL D GN + +S++       A  P
Sbjct  11   YTWNTAIACIILVLNFF---QATEGCFNSIISFGDSLADTGNRLHLSQNKTLLPHFAVRP  67

Query  299  YGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            YGETFFH PTGR+SDGR++IDF+A S+GLP V PY GGK
Sbjct  68   YGETFFHRPTGRFSDGRIVIDFIAESLGLPLVPPYLGGK  106



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            I  +    L V++      C  +++I+SFGDS+TD GNLI +S + N    SA LPYGET
Sbjct  12   IVSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALS-TPNELPESAFLPYGET  70

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FFHHPTGRYSDGRLIIDF+A  +GLP V P++G K 
Sbjct  71   FFHHPTGRYSDGRLIIDFIAEVLGLPHVPPFYGSKN  106



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            I  +    L V++      C  +++I+SFGDS+TD GNLI +S + N    SA LPYGET
Sbjct  12   IVSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALS-TPNELPESAFLPYGET  70

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FFHHPTGRYSDGRLIIDF+A  +GLP V P++G K 
Sbjct  71   FFHHPTGRYSDGRLIIDFIAEVLGLPHVPPFYGSKN  106



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGRYSDGRLIIDF+A  
Sbjct  35   FESIISFGDSIADTGNLLGLSDQNN-LPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAEF  93

Query  377  MGLPFVEPYFGGKTTG  424
            +GLP+V PYFG K   
Sbjct  94   LGLPYVPPYFGSKNEN  109



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +2

Query  134  AITYYIFLVLFVS--------TGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSA  289
            A+ Y I L+  ++         G    GCY++I+SFGDSL D GNL+ +S + N    +A
Sbjct  2    AVAYAIILIFLLAQSSSAAAANGKSEFGCYESIISFGDSLADTGNLLLLSPADNK-PAAA  60

Query  290  XLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
              PYG TFFH PTGR+SDGRL+IDF+A   GLPFV PY GG+ 
Sbjct  61   RPPYGRTFFHRPTGRFSDGRLVIDFIAQRFGLPFVPPYIGGQN  103



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFV+ G     C  +++I+SFGDS+ D GNL+ +S   N   MSA  PYGETFFHHPTGR
Sbjct  20   LFVTIGSSESQCQNFESIISFGDSIADTGNLLSLSDRYN-LPMSAFPPYGETFFHHPTGR  78

Query  335  YSDGRLIIDFMALSMGLPFVEPYFG  409
            +SDGRLIIDF+A  +GLP+V PYFG
Sbjct  79   FSDGRLIIDFIAEFLGLPYVPPYFG  103



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  167  VSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDG  346
            +S+   A GCY +I+SFGDSL D GN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  30   ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  89

Query  347  RLIIDFMALSMGLPFVEPYF---GGKTTGD  427
            RL+IDF+A  +GLPFV PY+   GG++  D
Sbjct  90   RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD  119



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  167  VSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDG  346
            +S+   A GCY +I+SFGDSL D GN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  28   ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  87

Query  347  RLIIDFMALSMGLPFVEPYF---GGKTTGD  427
            RL+IDF+A  +GLPFV PY+   GG++  D
Sbjct  88   RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD  117



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGRYSDGRLIIDF+A  
Sbjct  27   FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAEF  85

Query  377  MGLPFVEPYFGGKTTGDRSF  436
            +GLP+V PYFG K   +R+F
Sbjct  86   LGLPYVPPYFGFK---NRNF  102



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = +2

Query  122  SQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPY  301
            S  T +   I +VL +S  H    CY +I SFGDSL D GN++     S   V  + LPY
Sbjct  3    SSETHVGVVITIVLLLSV-HRVTSCYSSIFSFGDSLADTGNILASDGDSAGAV--SRLPY  59

Query  302  GETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            GET+FH PTGRYSDGRLIIDF+A +MG+P + PY GG +  D
Sbjct  60   GETYFHRPTGRYSDGRLIIDFIAQAMGVPLLRPYLGGGSDED  101



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTG---HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPY  301
            + I + IFLVL  S      ++  C+ +I+SFGDSLTD GN   +++  N     A LPY
Sbjct  6    SKIAFIIFLVLLNSIEGQRLISLRCFNSIISFGDSLTDTGNEFYLTRYRNPSPYFARLPY  65

Query  302  GETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            GETFFH PTGR+S+GRLIIDF+A S+GLP +  YFG K
Sbjct  66   GETFFHRPTGRFSNGRLIIDFIAESLGLPLIPAYFGEK  103



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +2

Query  137  ITYYIFL-VLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            I   IFL  LFV+       C  +++I+SFGDS+ D GNL+ +S   N   +S   PYGE
Sbjct  12   IISLIFLSTLFVTMVGSESQCRNFESIISFGDSIGDTGNLLGLSDDPNNLALSGYPPYGE  71

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            TFFH PTGR+SDGRLIIDF+A  +GLP+V PYFG K 
Sbjct  72   TFFHQPTGRFSDGRLIIDFIAEFLGLPYVPPYFGSKN  108



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFVS       C  +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20   LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            +SDGRLIIDF+A  +GLP+V PYF G T G+
Sbjct  79   FSDGRLIIDFIAEFLGLPYVPPYF-GSTNGN  108



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFVS       C  +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20   LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            +SDGRLIIDF+A  +GLP+V PYF G T G+
Sbjct  79   FSDGRLIIDFIAEFLGLPYVPPYF-GSTNGN  108



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +2

Query  137  ITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYG  304
            I+ ++FL    V+ V++       YK+I+SFGDS+ D GN +R+S   N    +A LPYG
Sbjct  9    ISTFLFLLSSTVIIVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLPQAAFLPYG  67

Query  305  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            ETFFH P+GRYSDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  68   ETFFHPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV  106



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +2

Query  137  ITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYG  304
            I+ ++FL    V+ V++       YK+I+SFGDS+ D GN +R+S   N    +A LPYG
Sbjct  9    ISTFLFLLSSTVIMVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLPQAAFLPYG  67

Query  305  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            ETFFH P+GRYSDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  68   ETFFHPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV  106



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFVS       C  +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20   LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            +SDGRLIIDF+A  +GLP+V PYF G T G+
Sbjct  79   FSDGRLIIDFIAEFLGLPYVPPYF-GSTNGN  108



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFVS       C  +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20   LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            +SDGRLIIDF+A  +GLP+V PYF G T G+
Sbjct  79   FSDGRLIIDFIAEFLGLPYVPPYF-GSTNGN  108



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I+SFGDS+ D GNL+ +S+ S+   + A  PYGETFFH PTGR+SDGRL+IDF+A 
Sbjct  40   CYDSIISFGDSIADTGNLLSLSEPSHVPQV-AFPPYGETFFHRPTGRFSDGRLVIDFIAD  98

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
            SMGLP V PYFG +  G+ SF
Sbjct  99   SMGLPLVRPYFGSR-NGNGSF  118



>gb|KJB63192.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=264

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +2

Query  143  YYIFLVLFVST--GHVAGGCYKAIVSFGDSLTDXGNLIRMSKS-SNAYVMSAXLPYGETF  313
            + +FLV+ +S+       GC+ +I SFGDSLTD GNL+ +S S S     SA LPYG TF
Sbjct  14   FLMFLVVTISSIINSQVNGCFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTF  73

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FHHPTGR+ DGRL+IDF+A ++G  F+ P++G K+
Sbjct  74   FHHPTGRFCDGRLVIDFIAEALGFSFLPPFYGSKS  108



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXL----------PYGETFFHHPTGR  334
            AG CY +I+SFGDSL D GNL+R+ + S++   S+            PYGETFFHHPTGR
Sbjct  32   AGTCYNSIISFGDSLADTGNLLRLDRLSSSSSSSSSSSNTPPHFFLPPYGETFFHHPTGR  91

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS  433
             SDGRL+IDF+A S+G P + PYF GK    RS
Sbjct  92   CSDGRLVIDFIAESLGFPLIRPYFAGKDIRGRS  124



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +2

Query  125  QGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYG  304
            +  A+ Y I  +L  ST   A  C+++I+SFGDSL D GN   +S   N     A  PYG
Sbjct  23   KKMAVAYAIISILVASTAASASQCFESIISFGDSLADTGNFFLLS-PPNKPPYCARPPYG  81

Query  305  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR  430
             TFFH PTGR SDGRL+IDF+A ++GLP VE Y  GK   ++
Sbjct  82   RTFFHLPTGRSSDGRLVIDFIAEALGLPLVESYIAGKNAAEK  123



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTG-----HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             ++ FV+T      +V G C+ +I +FGDSL+D GNL   + +SN    S   PYG+TFF
Sbjct  12   LIIFFVATALSPSTNVLGNCFNSIFNFGDSLSDTGNLFN-NCNSNKPPKSCFTPYGDTFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
             HPTGR+SDGRLIIDF+A S+GLP ++PY G +T
Sbjct  71   RHPTGRFSDGRLIIDFIAQSLGLPLLQPYLGVET  104



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  167  VSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDG  346
            +S+   A GCY +I+SFGDSL D GN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  28   ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  87

Query  347  RLIIDFMALSMGLPFVEPYF---GGKTTGD  427
            RL+IDF+A  +GLPFV PY+   GG++  D
Sbjct  88   RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD  117


 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY++I+SFGDSL D GN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  441  GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  500

Query  371  LSMGLPFVEPYFGGKTTG  424
              +GLP+V PY+G    G
Sbjct  501  ERLGLPYVAPYYGDDGGG  518



>gb|KJB63193.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=399

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +2

Query  143  YYIFLVLFVST--GHVAGGCYKAIVSFGDSLTDXGNLIRMSKS-SNAYVMSAXLPYGETF  313
            + +FLV+ +S+       GC+ +I SFGDSLTD GNL+ +S S S     SA LPYG TF
Sbjct  14   FLMFLVVTISSIINSQVNGCFTSIFSFGDSLTDTGNLLEISLSDSTNPPHSAFLPYGRTF  73

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FHHPTGR+ DGRL+IDF+A ++G  F+ P++G K+
Sbjct  74   FHHPTGRFCDGRLVIDFIAEALGFSFLPPFYGSKS  108



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            T  ++ + L       H    CY++I+SFGDS+ D GNL+ +S   N     A  PYGET
Sbjct  12   TLTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILS-DPNHLPHFALPPYGET  70

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            FFH PTGR+SDGRLIIDF+A S+ LPFV PYFG +   +RSF
Sbjct  71   FFHFPTGRHSDGRLIIDFIAESLDLPFVPPYFGSR---NRSF  109



>ref|XP_010316802.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X3 [Solanum 
lycopersicum]
Length=313

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +IFLVL  +   + G C+ +I+SFGDSL D GN + +S +       +  PYGETFFHHP
Sbjct  13   FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            TGR+SDGRL+IDF+A S+GLP V  Y  GK
Sbjct  72   TGRFSDGRLVIDFIAESLGLPLVPAYLEGK  101



>ref|XP_010316801.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Solanum 
lycopersicum]
Length=328

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +IFLVL  +   + G C+ +I+SFGDSL D GN + +S +       +  PYGETFFHHP
Sbjct  13   FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            TGR+SDGRL+IDF+A S+GLP V  Y  GK
Sbjct  72   TGRFSDGRLVIDFIAESLGLPLVPAYLEGK  101



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR+SDG LIIDF+A  
Sbjct  36   FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAEF  94

Query  377  MGLPFVEPYFGGKTTG  424
            +GLP+V PYFG K   
Sbjct  95   LGLPYVPPYFGSKNEN  110



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +++I+SFGDS+ D GNL+ +S  +N   MSA  PYGETFFHHPTGR+SDG LIIDF+A  
Sbjct  36   FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAEF  94

Query  377  MGLPFVEPYFGGKTTG  424
            +GLP+V PYFG K   
Sbjct  95   LGLPYVPPYFGSKNEN  110



>ref|NP_001031103.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31000.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=298

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            ++  ++F  LFV+       C  +K+I+SFGDS+ D GNL+ +S   N   ++A  PYGE
Sbjct  6    SLVIFLFSTLFVTIVSSETPCPNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F
Sbjct  65   TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNF  104



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +2

Query  167  VSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDG  346
             ST   AG CYK+I+SFGDS+ D GNL+R+  S+     S   PYGE+FFH PTGR+S+G
Sbjct  26   TSTRASAGICYKSIISFGDSIADTGNLLRLCPSNYPPHFSLP-PYGESFFHRPTGRFSNG  84

Query  347  RLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            RL+IDF A S GLP + PY  G+    R F
Sbjct  85   RLVIDFFAESFGLPLIPPYLAGEDARGRDF  114



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +IFLVL  +   + G C+ +I+SFGDSL D GN + +S +       +  PYGETFFHHP
Sbjct  13   FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            TGR+SDGRL+IDF+A S+GLP V  Y  GK
Sbjct  72   TGRFSDGRLVIDFIAESLGLPLVPAYLEGK  101



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +2

Query  137  ITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYG  304
            I+ ++FL    V+ V++       YK+I+SFGDS+ D GN +R+S   N    +A LPYG
Sbjct  9    ISTFLFLLSSTVIMVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLPQAAFLPYG  67

Query  305  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            ETFF  P+GRYSDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  68   ETFFQPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV  106



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            ++  ++F  LFV+       C  +K+I+SFGDS+ D GNL+ +S   N   ++A  PYGE
Sbjct  6    SLVIFLFSTLFVTIVSSETPCPNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F
Sbjct  65   TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNF  104



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            ++  ++F  LFV+       C  +K+I+SFGDS+ D GNL+ +S   N   ++A  PYGE
Sbjct  6    SLVIFLFSTLFVTIVSSETPCRNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F
Sbjct  65   TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNF  104



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +2

Query  137  ITYYIFL-VLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            I   +FL  L V+T      C  +++I+SFG+S+ D GNL+ +S   N   +S   PYGE
Sbjct  12   IISLVFLSTLLVTTVSSVSQCRNFESIISFGNSIGDTGNLLGLSDDPNNLALSGYPPYGE  71

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            TFFH PTGR+SDGRLIIDF+   +GLP+V PYFG K 
Sbjct  72   TFFHQPTGRFSDGRLIIDFITEFLGLPYVPPYFGSKN  108



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            A TY+ F+    S       CY AI SFGDSL D GN +  S +++  V  A LPYGET+
Sbjct  29   ATTYHPFISKNTSP---TTSCYTAIFSFGDSLADTGNFLHYSGNNSGPV--AQLPYGETY  83

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            FH  TGR+SDGRLIIDF+A +MGLP V PY  GK + D
Sbjct  84   FHRATGRFSDGRLIIDFIAQAMGLPLVPPYLAGKHSQD  121



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            I YY  +V+  S        YK+I+SFGDS+ D GN + +S  +N    +A LPYGE+FF
Sbjct  17   ILYYTTIVVASSESRCRR--YKSIISFGDSIADTGNYVHLSNVNNL-PQAAFLPYGESFF  73

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GRYSDGRL+IDF+A  +GLP+V PYFG +  
Sbjct  74   HPPSGRYSDGRLVIDFIAEFLGLPYVPPYFGSQNV  108



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GN I +S   N    +A LPYGETFF  P+GRYSDGRLIIDF+A  
Sbjct  34   FKSIISFGDSIADTGNYIHLSSDVNHPPQAAFLPYGETFFRSPSGRYSDGRLIIDFIAEF  93

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYFG +  
Sbjct  94   LGLPYVPPYFGSQNV  108



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            FL+  V T       +K+I+SFGDS+TD GNL+ +S S N    SA  PYGETFFHHP+G
Sbjct  17   FLITVV-TSQTRCRNFKSIISFGDSITDTGNLLGLS-SPNDLPESAFPPYGETFFHHPSG  74

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            R+SDGRLIIDF+A  +G+P V P++G K 
Sbjct  75   RFSDGRLIIDFIAEFLGIPHVPPFYGSKN  103



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +  +I   L V++ +    C  +K+I+SFGDS+ D GNL+ +S   N    SA  PYGET
Sbjct  12   LVRFILSTLLVTSVNSQTQCRNFKSIISFGDSIADTGNLLGLS-DPNDLPASAFPPYGET  70

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            FFHHPTGRYSDGRLIIDF+A  +G P V P++G +   
Sbjct  71   FFHHPTGRYSDGRLIIDFIAEFLGFPLVPPFYGCQNAN  108



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            FL+  V T       +K+I+SFGDS+TD GNL+ +S S N    SA  PYGETFFHHP+G
Sbjct  13   FLITVV-TSQTRCRNFKSIISFGDSITDTGNLLGLS-SPNDLPESAFPPYGETFFHHPSG  70

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            R+SDGRLIIDF+A  +G+P V P++G K 
Sbjct  71   RFSDGRLIIDFIAEFLGIPHVPPFYGSKN  99



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = +2

Query  119  FSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVM  283
            F Q  A      L+L+ +T  VA     C  YK+I+SFGDS+ D GN +R+S   N    
Sbjct  655  FYQEPAKYVSFLLILYSTTIVVASSESRCRRYKSIISFGDSIADTGNYLRLSNVKNL-PQ  713

Query  284  SAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            +A LPYGE+FFH P+GRYSDGRL+IDF+A  +GLP+V PYFG +  
Sbjct  714  AAFLPYGESFFHPPSGRYSDGRLVIDFIAEFLGLPYVPPYFGSQNV  759


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    +A LPYGE+FF
Sbjct  13   LLVLYYTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQTAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  72   HLPSGRASDGRLIIDFIAEFLGLPYVMPYFGSQNV  106


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL++  ST  VA     C  +K+I+SFGDS+ D GN + +S   N    +A  PYGE+FF
Sbjct  395  FLLVLYSTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQTAFFPYGESFF  453

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  454  HPPSGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV  488


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +2

Query  212   SFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPF  391
             +FGDS  D GN + +S   N    SA LPYGETFFH P+GRYSDGRLIIDF+A  +GLP+
Sbjct  1040  NFGDSSADTGNYLHLS-DVNHLPQSAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPY  1098

Query  392   VEPYFGGKTT  421
             V  YFG +  
Sbjct  1099  VPYYFGSQNV  1108



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +++++F  L V+T +    C  +K+I+SFGDS+ D GNL+ +S   N     A  PYGET
Sbjct  10   VSFFLF-TLLVTTVYSESQCRNFKSIISFGDSIADTGNLVGLS-DPNDLPHVAFPPYGET  67

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFG  409
            FFHHPTGR+S+GRL+IDFMA  +GLP V P++G
Sbjct  68   FFHHPTGRFSNGRLVIDFMAEFLGLPLVPPFYG  100


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  284  SAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            +A  PYGETFFH+PTGR+S+GRLIIDF+A  +GLP+V P FG +
Sbjct  388  AAFPPYGETFFHNPTGRFSNGRLIIDFIAEFLGLPYVPPCFGSQ  431



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY++I+SFGDSL D GN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  29   GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  88

Query  371  LSMGLPFVEPYFG  409
              +GLP+V PY+G
Sbjct  89   ERLGLPYVAPYYG  101



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +I +++F  T  V G CY++I SFGDSLTD GNL+  S + N     A  PYGETFFH P
Sbjct  5    FILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASPAHN-LPHFAKPPYGETFFHRP  62

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS  433
            TGR SDGRLIIDF+A  +GLP + PY   +TT  R 
Sbjct  63   TGRCSDGRLIIDFIAGFLGLPLIHPYL--ETTDPRQ  96



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            YK+I+SFGDS+ D GN + +S  +N    +A LPYGE+FFH P+GRYSDGRL+IDF+A  
Sbjct  3    YKSIISFGDSIADTGNYVHLSNVNNL-PQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEF  61

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYFG +  
Sbjct  62   LGLPYVPPYFGSQNV  76



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY++I+SFGDSL D GN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  29   GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  88

Query  371  LSMGLPFVEPYFG  409
              +GLP+V PY+G
Sbjct  89   ERLGLPYVAPYYG  101



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            AI    FL L  S    AG CYK+I+ FGDSLTD GNL+++    N        PYGETF
Sbjct  15   AILVLSFLKLSTSARASAGSCYKSIIGFGDSLTDTGNLVQLFPPDNP-THCYRPPYGETF  73

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            F HPTGR  DGRLIIDF+A S GLP V  Y     + D
Sbjct  74   FKHPTGRCCDGRLIIDFIAESFGLPLVPAYLWRDESTD  111



>gb|EYU28061.1| hypothetical protein MIMGU_mgv11b014990mg [Erythranthe guttata]
Length=451

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY++I+SFGDSL D GN++ +S S +        PYG TFFH PTGR+SDGRL+IDF+A
Sbjct  30   GCYESIISFGDSLADTGNVLLLSPS-DKKPHGGLPPYGRTFFHRPTGRFSDGRLVIDFIA  88

Query  371  LSMGLPFVEPYFGGKT  418
               GLPFV PY GG++
Sbjct  89   QRFGLPFVPPYIGGES  104



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            ++  ++F  LFV+       C  +K+I+SFGDS+ D GNL+ +S   N   ++A  PYGE
Sbjct  6    SLVIFLFSTLFVTIVSSETPCPNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
            TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F
Sbjct  65   TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNF  104


 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +  +I   L V++ +    C  +K+I+SFGDS+ D GNL+ +S   N    SA  PYGET
Sbjct  432  LVRFILSTLLVTSVNSQTQCRNFKSIISFGDSIADTGNLLGLS-DPNDLPASAFPPYGET  490

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            FFHHPTGRYSDGRLIIDF+A  +G P V P++G +   
Sbjct  491  FFHHPTGRYSDGRLIIDFIAEFLGFPLVPPFYGCQNAN  528



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +F+++ +         +++I+SFGDS+ D GNL+ +S  +N   ++   PYGETFFHHPT
Sbjct  20   LFIMITMVNTESQRQNFQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPT  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            GR SDGRLIIDF+A  +GLP+V PYFG K 
Sbjct  79   GRSSDGRLIIDFIAEFLGLPYVTPYFGSKN  108



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +F+++ +         +++I+SFGDS+ D GNL+ +S  +N   ++   PYGETFFHHPT
Sbjct  20   LFIMITMVKSESQCQNFQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPT  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            GR SDGRLIIDF+A  +GLP+V PYFG K 
Sbjct  79   GRSSDGRLIIDFIAEFLGLPYVTPYFGSKN  108



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +++I+SFGDS+ D GNL+ +S  +N   ++   PYGETFFHHPTGR SDGRLIIDF+A  
Sbjct  36   FQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEF  94

Query  377  MGLPFVEPYFGGKT  418
            +GLP+V PYFG K 
Sbjct  95   LGLPYVTPYFGSKN  108



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  TYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            T +I + +  S        ++ I+SFGDS+ D GNL+ +S  +N   ++   PYGETFFH
Sbjct  19   TLFIMITMVNSESQCQN--FEYIISFGDSIADTGNLLCLSDRNN-LSLNGFPPYGETFFH  75

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            HPTGR SDGRLIIDF+A  +GLP+V PYFG K 
Sbjct  76   HPTGRSSDGRLIIDFIAEFLGLPYVTPYFGSKN  108



>emb|CDX94633.1| BnaC07g10250D [Brassica napus]
Length=396

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +FL +  S  H     +K+I+SFGDS  D GNLI +S   +    +A  PYGETFFHHPT
Sbjct  21   LFLTIVNSEAHCRN--FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHPT  77

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            GR+S+GRLIIDF+A  +GLPFV P++G + 
Sbjct  78   GRFSNGRLIIDFIAEFLGLPFVPPFYGSQN  107



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 3/93 (3%)
 Frame = +2

Query  140  TYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            T +I + +  S        ++ I+SFGDS+ D GNL+ +S  +N   ++   PYGETFFH
Sbjct  19   TLFIMITMVNSESQCQN--FEYIISFGDSIADTGNLLCLSDRNN-LSLNGFPPYGETFFH  75

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            HPTGR SDGRLIIDF+A  +GLP+V PYFG K 
Sbjct  76   HPTGRSSDGRLIIDFIAEFLGLPYVTPYFGSKN  108



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +++++  +L V+T      C  +++I+SFGDS+ D GNLI +S S N    SA  PYGET
Sbjct  15   VSFFLSTLLVVTTVRSETKCRSFESIISFGDSIADTGNLIGLS-SPNQLPESAFPPYGET  73

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FFHHPTGR+SDGRL+IDF+A  +G P V P++G K 
Sbjct  74   FFHHPTGRFSDGRLVIDFIAEFLGFPHVPPFYGSKN  109


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFFHHPTGR+S+GRL+IDF+A  
Sbjct  396  FKSIISFGDSIADTGNLVGLS-DPNDLPHVAFPPYGETFFHHPTGRFSNGRLVIDFIAEF  454

Query  377  MGLPFVEPYFGGKT  418
            +GLP V P++G + 
Sbjct  455  LGLPLVPPFYGSQN  468



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            +  GCY AI SFGDSL D GN +     S+ +      PYGETFFHHPTGRYSDGR+++D
Sbjct  38   LVAGCYSAIFSFGDSLADTGNRLH----SHRFDPVGRFPYGETFFHHPTGRYSDGRVMLD  93

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A ++GLP V+PY  G   G+
Sbjct  94   FIAQAIGLPMVQPYLAGTHDGE  115



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +2

Query  146  YIFLVLFVSTGHV-----AGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYG  304
            ++ L  F+ST  V       GC  +K+I+SFGDS+TD GNL+ +S S N    SA  PYG
Sbjct  7    HMLLSFFISTLLVTIVTSQTGCRNFKSIISFGDSITDTGNLLGLS-SPNDLPESAFPPYG  65

Query  305  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            ETFFH+P+GR+SDGRLIIDF+A  +G+P V P++G K 
Sbjct  66   ETFFHYPSGRFSDGRLIIDFIAEFLGIPHVPPFYGSKN  103



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            ++   L V++ +    C  +K+I+SFGDS+ D GNL+ +S  +N    SA  PYGETFFH
Sbjct  434  FLLSTLLVTSANSQTQCRNFKSIISFGDSIADTGNLLGLSDPNN-LPASAFPPYGETFFH  492

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            HPTGRYSDGRLIIDF+A  +G P V P++G +   
Sbjct  493  HPTGRYSDGRLIIDFIAEFLGFPLVHPFYGCQNAN  527


 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +2

Query  134  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            A+  +++  L V+       C  +K+I+SFGDS+ D GNL+ +S  +N  V +A  PYGE
Sbjct  6    ALLTFLYSTLLVTIVSSETPCQNFKSIISFGDSIADTGNLVGLSNRNNLPV-TAFPPYGE  64

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K 
Sbjct  65   TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSKN  101



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVST-----GHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            F++ FV+T      +V   C+ +I +FGDSL+D GNL     S+N        PYG+TFF
Sbjct  13   FIIFFVATPFSPSTNVLANCFNSIFNFGDSLSDTGNLFINCNSNNPPNF-CFTPYGDTFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H PTGR+SDGRLIIDF+A S+G+P ++PY G +T
Sbjct  72   HRPTGRFSDGRLIIDFIAQSLGIPLLQPYLGVET  105



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = +2

Query  140  TYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            T +  + L  ++      C  +K+I+SFGDS+TD GNL+ +S  +N    +A  PYGETF
Sbjct  14   TLFFLIALLTTSVSSEQQCRKFKSIISFGDSITDTGNLLGLS-DANDLPQAAFPPYGETF  72

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FH PTGR+S+GRLIIDF+A  +GLP+V PYFG + 
Sbjct  73   FHVPTGRFSNGRLIIDFIAEFLGLPYVPPYFGSQN  107



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 4/81 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I SFGDSL D GNL+  S S+NA  + A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31   CYTSIFSFGDSLADTGNLL-YSPSNNAGAI-ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
             +G+P V PY  G   GD  F
Sbjct  89   GIGIPLVPPYLAGP--GDHGF  107



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = +2

Query  137  ITYYIFLVLF-VSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGE  307
            +++++ L  F ++T +    C  +K+I+SFGDS+ D GNL+ +S  +N   + A LPYGE
Sbjct  9    VSFFLILSTFCLTTVNSEPQCHNFKSIISFGDSIADTGNLLALSDPTNLPKV-AFLPYGE  67

Query  308  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            TFFHHPTGR+S+GRLIIDF+A  +G P V P++G +   
Sbjct  68   TFFHHPTGRFSNGRLIIDFIAEFLGFPLVPPFYGSQNAN  106



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  173  TGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRL  352
            T H A  CY +I SFGDSL D GNL+     +N +V    LPYGET+F  PTGR+SDGRL
Sbjct  25   TSHAAITCYTSIFSFGDSLADTGNLLHDVGKNNIHV--GRLPYGETYFRRPTGRFSDGRL  82

Query  353  IIDFMALSMGLPFVEPYFGG  412
            ++DF+A +MGLP + PY  G
Sbjct  83   VVDFLAQAMGLPLLPPYLAG  102



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSK-SSNAYVMSAXLPYGETFFHHPT  328
              V+ VS      GC+ +I SFGDSLTD GNL+ +S   SN    SA  P G TFFHHP+
Sbjct  19   LFVIIVSIIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPS  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            GR  DGRL+IDF+A ++G+PF++P +  K
Sbjct  79   GRRCDGRLVIDFLAEALGIPFLQPSYTTK  107



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I+SFGDSL D GN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
             +G+P V PY  G   GD  F
Sbjct  89   DIGIPLVPPYLEGP--GDHGF  107



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I+SFGDSL D GN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
             +G+P V PY  G   GD  F
Sbjct  89   DIGIPLVPPYLEGP--GDHGF  107



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I+SFGDSL D GN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31   CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
             +G+P V PY  G   GD  F
Sbjct  89   DIGIPLVPPYLEGP--GDHGF  107



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = +2

Query  116  AFSQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLI----RMSKSSNAYVM  283
            A  +  +  + I +VL ++   +A  CY +I +FGDSL+D GN I    +M   ++    
Sbjct  2    ALLKTVSFCFAILVVLLLTPLQIASACYTSIYAFGDSLSDAGNYIHIYQQMFPGTHKLPR  61

Query  284  SAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSF  436
             A  PYGET+FHHPTGR SDGR IIDFMA   GLP + PY  G      +F
Sbjct  62   YASPPYGETYFHHPTGRTSDGRTIIDFMAEYYGLPLIPPYIRGVNQSSSNF  112



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  155  LVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            L   VS+     G +K+I+SFGDS+TD GNL+ +S + N    SA  PYGETFFH PTGR
Sbjct  22   LTTVVSSQVKQCGKFKSIISFGDSITDTGNLLALSDADNP-PHSAFPPYGETFFHFPTGR  80

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            YS+GRLIIDF+A  +GLP++ P+ G + 
Sbjct  81   YSNGRLIIDFIAEFLGLPYLPPFHGSQN  108



>emb|CDY63997.1| BnaA07g36510D [Brassica napus]
Length=348

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            YK+I+SFGDS  D GN + +S   N    +A LPYGETFFH P+ RY DGRLIIDF+A  
Sbjct  46   YKSIISFGDSSADTGNFLSLSYDINHPPQAAFLPYGETFFHPPSRRYFDGRLIIDFIAEF  105

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYFG K+ 
Sbjct  106  LGLPYVPPYFGSKSV  120



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++FLVL  +  ++ G C+ +I+SFGDSL D GN + ++ +       +  PYGETFFHHP
Sbjct  13   FLFLVLNHNFQNIEG-CFDSIISFGDSLADTGNKLHITLNKIPPSHFSLPPYGETFFHHP  71

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            TGR+SDGRL+IDF+A S GLP V  Y  GK
Sbjct  72   TGRFSDGRLVIDFIAESFGLPLVPAYLEGK  101



>ref|NP_564313.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAK50088.1|AF372948_1 At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AAM91420.1| At1g28610/F1K23_5 [Arabidopsis thaliana]
 gb|AEE31001.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=250

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFV+       C   ++I+SFGDS+TD GNL+ +S   N   ++A LPYGETFFHHPTGR
Sbjct  15   LFVTIVSSQTQCRNLESIISFGDSITDTGNLVGLS-DRNHLPVTAFLPYGETFFHHPTGR  73

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKT  418
              +GR+IIDF+A  +GLP V P++G K 
Sbjct  74   SCNGRIIIDFIAEFLGLPHVPPFYGSKN  101



>gb|KJB62807.1| hypothetical protein B456_009G437300 [Gossypium raimondii]
Length=401

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSK-SSNAYVMSAXLPYGETFFHHPT  328
              V+ +S+     GC+ +I SFGDSLTD GNL+ +S   SN    SA  P G TFFHHP+
Sbjct  19   LFVIMISSIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPS  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            GR  DGRL+IDF+A ++G+PF+ P +  K
Sbjct  79   GRRCDGRLVIDFLAEALGIPFLRPSYTTK  107



>ref|XP_004958488.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=398

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +2

Query  188  GGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFM  367
            GGCYK   +FGDSL D GN I  S +      S   PYGETFFH PTGR+SDGRLI+DF+
Sbjct  47   GGCYKRFFAFGDSLIDTGNFIHYSTAPGPVARS---PYGETFFHRPTGRWSDGRLIVDFV  103

Query  368  ALSMGLPFVEPYFGGKTTGD  427
               +G P+  PY  GKT  D
Sbjct  104  VERLGFPYWTPYLAGKTKED  123



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 4/99 (4%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            +  +I +++F  T  V G CY++I SFGDSLTD GNL+  S + N     A  PYGETFF
Sbjct  2    VWRFILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASPAHN-LPHFAKPPYGETFF  59

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS  433
            H PTGR SDGRLIIDF+A  +GLP + PY   +TT  R 
Sbjct  60   HRPTGRCSDGRLIIDFIAGFLGLPLIHPYL--ETTDPRQ  96


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y++I SFGDSL D GN   +   + A+ +   LPYGETFF H TGR SDGRLI+DF+A +
Sbjct  372  YESIFSFGDSLADTGNF--LLSGALAFPVIRELPYGETFFRHATGRCSDGRLIVDFIAEA  429

Query  377  MGLPFVEPYF  406
             G+P++ PY 
Sbjct  430  FGIPYLPPYL  439



>ref|NP_001043722.1| Os01g0650000 [Oryza sativa Japonica Group]
 dbj|BAF05636.1| Os01g0650000, partial [Oryza sativa Japonica Group]
Length=176

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            +A  CY  + SFGDSLTD GN I     +++   +   PYGETFFH  TGR S+GRLIID
Sbjct  33   LAAPCYPRVFSFGDSLTDTGN-IAFLYGNDSRRPTLWPPYGETFFHRATGRASNGRLIID  91

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A ++GLPFV PY+ G+T GD
Sbjct  92   FIADALGLPFVRPYWSGRTAGD  113



>gb|AAF24544.2|AC007508_7 F1K23.13 [Arabidopsis thaliana]
Length=1411

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            YK+I+SFGDS+ D GN + +S  +N    +A LPYGE+FFH P+GRYSDGRL+IDF+A  
Sbjct  683  YKSIISFGDSIADTGNYVHLSNVNNL-PQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEF  741

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYFG +  
Sbjct  742  LGLPYVPPYFGSQNV  756


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152   FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
              LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    SA LPYGE+FF
Sbjct  1034  LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQSAFLPYGESFF  1092

Query  317   HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
             H P+GRYSDGRLIIDF+A  +GLP+V  YFG +  
Sbjct  1093  HPPSGRYSDGRLIIDFIAEFLGLPYVPSYFGSQNV  1127


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    SA LPYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQSAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GR S+GRLIIDF+A  +GLP+V PYFG +  
Sbjct  72   HPPSGRASNGRLIIDFIAEFLGLPYVPPYFGSQNV  106


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +2

Query  230  TDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFG  409
            +D GN++ +S   N    +A  PYGE+FFH P+GR SDGRLIIDF+A  +GLP+V PYFG
Sbjct  379  SDTGNILHLS-DVNHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPYVPPYFG  437

Query  410  GKTT  421
             +  
Sbjct  438  SQNV  441



>ref|XP_010912621.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Elaeis guineensis]
Length=175

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 6/81 (7%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I SFGDS+TD GN +  +         A LPYG+T+FHHPTGR+SDGR+IIDF+A 
Sbjct  30   CYTSIFSFGDSITDTGNFLNYTNCG----PEARLPYGKTYFHHPTGRFSDGRIIIDFIAQ  85

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
            ++G+P V PY  G   GD  F
Sbjct  86   AIGVPLVPPYLAGP--GDHGF  104



>gb|EYU28066.1| hypothetical protein MIMGU_mgv1a009376mg [Erythranthe guttata]
Length=344

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
             C+K+I+SFGDS+ D GNL+ +S  SN     A  PYGET+FH PTGR+SDGRLIIDF+A
Sbjct  34   ACFKSIISFGDSIADTGNLLHLSPPSNPPPNFASPPYGETYFHLPTGRFSDGRLIIDFIA  93

Query  371  LSMGLPFVEPYF-GGKTTGDRSFA  439
              + LPF  P+  GG  +G  +FA
Sbjct  94   EELALPFTPPFHSGGNVSGGVNFA  117



>gb|KJB62806.1| hypothetical protein B456_009G437200 [Gossypium raimondii]
Length=399

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKS-SNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
              GC+ +I SFGDSLTD GNL+ +S S S     SA LPYG TFFH PTGR+ DGRL+ID
Sbjct  30   VNGCFTSIFSFGDSLTDTGNLLELSISESTKPPHSAFLPYGCTFFHRPTGRFCDGRLVID  89

Query  362  FMALSMGLPFVEPYFGGKTTGDRSF  436
            F+A ++G  F+ P++G K+     F
Sbjct  90   FLAEALGFSFLPPFYGSKSGKWEKF  114



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            T+   + F  + V++   +   YK+I+SFGDS+ D GN + +S   N    +A LPYGET
Sbjct  10   TSFLLFFFYTIIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGET  68

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  69   FFSVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV  105



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            T+I  + F  + V++   +   YK+I+SFGDS+ D GN + +    N    +A LPYGET
Sbjct  10   TSILLFFFYTIIVASSEPSCRLYKSIISFGDSIADTGNYLHLF-DVNHPPQAAFLPYGET  68

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  69   FFSVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV  105



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMS--KSSNAYVMSAXLPYGETFFHHPTGRYSDGRLII  358
            A GCY +I+SFGDS++D GNL   S  KS N +      PYGET+FHHPTGR SDGRL+I
Sbjct  478  ALGCYSSIISFGDSVSDTGNLYNSSPNKSFNFFFP----PYGETYFHHPTGRCSDGRLVI  533

Query  359  DFMALSMGLPFVEPYF  406
            DF+A SMGLP V+PY 
Sbjct  534  DFIAESMGLPLVQPYL  549


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY +I+SFGDS+ D GNL   + S N  +     PYGET+FH P GR SDGRLIIDF
Sbjct  18   ALGCYSSIISFGDSIADTGNL--YNSSPNKSLDFFFPPYGETYFHRPVGRCSDGRLIIDF  75

Query  365  MALSMGLPFVEPYF  406
            +A  MGLP V+PY 
Sbjct  76   IAEYMGLPLVQPYL  89



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY +I SFGDS+TD GNL   SK+S+ +      PYGET+FHHPTGR SDGRLIIDF
Sbjct  30   AFGCYSSIFSFGDSITDTGNLYISSKNSSFHFFFP--PYGETYFHHPTGRCSDGRLIIDF  87

Query  365  MALSMGLPFVEPYFGGKTTG  424
            +A  +GLP+V PY   K+  
Sbjct  88   IAEFLGLPYVRPYTEVKSNA  107



>ref|XP_007213171.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
 gb|EMJ14370.1| hypothetical protein PRUPE_ppa026981mg, partial [Prunus persica]
Length=310

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GC+ +++SFGDSLTD GNL   S + + +      PYGET+FHHPTGR SDGRLIIDF+A
Sbjct  36   GCFNSVISFGDSLTDTGNLYDSSPNRSLHYFQP--PYGETYFHHPTGRCSDGRLIIDFIA  93

Query  371  LSMGLPFVEPYF  406
              +GLPFV P+ 
Sbjct  94   QFLGLPFVPPFL  105



>emb|CDY15657.1| BnaA07g08280D [Brassica napus]
Length=397

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +2

Query  149  IFLVLFV-STGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +FL + V S  H     +K+I+SFGDS  D GNLI +S   +    +A  PYGETFFHHP
Sbjct  21   LFLTIVVNSETHCRN--FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHP  77

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            TGR+S+GRLIIDF+A  +GLPFV P++G + 
Sbjct  78   TGRFSNGRLIIDFIAEFLGLPFVPPFYGSQN  108



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 5/90 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAG--GC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            FL+  ++T  V     C  +K+I+ FGDS+TD GNL+ +S+ +N    SA  PYGETFFH
Sbjct  16   FLITLLTTAAVTSEQQCRNFKSIIIFGDSITDTGNLLHLSEPNN-LPQSAFPPYGETFFH  74

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFG  409
             PTGR+S+GRLIIDF+A  + LP+V PYFG
Sbjct  75   VPTGRFSNGRLIIDFIAEFLRLPYVPPYFG  104



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            T+   + F  + V++   +   YK+I+SFGDS+ D GN + +S   N    +A LPYGET
Sbjct  10   TSFLLFFFYTIIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGET  68

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  69   FFSVPTGRDSDGRLIIDFIAEFLGLPYVPPYFGSQNV  105



>ref|XP_009102894.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
Length=397

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +2

Query  149  IFLVLFV-STGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            +FL + V S  H     +K+I+SFGDS  D GNLI +S   +    +A  PYGETFFHHP
Sbjct  21   LFLTIVVNSETHCRN--FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHP  77

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            TGR+S+GRLIIDF+A  +GLPFV P++G + 
Sbjct  78   TGRFSNGRLIIDFIAEFLGLPFVPPFYGSQN  108



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +2

Query  122  SQGTAITYYIFLVLFVST---GHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAX  292
            S G +   Y+  ++ VS     HV G C+ +++SFGDSLTD GNL   S + + +     
Sbjct  3    SMGWSFQAYLMNLILVSVFIIPHVLG-CFNSVISFGDSLTDTGNLYNSSPNRSLHYFQP-  60

Query  293  LPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYF  406
             PYGET+FHHPTGR SDGRLIIDF+A  +GLP V P+ 
Sbjct  61   -PYGETYFHHPTGRCSDGRLIIDFIAQFLGLPLVPPFL  97



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +F+ + + +       +++I+SFGDS+ D GNL+ +S   N     A  PYGETFFHHPT
Sbjct  27   LFVTVTIVSSETLCRNFESIISFGDSIADTGNLVALS-DHNHLPGPAFPPYGETFFHHPT  85

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            GR  DGR+IIDF+A  +GLP+V PYFG K 
Sbjct  86   GRSCDGRIIIDFIAEFLGLPYVPPYFGSKN  115



>ref|NP_174185.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31008.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    SA LPYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQSAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GRYSDGRLIIDF+A  +GLP+V  YFG +  
Sbjct  72   HPPSGRYSDGRLIIDFIAEFLGLPYVPSYFGSQNV  106



>sp|P0C8Z7.1|GDL91_ARATH RecName: Full=GDSL esterase/lipase At1g28640; AltName: Full=Extracellular 
lipase At1g28640; Flags: Precursor [Arabidopsis 
thaliana]
Length=390

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    SA LPYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQSAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GRYSDGRLIIDF+A  +GLP+V  YFG +  
Sbjct  72   HPPSGRYSDGRLIIDFIAEFLGLPYVPSYFGSQNV  106



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            + Y   +++  S  H     +K+I+SFGDS+ D GN + +S   N    +A LPYGE+FF
Sbjct  15   VLYSTTIIVVSSESHCRR--FKSIISFGDSIADTGNYLHLS-DINHLPQTAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  72   HPPTGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV  106



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GN + +S   N    +A LPYGE+FFH PTGR SDGRLIIDF+A  
Sbjct  33   FKSIISFGDSIADTGNYLHLS-DVNHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAEF  91

Query  377  MGLPFVEPYFGGKT  418
            +GLP+V PYFG + 
Sbjct  92   LGLPYVPPYFGSQN  105



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GN + +S   N    +A LPYGE+FFH PTGR SDGRLIIDF+A  
Sbjct  33   FKSIISFGDSIADTGNYLHLS-DVNHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAEF  91

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYFG +  
Sbjct  92   LGLPYVPPYFGSQNV  106



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +2

Query  161  LFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGR  334
            LFV+       C   ++I+SFGDS+TD GNL+ +S   N   ++A LPYGETFFHHPTGR
Sbjct  15   LFVTIVSSQTQCRNLESIISFGDSITDTGNLVGLS-DRNHLPVTAFLPYGETFFHHPTGR  73

Query  335  YSDGRLIIDFMALSMGLPFVEPYFGGKT  418
              +GR+IIDF+A  +GLP V P++G K 
Sbjct  74   SCNGRIIIDFIAEFLGLPHVPPFYGSKN  101



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +2

Query  146  YIFLVLFVSTG---HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            +IFL  F+ T          +++I+SFGDS+ D GNL+ +S  ++   M A  PYGETFF
Sbjct  15   FIFLSTFIVTNVSSETKCREFRSIISFGDSIADTGNLLGLSDPNDLPHM-AFPPYGETFF  73

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            HHPTGR+S+GRLIIDF+A  +GLP V P++G + 
Sbjct  74   HHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSQN  107



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  116  AFSQGTAITYYIFL---VLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMS  286
            AFS    I+ ++F+    + V +   +   YK+I+SFGDS  D GN + +S   N    +
Sbjct  2    AFSLKKLISTFLFIFSSTITVDSSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQA  60

Query  287  AXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            A  PYGETFFH PTGR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  61   AFPPYGETFFHAPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQN  104



>ref|XP_008812182.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=319

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I SFGDSL D GN +  +         A LPYGET+F HPTGR+SDGRLIIDF+A 
Sbjct  31   CYTSIFSFGDSLADTGNFLHYANQGP----EARLPYGETYFQHPTGRFSDGRLIIDFIAQ  86

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
            ++GLP V PY  G   GD  F
Sbjct  87   AIGLPLVPPYLAGP--GDHGF  105



>ref|XP_008777732.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=251

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A  CY +I SFGDSL D GN +  +         A LPYGET+F HPTGR+SDGRLIIDF
Sbjct  76   ATSCYTSIFSFGDSLADTGNFLHYANQGP----EARLPYGETYFQHPTGRFSDGRLIIDF  131

Query  365  MALSMGLPFVEPYFGGKTTGDRSF  436
            +A ++G+P V PY  G   GD  F
Sbjct  132  IAQAIGVPLVPPYLAGP--GDHGF  153



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL+ F  T  VA     C  YK+I+SFGDS+ D GN + +S   N    +A LPYGETFF
Sbjct  12   FLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
              PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  71   SVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV  105



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL+ F  T  VA     C  YK+I+SFGDS+ D GN + +S   N    +A LPYGETFF
Sbjct  12   FLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
              PTGR SDGRLIIDF+A  +GLP+V PYFG +  
Sbjct  71   SVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV  105



>dbj|BAD68800.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAG88304.1| unnamed protein product [Oryza sativa Japonica Group]
Length=222

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGN--LIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            +A  CY  + SFGDSL D GN   +  ++S    +     PYGETFFH  TGR S+GRLI
Sbjct  46   LAAPCYPRVFSFGDSLADTGNGPFLYGNESRRPPLWP---PYGETFFHRATGRASNGRLI  102

Query  356  IDFMALSMGLPFVEPYFGGKTTGD  427
            IDF+A ++GLPF+ PY+GG+TTGD
Sbjct  103  IDFIADALGLPFLRPYWGGRTTGD  126



>ref|XP_004969325.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=399

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY  + SFGDSL D GN   +  +++   +   LPYGETFFH PTGR+SDGR+++DF
Sbjct  32   AAGCYPRVFSFGDSLADTGNYAFVYGNNSNPALR--LPYGETFFHRPTGRFSDGRIVVDF  89

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A ++GLPFV PY  G++  D
Sbjct  90   IADTLGLPFVPPYLSGRSAED  110



>emb|CDP22023.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +2

Query  143  YYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHH  322
            +   + + +     A GCY +I +FGDSLTD GNL+ +S      +    LP GET+FHH
Sbjct  6    FLCLVPILLIIAQSAEGCYTSIFAFGDSLTDNGNLLALSAPR--IIHQGRLPNGETYFHH  63

Query  323  PTGRYSDGRLIIDFMALSMGLPFVEPY  403
            PTGR  DGRLI+DF+A   GLP   PY
Sbjct  64   PTGRCCDGRLIVDFLAQQFGLPIPPPY  90



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNL-IRMSKSSNAYVMSAXLPYGETFFHHP  325
            +FL L  ST  V   CY +I SFGDSL D GNL I  ++    Y   + +PYGET+FH P
Sbjct  17   VFLAL-ASTNQVLS-CYTSIFSFGDSLADTGNLLILQAQEHKPYSRISRVPYGETYFHRP  74

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYF  406
            TGR S+GRL+IDF+A S+GLPF+ P+ 
Sbjct  75   TGRSSNGRLVIDFIAQSLGLPFIPPFL  101



>gb|EEE55086.1| hypothetical protein OsJ_02828 [Oryza sativa Japonica Group]
Length=270

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGN--LIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            +A  CY  + SFGDSL D GN   +  ++S    +     PYGETFFH  TGR S+GRLI
Sbjct  35   LAAPCYPRVFSFGDSLADTGNGPFLYGNESRRPPLWP---PYGETFFHRATGRASNGRLI  91

Query  356  IDFMALSMGLPFVEPYFGGKTTGD  427
            IDF+A ++GLPF+ PY+GG+TTGD
Sbjct  92   IDFIADALGLPFLRPYWGGRTTGD  115



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = +2

Query  140  TYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            T+++  +L          C  +K+I+SFGDS+TD GNL+ +S + N    SA  PYGETF
Sbjct  15   TFFLITLLTTVISSQVQQCRKFKSIISFGDSITDTGNLLGLSDADNL-PHSAFPPYGETF  73

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FH PTGR+S+GRLIIDF+A  +GLP++ P++G + 
Sbjct  74   FHFPTGRFSNGRLIIDFIAEFLGLPYLPPFYGSQN  108



>ref|XP_006651411.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=373

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +2

Query  170  STGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSD  343
            S GH+A GC  +  + S GDS+TD GNL  +S +S        LPYGETFF  PTGR+ D
Sbjct  20   SAGHLAAGCGGFTRMFSLGDSITDAGNLAVISPNSTF----NRLPYGETFFGRPTGRFCD  75

Query  344  GRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            GRLI+DF+A  +GLPF+ P+  GKT  D
Sbjct  76   GRLIVDFLAEELGLPFLTPFLRGKTAED  103



>ref|XP_010480704.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Camelina sativa]
Length=352

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +  +I L   V++ +    C  +K+I+SFGDS+ D GNL+ ++   N    SA  PYGE+
Sbjct  12   LVSFILLAFLVTSLNAQMQCKNFKSIISFGDSIADTGNLLSLA-DPNDLPGSAFPPYGES  70

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            F  HPTGR+SDGRLIIDF+A  +GLP V P++G +
Sbjct  71   FLKHPTGRFSDGRLIIDFIAEFLGLPLVPPFYGSQ  105



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            F+V +VS+       +K+I+SFGDSL D GNL+ +S   N     A  PYGETFFHHPTG
Sbjct  428  FMVTYVSS-ETQCREFKSIISFGDSLADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTG  485

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            R+S+GRLIIDF+A  +GLP V P++G +
Sbjct  486  RFSNGRLIIDFIAEFLGLPLVPPFYGSQ  513


 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 3/92 (3%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            +I L   V+  +    C  +++I+SFGDS+ D  NL+ +S   N    SA  PYGE+F +
Sbjct  15   FIILAFLVTNLNSQTQCKNFRSIISFGDSIADTENLLSLS-DPNDLPGSAFPPYGESFLN  73

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            HPTGR+SDGRLIIDF+A  + LP V P++G +
Sbjct  74   HPTGRFSDGRLIIDFIAEFLDLPLVPPFYGSQ  105



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL++F ST  V      C  YK+I+SFGDS  D GN + +S   N    +A  PYGETFF
Sbjct  12   FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H PTGR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  71   HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQN  104



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAG--GC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            FL+  ++T  V     C  +K+I+ FGDS+TD GNL+ +S  +N    SA  PYGETFFH
Sbjct  16   FLITLLTTAAVTSEQQCRNFKSIIIFGDSITDTGNLLHLSDLNN-LPQSAFPPYGETFFH  74

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFG  409
             PTGR+S+GRLIIDF+A  + LP+V PYFG
Sbjct  75   VPTGRFSNGRLIIDFIAEFLRLPYVPPYFG  104



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL++F ST  V      C  YK+I+SFGDS  D GN + +S   N    +A  PYGETFF
Sbjct  12   FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H PTGR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  71   HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQN  104



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL++F ST  V      C  YK+I+SFGDS  D GN + +S   N    +A  PYGETFF
Sbjct  12   FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H PTGR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  71   HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQN  104



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GC+ +++SFGDSLTD GNL   S + + +      PYGET+FHHPTGR SDGRLIIDF+A
Sbjct  28   GCFNSVISFGDSLTDTGNLYNSSPNRSLHYFQP--PYGETYFHHPTGRCSDGRLIIDFIA  85

Query  371  LSMGLPFVEPYF  406
              +GLP V P+ 
Sbjct  86   QFLGLPLVPPFL  97



>ref|XP_009102895.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=382

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +FL+  V++       +K+I+SFGDS+ D GNL+ +S  +N   + A  PYGETFFHHPT
Sbjct  21   LFLLTVVNSETTCRN-FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPT  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            GR+S+GRLIIDF+A  +G P V P++G +   
Sbjct  79   GRFSNGRLIIDFIAEFLGFPLVPPFYGSQNAN  110



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 6/95 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C  +K+I+SFGDS+ D GN + +S   N    SA LPYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQSAFLPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            H P+GR S+GRLIIDF+A  +GLP+V PYFG +  
Sbjct  72   HPPSGRASNGRLIIDFIAEFLGLPYVPPYFGSQNV  106



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +2

Query  179  HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLII  358
              +GGCY AI SFGDSL D GN IR+              YG TFF+ PTGR+SDGRLI+
Sbjct  25   RASGGCYSAIFSFGDSLADTGNAIRLGGLGGPTGTPP---YGRTFFNRPTGRFSDGRLIV  81

Query  359  DFMALSMGLPFVEPYFGGKTTGD  427
            DF+A  +GLP + PY GG ++ D
Sbjct  82   DFIAQGLGLPLLRPYLGGGSSED  104



>gb|EEE55085.1| hypothetical protein OsJ_02827 [Oryza sativa Japonica Group]
Length=398

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            +A  CY  + SFGDSLTD GN I     +++   +   PYGETFFH  TGR S+GRLIID
Sbjct  35   LAAPCYPRVFSFGDSLTDTGN-IAFLYGNDSRRPTLWPPYGETFFHRATGRASNGRLIID  93

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A ++GLPFV PY+ G+T GD
Sbjct  94   FIADALGLPFVRPYWSGRTAGD  115



>gb|AAX59709.1| lipase 1 [Brassica napus]
Length=373

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +FL+  V++       +K+I+SFGDS+ D GNL+ +S  +N   + A  PYGETFFHHPT
Sbjct  12   LFLLTVVNSETTCRN-FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPT  69

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            GR+S+GRLIIDF+A  +G P V P++G + 
Sbjct  70   GRFSNGRLIIDFIAEFLGFPLVPPFYGSQN  99



>emb|CDY15658.1| BnaA07g08290D [Brassica napus]
Length=386

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +FL+  V++       +K+I+SFGDS+ D GNL+ +S  +N   + A  PYGETFFHHPT
Sbjct  21   LFLLTVVNSETTCRN-FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPT  78

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            GR+S+GRLIIDF+A  +G P V P++G +   
Sbjct  79   GRFSNGRLIIDFIAEFLGFPLVPPFYGSQNAN  110



>ref|NP_001043721.1| Os01g0649900 [Oryza sativa Japonica Group]
 dbj|BAB89190.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05635.1| Os01g0649900 [Oryza sativa Japonica Group]
 gb|EAY75183.1| hypothetical protein OsI_03073 [Oryza sativa Indica Group]
 gb|EAZ12905.1| hypothetical protein OsJ_02826 [Oryza sativa Japonica Group]
Length=400

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  +  FGDSLTD GN I     +++   S   PYGETFFH  TGR S+GRLIIDF+A 
Sbjct  34   CYPRVFCFGDSLTDTGN-IAFLYGNDSRRPSLWPPYGETFFHRATGRSSNGRLIIDFIAE  92

Query  374  SMGLPFVEPYFGGKTTGD  427
            +MGLPFV PY+GG+T G+
Sbjct  93   AMGLPFVRPYWGGQTAGN  110



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  53   FKSIISFGDSIADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTGRFSNGRLIIDFIADF  111

Query  377  MGLPFVEPYFGGKTTG  424
            +GLP V P++G +   
Sbjct  112  LGLPLVPPFYGSQNAN  127



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            F+V +VS+       +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFFHHPTG
Sbjct  430  FIVTYVSS-ETQCREFKSIISFGDSIADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTG  487

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            R+S+GRLIIDF+A  +GLP V P++G +
Sbjct  488  RFSNGRLIIDFLAEFLGLPLVPPFYGSQ  515


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            ++ L   V+  +    C  +++I+SFGDS+ D GNL+ ++  S+    SA  PYG++F +
Sbjct  15   FVILAFLVANLNSQTQCKNFRSIISFGDSIADTGNLLSLADPSD-LPGSAFPPYGKSFLN  73

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYF  406
            HPTGR+SDGRLIIDF+A  +GLP V P++
Sbjct  74   HPTGRFSDGRLIIDFIAEFLGLPLVPPFY  102



>dbj|BAC41872.1| unknown protein [Arabidopsis thaliana]
Length=245

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---CYK--AIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C +  +I+SFGDS+ D GN++ +S   N    +A  PYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLS-DVNHLPQTAFFPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H P+GR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  72   HPPSGRASDGRLIIDFIAEFLGLPYVPPYFGSQN  105



>emb|CDM83549.1| unnamed protein product [Triticum aestivum]
Length=389

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDSL D GNL+ +   +++Y  +  LPYGET+FH  TGR S+GRLIIDF+A 
Sbjct  24   CYPRVFSFGDSLADTGNLLYL-YGNDSYEAATRLPYGETYFHKATGRSSNGRLIIDFIAE  82

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLPFV PY  G++  D
Sbjct  83   ALGLPFVPPYMSGRSAED  100



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY +I +FGDSL+D GNL       N   +    PYGETFFH PTGR+SDGRL++DF+A
Sbjct  22   GCYTSIFNFGDSLSDTGNLYYTCSFPNPPNV-CFFPYGETFFHRPTGRFSDGRLVLDFLA  80

Query  371  LSMGLPFVEPYFG  409
            +S+GLP V+PY G
Sbjct  81   MSLGLPPVQPYQG  93



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = +2

Query  146  YIFLVLFVSTG---HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            +IFL  FV T          +K+I+SFGDS+ D GNL+ +S   +   M A  PYGE FF
Sbjct  15   FIFLSTFVVTNVSSETKCREFKSIISFGDSIADTGNLLGLSDPKDLPHM-AFPPYGENFF  73

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFG  409
            HHPTGR+S+GRLIIDF+A  +GLP V P++G
Sbjct  74   HHPTGRFSNGRLIIDFIAEFLGLPLVPPFYG  104



>gb|EMT22154.1| GDSL esterase/lipase [Aegilops tauschii]
Length=387

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDSL D GNL+ +   +++Y  +  LPYGET+FH  TGR S+GRLI+DF+A 
Sbjct  19   CYPRVFSFGDSLADTGNLLYL-YGNDSYEAATRLPYGETYFHRATGRSSNGRLIVDFIAE  77

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLPFV PY  G++  D
Sbjct  78   ALGLPFVPPYLSGRSAED  95



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  122  SQGTAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXL  295
             + + +T  + LV+ VS       C  Y +I SFGDS+ D GNL   S+  + +      
Sbjct  18   QRWSTVTLQLLLVITVSAPLFTAACSSYSSIFSFGDSIADTGNLYLSSQPPSDHCFFP--  75

Query  296  PYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            PYG+T+FHHP+GR SDGRLIIDF+A S+G+P V+PY G K 
Sbjct  76   PYGQTYFHHPSGRCSDGRLIIDFIAESLGIPMVKPYLGIKN  116



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY +I SFGDSL D GN +  S +++  V  A  PYGET+FH  TGR+S+GRL++DF+A 
Sbjct  49   CYTSIFSFGDSLADTGNFLHYSGNNSGPV--AHHPYGETYFHRATGRFSNGRLVVDFIAQ  106

Query  374  SMGLPFVEPYFGGKTTGD  427
            +MGLP V PY  GK + D
Sbjct  107  AMGLPLVPPYLAGKNSQD  124



>ref|NP_001043724.1| Os01g0650200 [Oryza sativa Japonica Group]
 dbj|BAD68799.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05638.1| Os01g0650200 [Oryza sativa Japonica Group]
 dbj|BAG88983.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +2

Query  182  VAGGCYKAIVSFGDSLTDXGN--LIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            +A  CY  + SFGDSL D GN   +  ++S    +     PYGETFFH  TGR S+GRLI
Sbjct  46   LAAPCYPRVFSFGDSLADTGNGPFLYGNESRRPPLWP---PYGETFFHRATGRASNGRLI  102

Query  356  IDFMALSMGLPFVEPYFGGKTTGD  427
            IDF+A ++GLPF+ PY+GG+TTGD
Sbjct  103  IDFIADALGLPFLRPYWGGRTTGD  126



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            YK+I+SFGDS+ D GN +R+S   N   + A LPYG++FFH P+GR SDGRLIIDF+A  
Sbjct  21   YKSIISFGDSIADTGNYLRLSDVKNLPPV-AFLPYGKSFFHPPSGRASDGRLIIDFIAEF  79

Query  377  MGLPFVEPYFGGKTT  421
            +GLP+V PYF  +  
Sbjct  80   LGLPYVPPYFRSQNV  94



>gb|EEC75320.1| hypothetical protein OsI_11693 [Oryza sativa Indica Group]
Length=353

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = +2

Query  188  GGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            GGC  +K + SFGDS+TD GNL  +S    ++     LPYGETFF HPTGR+ DGRLI+D
Sbjct  22   GGCGGFKRMFSFGDSITDAGNLATISPPDASF---NRLPYGETFFGHPTGRFCDGRLIVD  78

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A  +GLPF+ P+   K+  D
Sbjct  79   FLADDLGLPFLTPFLRAKSPED  100



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIR-MSKSSNAYVMSAXLPYGETF  313
            +T Y   +L  +       C+ +I SFGDSL D GNL+  +   + A    A LPYGET+
Sbjct  25   VTLYDTSILRSTFAATTASCFASIFSFGDSLADTGNLLHYLGDDAGAL---AQLPYGETY  81

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            FHH TGR SDGRLIIDF+A + GLP V PY  G +  D
Sbjct  82   FHHATGRLSDGRLIIDFIAQASGLPLVPPYLAGTSAQD  119



>gb|EAY90131.1| hypothetical protein OsI_11697 [Oryza sativa Indica Group]
Length=387

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = +2

Query  188  GGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            GGC  +K + SFGDS+TD GNL  +S    ++     LPYGETFF HPTGR+ DGRLI+D
Sbjct  39   GGCGGFKRMFSFGDSITDAGNLATISPPDASF---NRLPYGETFFGHPTGRFCDGRLIVD  95

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A  +GLPF+ P+   KT  D
Sbjct  96   FLAEGLGLPFLTPFLRAKTPED  117



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            C  +I SFGDSL D GN +  S+ +   +  A LPYGET+FH PTGRY+DGRLIIDF+A 
Sbjct  31   CCTSIFSFGDSLADTGNFLYSSRDNPRAI--ARLPYGETYFHRPTGRYTDGRLIIDFIAQ  88

Query  374  SMGLPFVEPYFGGKTTGDRSF  436
             +G+P V PY  G   GD  F
Sbjct  89   DIGIPLVPPYLEGP--GDHGF  107



>ref|XP_004984286.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=385

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CYK + S GDS+TD GNL   S + N  V++   PYGETFF  PTGR+ DGRLI+DF+A 
Sbjct  39   CYKRLFSLGDSITDAGNL--ASVAPNTSVLA--FPYGETFFRRPTGRFCDGRLIVDFIAE  94

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++ LPF+ P+  GKT  D
Sbjct  95   ALKLPFLTPFLAGKTAAD  112



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +  +I   LF++  +    C   ++I+SFGDS  D GNL+ +S   N +   A  PYGET
Sbjct  440  VVSFILSTLFLTMVNSEPECRNLRSIISFGDSTADTGNLLGLS-DPNDHPQVALPPYGET  498

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FFHHPTGR+S+GRLIIDF+A  +GLP V P++G + 
Sbjct  499  FFHHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSQN  534


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            F+V +VS+       +K+I+SFGDS++D GN + +S  +N     A LPYGETFFHHPTG
Sbjct  20   FVVTYVSS-ETKCREFKSIISFGDSVSDTGNFLGLSDPNNLPHF-AFLPYGETFFHHPTG  77

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            R+S+GRLIIDF+A  + LP V P++G + 
Sbjct  78   RFSNGRLIIDFIAEFLSLPLVPPFYGSQN  106



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +++++  +  ++  +    C  +K+I+SFGDS+ D GNL+ +S   N     A  PYGET
Sbjct  14   LSFFLSTLFLLTVVNSETNCRNFKSIISFGDSIADTGNLLGLS-DPNDLPKVAFPPYGET  72

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            FFHHPTGR+S+GRLIIDF+A  +G P V P++G + 
Sbjct  73   FFHHPTGRFSNGRLIIDFIAEFLGFPLVPPFYGSQN  108



>gb|EAY75181.1| hypothetical protein OsI_03071 [Oryza sativa Indica Group]
Length=406

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDSLTD GN   +   +++   +   PYGETFFH  TGR+SDGRL++DF+A 
Sbjct  42   CYPRLFSFGDSLTDTGNFAFI-YGNDSREPALRPPYGETFFHRATGRFSDGRLVVDFIAD  100

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLPFV PY  G+T GD
Sbjct  101  ALGLPFVRPYLSGRTAGD  118



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            ++ I+SFGDSL D GNLI +S + N    SA  PYGETFFH+P+GR+SDGRL+IDF+A  
Sbjct  31   FEWIISFGDSLADTGNLIGLS-TPNDLPESAFPPYGETFFHYPSGRFSDGRLVIDFIAEF  89

Query  377  MGLPFVEPYFGGKT  418
            +GLP V P++G ++
Sbjct  90   LGLPHVPPFYGSQS  103



>ref|XP_006844514.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
 gb|ERN06189.1| hypothetical protein AMTR_s00016p00146420, partial [Amborella 
trichopoda]
Length=150

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = +2

Query  143  YYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHH  322
            + ++  LF +        Y A+ SFGDSL D GN++ +   S+       LPYGETFFH 
Sbjct  12   FSLYSCLFAAEAESNTSSYAALFSFGDSLADTGNMLSLQGQSSPI---GRLPYGETFFHR  68

Query  323  PTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            PTGR+SDGRL++DF A ++GLP +  Y      GD
Sbjct  69   PTGRFSDGRLVVDFFAQALGLPLLPAYLSTLDGGD  103



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +2

Query  143  YYIFLVLF-VSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            Y + L+L  V    +  GCY +I+ FGDS+TD GNL   +   N  +     PYGET+FH
Sbjct  8    YLMNLILISVIINPLVLGCYNSIIGFGDSITDTGNL--YNSDPNRSLNFFHPPYGETYFH  65

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            HPTGR SDGRL+IDF+A  +GLP V PY   +++  
Sbjct  66   HPTGRCSDGRLVIDFIAEFLGLPLVPPYLESQSSNQ  101



>gb|KCW76155.1| hypothetical protein EUGRSUZ_D00534, partial [Eucalyptus grandis]
Length=362

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY++I +FGDSL+D GN +R   S+  + +    PYG+TFF HPTGRYSDGRLIIDF+A 
Sbjct  21   CYESIFNFGDSLSDTGNYLR---SAGDHAILPTSPYGKTFFGHPTGRYSDGRLIIDFIAE  77

Query  374  SMGLPFVEPYF  406
            ++GLP+++PY 
Sbjct  78   TVGLPYLKPYL  88



>gb|EEE59101.1| hypothetical protein OsJ_10956 [Oryza sativa Japonica Group]
Length=370

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = +2

Query  188  GGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            GGC  +K + SFGDS+TD GNL  +S    ++     LPYGETFF HPTGR+ DGRLI+D
Sbjct  22   GGCGGFKRMFSFGDSITDAGNLATISPPDASF---NRLPYGETFFGHPTGRFCDGRLIVD  78

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A  +GLPF+ P+   K+  D
Sbjct  79   FLADDLGLPFLTPFLRAKSPED  100



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---CYK--AIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C +  +I+SFGDS+ D GN++ +S   N    +A  PYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLS-DVNHLPQTAFFPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H P+GR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  72   HPPSGRASDGRLIIDFIAEFLGLPYVPPYFGSQN  105



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 8/97 (8%)
 Frame = +2

Query  155  LVLFVSTGHVAGGC---YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            LV  V+T   AG C   Y +I SFGDSLTD GNL  +S   +   M    P+G+T FHHP
Sbjct  4    LVFLVTTLVFAGTCRAYYTSIFSFGDSLTDTGNLNFISPPLSPDCMLP--PFGQTHFHHP  61

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG---GKTTGD  427
             GR SDGRLIIDF+A S+GL +V+PY G   G+ TG+
Sbjct  62   NGRCSDGRLIIDFIAESLGLSYVKPYLGFKNGEVTGN  98



>ref|NP_001050175.1| Os03g0365800 [Oryza sativa Japonica Group]
 gb|ABF96124.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12089.1| Os03g0365800 [Oryza sativa Japonica Group]
 dbj|BAG88815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=387

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = +2

Query  188  GGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            GGC  +K + SFGDS+TD GNL  +S    ++     LPYGETFF HPTGR+ DGRLI+D
Sbjct  39   GGCGGFKRMFSFGDSITDAGNLATISPPDASF---NRLPYGETFFGHPTGRFCDGRLIVD  95

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A  +GLPF+ P+   K+  D
Sbjct  96   FLADDLGLPFLTPFLRAKSPED  117



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---CYK--AIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
             LVL+ +T  VA     C +  +I+SFGDS+ D GN++ +S   N    +A  PYGE+FF
Sbjct  13   LLVLYSTTIIVASSESRCRRFTSIISFGDSIADTGNILHLS-DVNHLPQTAFFPYGESFF  71

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H P+GR SDGRLIIDF+A  +GLP+V PYFG + 
Sbjct  72   HPPSGRASDGRLIIDFIAEFLGLPYVPPYFGSQN  105



>ref|XP_006658887.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=385

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY  + +FG+SL D GN I  S +     +S   PYGETFFH PTGR+SDGRLI+DF+ 
Sbjct  37   GCYSHLFTFGNSLIDTGNFIHYSTAPGPVALS---PYGETFFHRPTGRWSDGRLIVDFIV  93

Query  371  LSMGLPFVEPYFGGKTTGD  427
              +G P+  PY  GK+  D
Sbjct  94   ERLGFPYWTPYLAGKSKED  112



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            C+ A+ SFGDSLTD GNL  +       + S  LPYGETFFH PTGR SDGRLI+DF+A 
Sbjct  29   CHTALFSFGDSLTDTGNLKYLEHDQFFDIWS--LPYGETFFHRPTGRCSDGRLIVDFLAQ  86

Query  374  SMGLPFVEPYFGG  412
             +GLP ++PY  G
Sbjct  87   GLGLPMLQPYLSG  99



>gb|EPS71267.1| hypothetical protein M569_03493 [Genlisea aurea]
Length=402

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            FLV   + G  +   Y +I SFGDSL D GN I +S S+  + + A LPYG TFFH PTG
Sbjct  42   FLVTVTAAGAAS---YDSIFSFGDSLADTGNFI-VSGSAVKFPVIAKLPYGMTFFHRPTG  97

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            R SDGRL++DF+A + GLP+V PY  GK 
Sbjct  98   RCSDGRLVLDFIAEAYGLPYVPPYLAGKN  126



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +2

Query  155  LVLFVSTGHVAGGC-YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            L+   +T   +  C Y +I SFGDSL D GNL+R+  ++ ++      PYG T+FHHPTG
Sbjct  17   LLALATTHPTSCSCHYTSIFSFGDSLIDTGNLLRLQHNNASF--ECWFPYGITYFHHPTG  74

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            R SDGRLIIDF+A  +GLPFV PY    + G 
Sbjct  75   RCSDGRLIIDFIAEYLGLPFVPPYLSRGSGGQ  106



>gb|EAY90132.1| hypothetical protein OsI_11698 [Oryza sativa Indica Group]
Length=391

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDS+TD GN +    ++ A    A  PYGETFF HPTGRYSDGRL++DF+A 
Sbjct  46   CYTRMFSFGDSITDTGNQVSFFPTAPA----ARPPYGETFFGHPTGRYSDGRLVVDFLAE  101

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLP++  Y  GKT  D
Sbjct  102  ALGLPYLTAYLRGKTAED  119



>gb|EAZ27028.1| hypothetical protein OsJ_10957 [Oryza sativa Japonica Group]
Length=392

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDS+TD GN +    ++ A    A  PYGETFF HPTGRYSDGRL++DF+A 
Sbjct  47   CYTRMFSFGDSITDTGNQVSFFPTAPA----ARPPYGETFFGHPTGRYSDGRLVVDFLAE  102

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLP++  Y  GKT  D
Sbjct  103  ALGLPYLTAYLRGKTAED  120



>gb|KEH36573.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=342

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 18/113 (16%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F+VL +     A  CY +I SFGDSLTD GNL  +S+  +   +    PYG+T FHHP
Sbjct  12   WLFIVLPLVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCLLP--PYGKTHFHHP  69

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG----------------GKTTGDRSF  436
             GR SDGRLI+DF+A    LP+++PY G                G T  DRSF
Sbjct  70   NGRCSDGRLIVDFIAEFFRLPYLKPYLGFINGGNIEHGVNFAVAGATALDRSF  122



>emb|CDP15060.1| unnamed protein product [Coffea canephora]
Length=384

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I +FGDS TD GN    +   N Y+  +  PYG+TFFHHPT RYSDGRL+IDF+A  
Sbjct  38   FKSIYAFGDSYTDTGN-TNSATGPNPYLYVSRSPYGQTFFHHPTNRYSDGRLVIDFLAQQ  96

Query  377  MGLPFVEPYFGGKTTGDRSF  436
            + LPF+ PY     T D+S+
Sbjct  97   LSLPFLPPYLS--KTADKSY  114



>ref|XP_002274810.1| PREDICTED: GDSL esterase/lipase At3g48460 [Vitis vinifera]
Length=384

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K I +FGDS TD GN  R +   NA+   + LPYG TFFHHPT RYSDGRL+IDF+A +
Sbjct  41   FKRIYAFGDSYTDTGN-TRSATGPNAFTYVSNLPYGSTFFHHPTNRYSDGRLVIDFVAQA  99

Query  377  MGLPFVEPYFGGK  415
            + LPF+ PY   K
Sbjct  100  LSLPFLPPYRSQK  112



>ref|XP_006645636.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=386

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +2

Query  170  STGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGR  349
            S+GH      +AI SFGDS TD GN +R++ ++   +    LPYGETFF HPTGR S+GR
Sbjct  31   SSGHPK---IEAIFSFGDSYTDTGNFVRLAAAALTVIPYNSLPYGETFFGHPTGRASNGR  87

Query  350  LIIDFMALSMGLPFVEPYFG  409
            L++DF+A   G+PFV PY G
Sbjct  88   LVVDFIAEKFGVPFVPPYLG  107



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            +T+++   LF++T +     +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFF
Sbjct  11   VTFFLSSTLFLATANSESR-FKSIISFGDSIADTGNLLGLS-DPNDLPHVAFPPYGETFF  68

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            +H TGR+S+GRLIIDF+A  +GLP V P++G +   
Sbjct  69   NHSTGRFSNGRLIIDFIAEYLGLPLVPPFYGSQNAN  104



>emb|CAN62554.1| hypothetical protein VITISV_031355 [Vitis vinifera]
Length=385

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K I +FGDS TD GN  R +   NA+   + LPYG TFFHHPT RYSDGRL+IDF+A +
Sbjct  41   FKRIYAFGDSYTDTGN-TRSATGPNAFTYVSNLPYGSTFFHHPTNRYSDGRLVIDFVAQA  99

Query  377  MGLPFVEPYFGGK  415
            + LPF+ PY   K
Sbjct  100  LSLPFLPPYRSQK  112



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +2

Query  179  HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLP-YGETFFHHPTGRYSDGRLI  355
            HV  GC+ +I SFGDSLTD GNL ++S S +  +     P YG TFF +PTGR SDGRL+
Sbjct  29   HV-NGCFTSIFSFGDSLTDTGNLHQLSLSESKKLSHFDFPPYGRTFFGYPTGRCSDGRLV  87

Query  356  IDFMALSMGLPFVEPYFGGKTTGDRSF  436
            IDF+A   GLPF+ PYF G+    R+ 
Sbjct  88   IDFIAEDFGLPFLPPYFEGENGKPRNL  114



>ref|XP_004134931.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=380

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY +I +FGDSL+D GNL     S N    +   PYGETFFH PTGR+S+GRL++DF A
Sbjct  21   GCYTSIFNFGDSLSDTGNLYFTCSSPNP-SHACFFPYGETFFHLPTGRFSNGRLVLDFFA  79

Query  371  LSMGLPFVEPY  403
            +S+GLP V+PY
Sbjct  80   MSLGLPPVQPY  90



>ref|XP_004155631.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g28570-like 
[Cucumis sativus]
Length=380

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            GCY +I +FGDSL+D GNL     S N    +   PYGETFFH PTGR+S+GRL++DF A
Sbjct  21   GCYTSIFNFGDSLSDTGNLYFTCSSPNP-SHACFFPYGETFFHLPTGRFSNGRLVLDFFA  79

Query  371  LSMGLPFVEPY  403
            +S+GLP V+PY
Sbjct  80   MSLGLPPVQPY  90



>emb|CBI14877.3| unnamed protein product [Vitis vinifera]
Length=411

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K I +FGDS TD GN  R +   NA+   + LPYG TFFHHPT RYSDGRL+IDF+A +
Sbjct  68   FKRIYAFGDSYTDTGN-TRSATGPNAFTYVSNLPYGSTFFHHPTNRYSDGRLVIDFVAQA  126

Query  377  MGLPFVEPYFGGK  415
            + LPF+ PY   K
Sbjct  127  LSLPFLPPYRSQK  139



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +2

Query  176  GHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            G    GCY +I SFGDSL D GNL+         +     PYG T+FH PTGR+SDGRLI
Sbjct  45   GSATTGCYSSIFSFGDSLADTGNLLHTLGRDGTRI--GRPPYGMTYFHRPTGRFSDGRLI  102

Query  356  IDFMALSMGLPFVEPYFGGKTTGD  427
            +DF+A +MGLP + PY    T GD
Sbjct  103  VDFIAQAMGLPLLPPYLEETTGGD  126



>gb|ACU19966.1| unknown [Glycine max]
Length=224

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY ++ SFGDSLTD GNL  +S   +   +    PYG+T FH P GR SDGRLI+DF+A 
Sbjct  34   CYTSLFSFGDSLTDTGNLYFISPRQSPDCLLP--PYGQTHFHRPNGRCSDGRLILDFLAE  91

Query  374  SMGLPFVEPYFGGKT  418
            S+GLP+V+PY G K 
Sbjct  92   SLGLPYVKPYLGFKN  106



>ref|XP_008806794.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Phoenix dactylifera]
 ref|XP_008806795.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Phoenix dactylifera]
Length=382

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 59/96 (61%), Gaps = 5/96 (5%)
 Frame = +2

Query  146  YIFLVLFVSTG---HVAGGCY-KAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            ++FLVLF  T        GCY KAI S GDS+ D GNL+R      A+   A LPYGET 
Sbjct  14   FLFLVLFFWTSAGLEEREGCYIKAIYSLGDSIADTGNLLR-EGVGGAFAPIAHLPYGETT  72

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            FH PTGR SDG L+ID++A S+ LPFV PY   +  
Sbjct  73   FHRPTGRCSDGLLMIDYLASSLNLPFVNPYLDKEAN  108



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 18/113 (16%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F+VL +     A  CY +I SFGDSLTD GNL  +S+  +   +    PYG+T FHHP
Sbjct  12   WLFIVLPLVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCLLP--PYGKTHFHHP  69

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG----------------GKTTGDRSF  436
             GR SDGRLI+DF+A    LP+++PY G                G T  DRSF
Sbjct  70   NGRCSDGRLIVDFIAEFFRLPYLKPYLGFINGGNIEHGVNFAVAGATALDRSF  122



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFFH PTGR+S+GRLIIDF+A  
Sbjct  35   FKSIISFGDSIADTGNLLGLS-GPNELPHVAFPPYGETFFHRPTGRFSNGRLIIDFIAEF  93

Query  377  MGLPFVEPYFGGKT  418
            +GLP V P++G + 
Sbjct  94   LGLPLVPPFYGSQN  107



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 18/113 (16%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F+VL +     A  CY +I SFGDSLTD GNL  +S+  +   +    PYG+T FHHP
Sbjct  12   WLFIVLPLVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCLLP--PYGKTHFHHP  69

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFG----------------GKTTGDRSF  436
             GR SDGRLI+DF+A    LP+++PY G                G T  DRSF
Sbjct  70   NGRCSDGRLIVDFIAEFFRLPYLKPYLGFINGGNIEHGVNFAVAGATALDRSF  122



>ref|XP_004959854.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Setaria italica]
Length=392

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            +G  Y    SFGDS  D GN IR S         + LPYGETFFH PTGR+SDGRL++DF
Sbjct  40   SGSSYARFFSFGDSQIDTGNFIRYSADPGPV---SRLPYGETFFHRPTGRWSDGRLVVDF  96

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A  +G P+  PY  GKT  D
Sbjct  97   IAERLGFPYWPPYLAGKTAED  117



>dbj|BAD68794.1| lipase-like [Oryza sativa Japonica Group]
Length=370

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 50/78 (64%), Gaps = 14/78 (18%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY  + SFGDSL D GNL                PYGETFFH  TGR SDGRLIIDF+A 
Sbjct  40   CYLRVFSFGDSLADTGNLWP--------------PYGETFFHRATGRCSDGRLIIDFIAE  85

Query  374  SMGLPFVEPYFGGKTTGD  427
            +MGLPF+ PY+GG+T  D
Sbjct  86   AMGLPFLRPYWGGQTAED  103



>ref|XP_006644440.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=404

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY+ + SFGDSLTD GN   +   +++   +   PYGETFF   TGR+SDGRL++DF+A 
Sbjct  40   CYQRLFSFGDSLTDTGNFPFIF-GNDSREPALRPPYGETFFRRATGRFSDGRLVVDFIAD  98

Query  374  SMGLPFVEPYFGGKTTGD  427
            ++GLPFV PY+ G+T GD
Sbjct  99   ALGLPFVRPYWSGRTAGD  116



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAG---GC-YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETF  313
            +I +V FV+    A     C Y+++ SFGDSL D GNL   S     +      PYG+TF
Sbjct  9    WIAMVAFVAVSSSASLLVACPYRSMFSFGDSLADTGNLYLSSHPPTDHCFFP--PYGQTF  66

Query  314  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            FHH +GR SDGRLIIDF+A S+GLP V+PYFGG    +
Sbjct  67   FHHVSGRCSDGRLIIDFIAESLGLPLVKPYFGGWNVEE  104



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GC+ AI SFGDS+ D GN +R+     +   S   PYG TFF  PTGR+SDGR+IIDF
Sbjct  27   ASGCFTAIFSFGDSIADTGNAVRLGSLGAS---SGSPPYGRTFFDRPTGRFSDGRVIIDF  83

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A  +GLP V PY  G +  D
Sbjct  84   IAQGLGLPLVRPYLDGGSGDD  104



>ref|NP_001060434.1| Os07g0642200 [Oryza sativa Japonica Group]
 dbj|BAC16480.1| lipase-like protein [Oryza sativa Japonica Group]
 dbj|BAD30249.1| lipase-like protein [Oryza sativa Japonica Group]
 dbj|BAF22348.1| Os07g0642200 [Oryza sativa Japonica Group]
 dbj|BAG86694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            +GGCY  + +FG+SL D GN I  S S      S   PYGETFF  PTGR+SDGRLI+DF
Sbjct  42   SGGCYSHLFTFGNSLIDTGNFIHYSTSPGPVARS---PYGETFFRRPTGRWSDGRLIVDF  98

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +   +G P+  PY  GK+  D
Sbjct  99   IVERLGFPYWTPYLAGKSRED  119



>gb|EAZ04881.1| hypothetical protein OsI_27063 [Oryza sativa Indica Group]
Length=391

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            +GGCY  + +FG+SL D GN I  S S      S   PYGETFF  PTGR+SDGRLI+DF
Sbjct  42   SGGCYSHLFTFGNSLIDTGNFIHYSTSPGPVARS---PYGETFFRRPTGRWSDGRLIVDF  98

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +   +G P+  PY  GK+  D
Sbjct  99   IVERLGFPYWTPYLAGKSRED  119



>ref|XP_002461107.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
 gb|EER97628.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
Length=395

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +2

Query  188  GGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFM  367
            GGCY    +FGDSL D GN I  S +      S   PYGETFFH PTGR+SDGRLI+DF+
Sbjct  38   GGCYSHFFAFGDSLIDTGNFIHYSTAPGPVAHS---PYGETFFHRPTGRWSDGRLIVDFI  94

Query  368  ALSMGLPFVEPYFGGKTTGD  427
               +G P   PY  GK+  D
Sbjct  95   VERLGYPRWSPYLDGKSKED  114



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 3/102 (3%)
 Frame = +2

Query  119  FSQGTAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAX  292
            F + T   + I L+  V +      C  +K+I+SFGDS  D GNL+ +S  +N     A 
Sbjct  9    FKKLTRTFFIITLLTTVVSSLEVKQCREFKSIISFGDSHADTGNLLGLSDPNNLPHF-AF  67

Query  293  LPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
             PYGETFFHHPTGR+S+GR+IIDFMA  + LP V P++G + 
Sbjct  68   PPYGETFFHHPTGRFSNGRVIIDFMAEFLDLPLVPPFYGSQN  109



>gb|KJB51165.1| hypothetical protein B456_008G204600 [Gossypium raimondii]
Length=386

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K I +FGDS TD GN   +S   N +V  +  PYG TFFHHPT RYSDGRL+IDF+A S
Sbjct  43   FKKIYAFGDSFTDTGNTESLS-GPNGFVRVSNPPYGTTFFHHPTNRYSDGRLVIDFVAQS  101

Query  377  MGLPFVEPYFGGK  415
            + LPF+ PY   K
Sbjct  102  LSLPFLPPYRNRK  114



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIR-MSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            C  +I SFGDSL D GNL+  +   +  +   A LPYGET+FH+ TGR+SDGRLIIDF+A
Sbjct  44   CLTSIFSFGDSLADTGNLLHYLGDDAGPF---AHLPYGETYFHNATGRFSDGRLIIDFIA  100

Query  371  LSMGLPFVEPYFGGKTTGD  427
             S+GLP V PY  G    D
Sbjct  101  QSLGLPLVPPYLAGTNAQD  119



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  176  GHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            G     CY  I SFGDSL D GNLIR+    +A   +   PYG T+FH PTGR+SDGRLI
Sbjct  18   GSSTTACYSTIFSFGDSLADTGNLIRVP--GHADCQAGRPPYGMTYFHSPTGRFSDGRLI  75

Query  356  IDFMALSMGLPFVEPYF----GGKTTGDRSFA  439
            +D++A +MGLP + PY     GG+     +FA
Sbjct  76   VDYIAEAMGLPLLPPYLEAWRGGRLRKGVNFA  107



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY ++ SFGDSL D GNL+R     N  V    LPYGET+F  PTGR+ DGRL++DF+A 
Sbjct  72   CYTSVFSFGDSLADTGNLLRYLGKKNIDV--GRLPYGETYFRRPTGRFCDGRLVVDFIAQ  129

Query  374  SMGLPFVEPYFGGKT  418
            +MGLP + PY   ++
Sbjct  130  AMGLPLLPPYLARRS  144



>gb|EMT20589.1| GDSL esterase/lipase [Aegilops tauschii]
Length=341

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            ++F VL ++    + GC+K I SFGDS+TD GN   +S++S     S    YGET+FH P
Sbjct  16   FVFAVLLLNADIGSCGCFKRIFSFGDSITDTGNFAYISRNSPPGPPSVPP-YGETYFHRP  74

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            TGR SDGRLIIDF A ++GLP + P    + TG
Sbjct  75   TGRASDGRLIIDFYAQALGLPLLPPSIPKEKTG  107



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIR-MSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
            C  +I SFGDSL D GNL+  +   +  +   A LPYGET+FH+ TGR+SDGRLIIDF+A
Sbjct  44   CLTSIFSFGDSLADTGNLLHYLGDDAGPF---AHLPYGETYFHNATGRFSDGRLIIDFIA  100

Query  371  LSMGLPFVEPYFGGKTTGD  427
             S+GLP V PY  G    D
Sbjct  101  QSLGLPLVPPYLAGTNAQD  119



>ref|XP_009411652.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y AI  FG+SLTD GNL+  S  + A   ++ LPYGET+F HP+GR+SDGRL+IDF+A +
Sbjct  61   YPAIFGFGNSLTDTGNLVFFSGGTEA---ASGLPYGETYFGHPSGRFSDGRLVIDFIAQA  117

Query  377  MGLPFVEPYFGGKTTGD  427
            + LP V PY  G ++ D
Sbjct  118  LRLPLVPPYLAGNSSED  134



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 6/74 (8%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRM--SKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            GCY +I++FGDSLTD GNL     +KS N +      PYG+T+FHHPTGR SDGRL+IDF
Sbjct  533  GCYNSIIAFGDSLTDTGNLYNSYPNKSLNFF----HPPYGQTYFHHPTGRCSDGRLVIDF  588

Query  365  MALSMGLPFVEPYF  406
            +A  +GLP V PY 
Sbjct  589  IAEFLGLPLVPPYL  602


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 6/79 (8%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRM--SKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            G Y +I+SFGDSLTD GN      +KS N +      PYG+T+FHHPTGR SDGRL+IDF
Sbjct  32   GRYNSIISFGDSLTDTGNFYNSYPNKSLNFF----HPPYGQTYFHHPTGRCSDGRLVIDF  87

Query  365  MALSMGLPFVEPYFGGKTT  421
            +A  +GLP V PY   + +
Sbjct  88   IAEFLGLPLVPPYLESQNS  106



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGC---YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFH  319
            I +VL +++  +   C   + +I SFGDSL D GNL    +  + +  S   PYGET+FH
Sbjct  14   ILVVLIIASPPLFTACRPSFSSIFSFGDSLADTGNLYFSYQQPSQHCFSP--PYGETYFH  71

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG--DRS  433
            HP+ R SDGRLI+DF+  S+G+P V+PY G K  G  DRS
Sbjct  72   HPSARCSDGRLILDFICESLGVPTVKPYLGIKNGGLEDRS  111



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 8/101 (8%)
 Frame = +2

Query  122  SQGTAITYYIFLVL------FVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVM  283
            S  + + +Y+ L+         S  H   G Y A+ SFGDSL D GNL+    S   ++ 
Sbjct  3    SSSSCLNFYLLLIFSLCSCTIASKVHSKKGNYSALFSFGDSLADTGNLLLSGHSP--FIR  60

Query  284  SAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYF  406
             A  P+GETFFH PTGR SDGRL++DF+A + GLP + PY 
Sbjct  61   IAHPPFGETFFHKPTGRCSDGRLVVDFVAEAFGLPLLPPYL  101



>ref|XP_003569458.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=395

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +2

Query  191  GCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMA  370
             CY  + SFGDSL D GN  R   + ++   +   PYGETFFH+ TGR+S+GRL++DF+A
Sbjct  28   ACYPRVFSFGDSLADTGNY-RFVYADDSREPALRPPYGETFFHNATGRFSNGRLVVDFIA  86

Query  371  LSMGLPFVEPYFGGKTTGDRSF  436
             ++GLPFV PY+ G +  D +F
Sbjct  87   EALGLPFVRPYWSGSSAEDFAF  108



>ref|XP_002456053.1| hypothetical protein SORBIDRAFT_03g029590 [Sorghum bicolor]
 gb|EES01173.1| hypothetical protein SORBIDRAFT_03g029590 [Sorghum bicolor]
Length=399

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +2

Query  158  VLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRY  337
            ++ +     A  CY  + SFGDSLTD GN  R    +N+   +   PYGETFF   TGR+
Sbjct  22   LMVIVGAEPAAACYPRVFSFGDSLTDTGNF-RFYYGNNSGEPALRPPYGETFFRRATGRF  80

Query  338  SDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            S+GRL++DF+A +MGLPFV PY  G+   D
Sbjct  81   SNGRLVLDFIADTMGLPFVRPYLSGRRAED  110



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  194  CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMAL  373
            CY ++ SFGDSLTD GNL  +S   +   +    PYG+T FH P GR SDGRLI+DF+A 
Sbjct  34   CYTSLFSFGDSLTDTGNLYFISPRQSPDCLLP--PYGQTHFHRPNGRCSDGRLILDFLAE  91

Query  374  SMGLPFVEPYFGGKT  418
            S+GLP+V+PY G K 
Sbjct  92   SLGLPYVKPYLGFKN  106



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            I +++     V+       C  +K+I+SFGDS+ D GN + +S  +N     A  PYGET
Sbjct  13   IIFFLLSTFLVTNVSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHF-AFPPYGET  71

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            FFHHPTGR+S+GR+IIDF+A  + LP V P++G +   
Sbjct  72   FFHHPTGRFSNGRVIIDFIAEFLSLPLVPPFYGSQNAN  109



>gb|EMT30306.1| GDSL esterase/lipase [Aegilops tauschii]
Length=336

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPT  328
            +F VL ++    + GC+K I SFGDS+TD GN   +S++S     S    YGET+FH PT
Sbjct  17   VFAVLLLNADLGSCGCFKRIFSFGDSITDTGNFAYISRNSPPGPPSVPP-YGETYFHRPT  75

Query  329  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            GR SDGRLIIDF A ++GLP + P    + TG
Sbjct  76   GRASDGRLIIDFYAQALGLPLLPPSIPEEKTG  107



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            I +++     V+       C  +K+I+SFGDS+ D GN + +S  +N     A  PYGET
Sbjct  13   IIFFLLSTFLVTNVSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHF-AFPPYGET  71

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            FFHHPTGR+S+GR+IIDF+A  + LP V P++G +   
Sbjct  72   FFHHPTGRFSNGRVIIDFIAEFLSLPLVPPFYGSQNAN  109



>ref|XP_006651412.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Oryza brachyantha]
Length=375

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +2

Query  188  GGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFM  367
            G CY ++ SFGDS+TD GN +    ++ A    A  PYGETFF HPTGRYSDGRL++DF+
Sbjct  26   GYCYTSMFSFGDSITDTGNQVSFFPTAPA----ASPPYGETFFGHPTGRYSDGRLVVDFL  81

Query  368  ALSMGLPFVEPYFGGKTTGD  427
            A ++ LP++  +  GKT  D
Sbjct  82   AEALRLPYLTAFLRGKTAED  101



>ref|XP_004969326.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=422

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A  CY+ + SFGDSL D GN  R    +++   +   PYGETFF  PTGR+S+GRL++DF
Sbjct  34   AAACYQRLFSFGDSLADTGNF-RFYYGNSSGEPALRPPYGETFFRRPTGRFSNGRLVLDF  92

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A +MGLPFV PY  G+   D
Sbjct  93   IADTMGLPFVRPYLSGRRAED  113



>ref|XP_002461110.1| hypothetical protein SORBIDRAFT_02g040940 [Sorghum bicolor]
 gb|EER97631.1| hypothetical protein SORBIDRAFT_02g040940 [Sorghum bicolor]
Length=396

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 3/88 (3%)
 Frame = +2

Query  164  FVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSD  343
            +   G   G C+  + SFGDS+TD GN +  + S  A    A  PYGETFF  P GR+ D
Sbjct  39   WRGNGGAGGTCFTRLFSFGDSITDNGNWMHYAHSPGAV---ARPPYGETFFRRPNGRFCD  95

Query  344  GRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            GR+IID +A ++G+PF+ PY  G  +GD
Sbjct  96   GRIIIDHIADALGIPFLTPYLAGNKSGD  123



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAX-LPYGETFFHHPTGRYSDGRLIID  361
            A GCY +I SFGDS+ D GN I    +S   V S   LPYG+T+F H TGR+SDGRLI+D
Sbjct  29   AVGCYTSIFSFGDSIADTGNAI----NSGIIVESVRHLPYGQTYFGHATGRFSDGRLIVD  84

Query  362  FMALSMGLPFVEPYFGGKTTGD  427
            F+A +MGLP + PY  G    D
Sbjct  85   FIAEAMGLPMLRPYLAGGNAED  106



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 61/101 (60%), Gaps = 10/101 (10%)
 Frame = +2

Query  131  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGN-------LIRMSKSSNAYVMSA  289
            T I++ +  ++ +S+   A GC+ +I + GDSL D GN       +  +SK +   +   
Sbjct  10   TTISFSVTFLILLSSLKTASGCFTSIFALGDSLADTGNYATIYPPIFHLSKGT---LYCG  66

Query  290  XLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGG  412
              PYGET+FHHPTGR SDGRLIIDF+A   GLP V PY  G
Sbjct  67   LPPYGETYFHHPTGRCSDGRLIIDFIAEYYGLPPVPPYLRG  107



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = +2

Query  116  AFSQGTAITYYIFLVLFVSTGHVAGGC-YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAX  292
            +  +   I+   F+V+  S+  +   C Y +I SFGDS  D GNL   S     +     
Sbjct  12   SICEQRWISIVAFVVIASSSAPLLAACPYTSIFSFGDSFADTGNLYLSSHPPTHHCFFP-  70

Query  293  LPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS  433
             PYGET+FH  TGR SDGRLIIDF+A S+GLP V+PYFG K  G  S
Sbjct  71   -PYGETYFHRVTGRCSDGRLIIDFIAESLGLPLVKPYFGIKKFGGWS  116



>ref|XP_007148064.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
 gb|ESW20058.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
Length=380

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            + ++ SFGDSLTD GNL  +S   +   +    PYG+T+FH PTGR SDGRLI+DF+A S
Sbjct  25   FSSLFSFGDSLTDTGNLFFISSPQSPNCLLP--PYGQTYFHRPTGRCSDGRLILDFLADS  82

Query  377  MGLPFVEPYFGGKT  418
            +GLP++EPY G K 
Sbjct  83   LGLPYLEPYLGFKN  96



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 6/94 (6%)
 Frame = +2

Query  152  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            FL++F ST  V      C  YK+I+SF DS  D GN + +S   N    +A  PYGETFF
Sbjct  12   FLLMFSSTITVDSSEPSCRSYKSIISFSDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKT  418
            H PTGR SDGRLIIDF+A  + LP+V PYFG + 
Sbjct  71   HAPTGRNSDGRLIIDFIAEFLRLPYVPPYFGSQN  104



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            F+V+F S   +A   YK+I SFGDS  D GNL   S   + +      PYG+TFFH  TG
Sbjct  15   FVVVFSSATILAACPYKSIFSFGDSFADTGNLYFSSHPPSHHCFFP--PYGQTFFHRVTG  72

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGK  415
            R SDGRLIIDF+A S+GLP ++PY G K
Sbjct  73   RCSDGRLIIDFIAESLGLPLLKPYLGMK  100



>tpg|DAA58331.1| TPA: hypothetical protein ZEAMMB73_278814 [Zea mays]
Length=316

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY  + +FGDSL D GN   +  + +A +     PYGETFFH  TGR S+GRL++DF
Sbjct  33   AAGCYPRVFNFGDSLADTGNYPFVYGNDSAKLRP---PYGETFFHRATGRASNGRLVVDF  89

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A ++GLPFV PY  G++  D
Sbjct  90   IADTLGLPFVRPYLSGRSAED  110



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GNL+ +S  +N     A  PYGETFFHHPTGR+S+GR+IIDF+A  
Sbjct  32   FKSIISFGDSIADTGNLLGLSDPNNLPHF-AFPPYGETFFHHPTGRFSNGRVIIDFIAEF  90

Query  377  MGLPFVEPYFGGKT  418
            + LP V P++G + 
Sbjct  91   LDLPLVPPFYGSQN  104


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = +2

Query  152  FLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            F+V +VS+       +K+I+SFGDS+ D GN + +S  +N     A  PYGETFFHH TG
Sbjct  442  FVVTYVSS-ETKCREFKSIISFGDSVADTGNFLGLSDRNNLPHF-AFPPYGETFFHHATG  499

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            R+S+GRLIIDF+A  + LP V P++G +   
Sbjct  500  RFSNGRLIIDFIAEFLSLPLVPPFYGSQNAN  530



>ref|XP_007148067.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
 gb|ESW20061.1| hypothetical protein PHAVU_006G177800g [Phaseolus vulgaris]
Length=317

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            + +I SFGDSLTD GN    S S N        PYG+TFFHH TGR SDGRLIIDF+A S
Sbjct  44   FTSIFSFGDSLTDTGNRYLASHSPNHCFFP---PYGQTFFHHVTGRCSDGRLIIDFIAES  100

Query  377  MGLPFVEPYFGGKT  418
            +GLP V+PY   K+
Sbjct  101  LGLPLVKPYLEKKS  114



>ref|XP_010054333.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=388

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y++I +FGDSL+D GN +R   S+  + +    PYG+TFF HPTGRYSDGRLIIDF+A +
Sbjct  48   YESIFNFGDSLSDTGNYLR---SAGDHAILPTSPYGKTFFGHPTGRYSDGRLIIDFIAET  104

Query  377  MGLPFVEPYF  406
            +GLP+++PY 
Sbjct  105  VGLPYLKPYL  114



>ref|XP_006651409.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=370

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = +2

Query  176  GHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLI  355
            G  A G +  + SFGDS+TD GNL+    SS A    A  PYGETFF  PTGR+ DGRLI
Sbjct  21   GDPATGGFTRLFSFGDSITDAGNLVSFVPSSPA----ASPPYGETFFGRPTGRFCDGRLI  76

Query  356  IDFMALSMGLPFVEPYFGGKTTGD  427
            +DF+A ++ LP++ P+  GKT  D
Sbjct  77   VDFLAEALRLPYLTPFLRGKTAED  100



>gb|KHG00751.1| hypothetical protein F383_21550 [Gossypium arboreum]
Length=386

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K I +FGDS TD GN   ++   N +V  +  PYG TFFHHPT RYSDGRL+IDF+A S
Sbjct  43   FKKIYAFGDSFTDTGNTGSLT-GPNGFVHVSNPPYGTTFFHHPTNRYSDGRLVIDFVAQS  101

Query  377  MGLPFVEPYFGGK  415
            + LPF+ PY   K
Sbjct  102  LSLPFLPPYRNRK  114



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGC-YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHP  325
            + LV+  S   +   C Y +I SFGDSL D GNL         + +    PYGETFFHH 
Sbjct  17   VALVIASSAPLLLAACPYTSIFSFGDSLADTGNLYFSPYPPTNHCLFP--PYGETFFHHV  74

Query  326  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS  433
            TGR SDGRLIIDF+A S+G+P V+PY G K  G  S
Sbjct  75   TGRCSDGRLIIDFIAESLGIPRVKPYLGIKNIGRWS  110



>ref|XP_010518794.1| PREDICTED: GDSL esterase/lipase At5g45910 [Tarenaya hassleriana]
Length=321

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y++I +FGDSL+D GN   +      + +   LPYGETFF+ PTGRYSDGRLIIDF+A +
Sbjct  27   YESIFNFGDSLSDTGNF--LISGDKPFPVVGKLPYGETFFNRPTGRYSDGRLIIDFIAEA  84

Query  377  MGLPFVEPYFGGKTTG  424
             GLP++ PY  G  T 
Sbjct  85   SGLPYLPPYLEGVRTN  100



>dbj|BAJ94075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y  + SFGDSLTD GN +R++ +      S+  PYGETFF  PTGR SDGRL++DF+A +
Sbjct  30   YSGVFSFGDSLTDTGNSLRLAATRAG--PSSRPPYGETFFRRPTGRASDGRLVVDFIAEA  87

Query  377  MGLPFVEPYFGGKTTGD  427
            +G+P   PY  GK+  D
Sbjct  88   LGVPHPTPYLAGKSAED  104



>dbj|BAJ95195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y  + SFGDSLTD GN +R++ +      S+  PYGETFF  PTGR SDGRL++DF+A +
Sbjct  30   YSGVFSFGDSLTDTGNSLRLAATRAG--PSSRPPYGETFFRRPTGRASDGRLVVDFIAEA  87

Query  377  MGLPFVEPYFGGKTTGD  427
            +G+P   PY  GK+  D
Sbjct  88   LGVPHPTPYLAGKSAED  104



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +2

Query  200  KAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALSM  379
            ++I+SFGDS+ D GNL+ +S   N +   A LPYGETFFHHPTGR+S+GRLIIDF+ L +
Sbjct  12   RSILSFGDSIADTGNLLGLS-DPNDHPQVALLPYGETFFHHPTGRFSNGRLIIDFIVLRL  70

Query  380  GLPFVEPYFGGKT  418
             L  V P++G + 
Sbjct  71   SL--VPPFYGSQN  81



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGET  310
            +T+++   LF++T +       +K+I+SFG+S+ D GNL+ +S   N     A  PYGET
Sbjct  14   VTFFLSSTLFLATANSEPQRRRFKSIISFGNSIADTGNLLGLS-DPNDLPHVAFPPYGET  72

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG  424
            FF+H TGR+S+GRLIIDF+A  +GLP V P++G +   
Sbjct  73   FFNHSTGRFSNGRLIIDFIAEYLGLPLVPPFYGSQNAN  110



>emb|CDO96748.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 59/101 (58%), Gaps = 5/101 (5%)
 Frame = +2

Query  146  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXL---PYGETFF  316
            ++ L L  S  H A GCY +I +FGDSLTD GN + +      +         P GET+F
Sbjct  59   FVLLALLSSPQH-AIGCYTSIFAFGDSLTDAGNYLELYPHLVPHHKPPHFFFPPNGETYF  117

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT-GDRSF  436
            H+PTGR  DGRL+IDF A   GLP +  YFGGK    +R+F
Sbjct  118  HYPTGRCCDGRLMIDFFAEYFGLPLLPTYFGGKNNESNRNF  158



>ref|XP_008364168.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Malus domestica]
Length=311

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGN-LIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIID  361
            A GCY +I+ FGDSL D GN  +      +        PYGE FFHHPTGR  DGRLIID
Sbjct  26   ALGCYTSIIGFGDSLADTGNSYLNALDHHDKPFHFFFPPYGEDFFHHPTGRCCDGRLIID  85

Query  362  FMALSMGLPFVEPYF  406
            F+A S+GLP V PYF
Sbjct  86   FIAESLGLPLVRPYF  100



>ref|NP_001130974.1| uncharacterized protein LOC100192079 [Zea mays]
 gb|ACF79385.1| unknown [Zea mays]
 gb|ACN29020.1| unknown [Zea mays]
 tpg|DAA58329.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=403

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +2

Query  155  LVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRM-SKSSNAYVMSAXLPYGETFFHHPTG  331
            +VL +     A GCY  + SFGDSL D GN   +    S +   +   PYGETFFH  TG
Sbjct  23   VVLILGAVAPAAGCYPRVFSFGDSLADTGNYPFVYGNDSGSGGAALRPPYGETFFHRATG  82

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            R S+GRL++DF+A ++GLPFV PY  G++  D
Sbjct  83   RASNGRLVVDFIADTLGLPFVRPYLSGRSAED  114



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +K+I+SFGDS+ D GNL+ +S   N     A  PYGETFF+H TGR+S+GRLIIDF+A  
Sbjct  30   FKSIISFGDSIADTGNLLGLS-DPNDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEY  88

Query  377  MGLPFVEPYFGGKTTG  424
            +GLP V P++G +   
Sbjct  89   LGLPLVPPFYGSQNAN  104



>gb|KDO77811.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=222

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 5/93 (5%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            + + + L+  VST H+    Y AI +FGDSL+D GN   +   + A+ +   LPYGETFF
Sbjct  6    LVFALCLLRSVSTSHLK---YHAIFNFGDSLSDTGNF--LVSGALAFPVIGKLPYGETFF  60

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK  415
             H TGR SDGRL+IDFMA +  LP++ PY   K
Sbjct  61   RHATGRCSDGRLVIDFMAEAFRLPYLPPYLALK  93



>gb|EEC75319.1| hypothetical protein OsI_11692 [Oryza sativa Indica Group]
Length=255

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 12/90 (13%)
 Frame = +2

Query  176  GHVAGG--------CYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTG  331
            GH+A G        C+  + SFGDS+TD GN   +S +++       LPYGETFF  PTG
Sbjct  36   GHLATGAGGDDGFSCFTRMFSFGDSITDTGNSATISPNASFN----RLPYGETFFGRPTG  91

Query  332  RYSDGRLIIDFMALSMGLPFVEPYFGGKTT  421
            RYSDGRLI+DF+A  + LPF+ P+  G+ T
Sbjct  92   RYSDGRLIVDFLAERLELPFLTPFLRGRET  121



>ref|XP_004980345.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Setaria italica]
Length=370

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +2

Query  170  STGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGR  349
            ++   A  CYK + S GDS+TD GNL  ++ +    + +   PYGETFFH P GR+ DGR
Sbjct  22   ASARQAPCCYKRLFSLGDSITDAGNLAIVAPN----IPAMAFPYGETFFHRPNGRFCDGR  77

Query  350  LIIDFMALSMGLPFVEPYFGGKTTGD  427
            LI+DF+A ++ LP + P+  G    D
Sbjct  78   LIVDFIAEALKLPLLTPFLAGNKAED  103



>ref|XP_006651410.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Oryza brachyantha]
Length=374

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 13/112 (12%)
 Frame = +2

Query  119  FSQGTAITYYIFLVLFVS----TGHVA-----GGCYKAIVSFGDSLTDXGNLIRMSKSSN  271
             S  T +T  +FL+L  S    + H A     G  +  + SFGDS+TD GNL+    SS 
Sbjct  6    LSSPTMMTMILFLLLCTSAAADSAHPAPGGGGGSGFTHLFSFGDSITDTGNLVSFVPSST  65

Query  272  AYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
            A    A LPYGETFF  PTGR+ DGRLI+DF+A  + LP++  +  G+T  D
Sbjct  66   A----ARLPYGETFFRRPTGRFCDGRLIVDFLAEELRLPYLTAFLRGRTAED  113



>ref|XP_010250902.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Nelumbo nucifera]
Length=400

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  170  STGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGR  349
             T    G  +  I +FGDS TD GN    S    ++   + LPYG TFFHHPT RYSDGR
Sbjct  44   KTSKTIGSRFTKIYAFGDSFTDTGNTRSASTGPTSFDHVSQLPYGITFFHHPTNRYSDGR  103

Query  350  LIIDFMALSMGLPFVEPYFGGK  415
            L+IDF+A ++ LP++ PY   K
Sbjct  104  LVIDFLAEALSLPYLPPYINRK  125



>ref|XP_011072984.1| PREDICTED: GDSL esterase/lipase At3g48460 [Sesamum indicum]
Length=385

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            +  I +FGDS TD GN  R +   N ++  + LPYG TFFH PT RYSDGRL+IDF+A +
Sbjct  39   FNTIYAFGDSYTDTGN-TRSNTGPNGFMFVSNLPYGRTFFHRPTNRYSDGRLVIDFVAQA  97

Query  377  MGLPFVEPYFGGKTTGDRS  433
            + LPF+ PY   K   D+S
Sbjct  98   LALPFLSPYLDQK--ADKS  114



>gb|ACN28025.1| unknown [Zea mays]
 tpg|DAA58333.1| TPA: hypothetical protein ZEAMMB73_278814 [Zea mays]
Length=395

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY  + +FGDSL D GN   +  + +A +     PYGETFFH  TGR S+GRL++DF
Sbjct  33   AAGCYPRVFNFGDSLADTGNYPFVYGNDSAKLRP---PYGETFFHRATGRASNGRLVVDF  89

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A ++GLPFV PY  G++  D
Sbjct  90   IADTLGLPFVRPYLSGRSAED  110



>gb|KJB57433.1| hypothetical protein B456_009G164000 [Gossypium raimondii]
Length=379

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 8/89 (9%)
 Frame = +2

Query  149  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGN---LIRMSKSSNAYVMSAXLPYGETFFH  319
            I L+L   +   A  CY++I+SFGDSL D GN   L++ +K + A+      P+G T+F+
Sbjct  17   ILLILTFFSSSSAKRCYRSIISFGDSLADTGNWVILLQQNKPTPAFP-----PFGGTYFN  71

Query  320  HPTGRYSDGRLIIDFMALSMGLPFVEPYF  406
             PTGR  DGRLI+DF A  +GLP V PYF
Sbjct  72   RPTGRCCDGRLIVDFFAQKLGLPLVPPYF  100



>ref|NP_001149094.1| LOC100282715 precursor [Zea mays]
 gb|ACG34180.1| esterase precursor [Zea mays]
 gb|ACN34799.1| unknown [Zea mays]
 tpg|DAA58332.1| TPA: esterase [Zea mays]
Length=399

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY  + +FGDSL D GN   +  + +A +     PYGETFFH  TGR S+GRL++DF
Sbjct  33   AAGCYPRVFNFGDSLADTGNYPFVYGNDSAKLRP---PYGETFFHRATGRASNGRLVVDF  89

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A ++GLPFV PY  G++  D
Sbjct  90   IADTLGLPFVRPYLSGRSAED  110



>gb|KJB62808.1| hypothetical protein B456_009G437400 [Gossypium raimondii]
Length=343

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +2

Query  143  YYIFLVLFVSTGHVA---GGCYKAIVSFGDSLTDXGNLIRMSK-SSNAYVMSAXLPYGET  310
            + I ++LF     ++    GC+ +I SFGDS++D GN I +S   +      A  P G T
Sbjct  16   FIIVVLLFAVISSISSPVNGCFTSIFSFGDSMSDTGNSIEISVLETGKLPHGAFPPNGCT  75

Query  311  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFA  439
            FFH PTGR+ DGRL+IDF+A ++GLPF+ PY+  K     +F 
Sbjct  76   FFHRPTGRFCDGRLVIDFLAEALGLPFLPPYYRYKNGTSENFE  118



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  197  YKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDFMALS  376
            Y++I +FGDSL+D GN +R +       MS   PYG+TFF HPTGR+SDGRLIIDF+A +
Sbjct  9    YESIFNFGDSLSDTGNYLRSAGDHAILPMS---PYGKTFFGHPTGRFSDGRLIIDFIAEA  65

Query  377  MGLPFVEPYF  406
            +GLP+++PY 
Sbjct  66   VGLPYLKPYL  75



>ref|XP_009411653.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = +2

Query  137  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFF  316
            ++   FL L V    V    Y AI  FG+SLTD GNL   S  +   V ++ LPYGET+F
Sbjct  5    VSLCFFLHLLVLPA-VRSSSYPAIFGFGNSLTDTGNLDFFSGGT---VAASRLPYGETYF  60

Query  317  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD  427
             HP+GR+SDGRL+IDF+A ++ LP   PY  G ++ D
Sbjct  61   GHPSGRFSDGRLVIDFIAQALRLPMAPPYLAGNSSED  97



>ref|XP_002456052.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
 gb|EES01172.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
Length=399

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +2

Query  185  AGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLIIDF  364
            A GCY  + SFGDSL D GN +     +N+       PYGETFFH  TGR S+GRL++DF
Sbjct  31   AAGCYPRVFSFGDSLADTGNCL-FVYGNNSGQAGLRPPYGETFFHRATGRASNGRLVVDF  89

Query  365  MALSMGLPFVEPYFGGKTTGD  427
            +A ++GLPFV PY  G +  D
Sbjct  90   IADALGLPFVRPYLSGGSAED  110



>ref|XP_009383572.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Musa acuminata 
subsp. malaccensis]
Length=366

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = +2

Query  179  HVAGGCYKAIVSFGDSLTDXGNLIRMSKSSNAYVMSAXLPYGETFFHHPTGRYSDGRLII  358
            H    C+ AI SFGDSL D GN I    ++ A    +  P+G T+FH  TGRYSDGRLII
Sbjct  20   HHGRACFPAIFSFGDSLQDTGNFI----NTFANTTISKHPWGITYFHKATGRYSDGRLII  75

Query  359  DFMALSMGLPFVEPYFGGKT  418
            DF+A ++GLP V PY GG T
Sbjct  76   DFIAQALGLPLVPPYRGGGT  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840