BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019E11

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365595.1|  PREDICTED: uncharacterized protein LOC102603607  99.0    4e-21   Solanum tuberosum [potatoes]
ref|XP_010326077.1|  PREDICTED: uncharacterized protein LOC101252...  93.6    1e-19   Solanum lycopersicum
ref|XP_009796832.1|  PREDICTED: uncharacterized protein LOC104243...  94.0    3e-19   Nicotiana sylvestris
ref|XP_004246765.1|  PREDICTED: uncharacterized protein LOC101252...  93.6    3e-19   Solanum lycopersicum
ref|XP_009598980.1|  PREDICTED: uncharacterized protein LOC104094...  92.8    6e-19   Nicotiana tomentosiformis
ref|XP_010326076.1|  PREDICTED: uncharacterized protein LOC101252...  74.7    1e-12   Solanum lycopersicum
ref|XP_009796835.1|  PREDICTED: uncharacterized protein LOC104243...  71.6    1e-11   Nicotiana sylvestris
ref|XP_009796833.1|  PREDICTED: uncharacterized protein LOC104243...  72.0    1e-11   Nicotiana sylvestris
ref|XP_009598981.1|  PREDICTED: uncharacterized protein LOC104094...  71.6    1e-11   
gb|KHG23614.1|  Putative E3 ubiquitin-protein ligase XBAT35           64.3    5e-09   Gossypium arboreum [tree cotton]
gb|KJB17075.1|  hypothetical protein B456_002G263500                  63.9    6e-09   Gossypium raimondii
gb|KJB17074.1|  hypothetical protein B456_002G263500                  63.9    6e-09   Gossypium raimondii
gb|KHG23613.1|  Putative E3 ubiquitin-protein ligase XBAT35           63.9    6e-09   Gossypium arboreum [tree cotton]
gb|KJB17073.1|  hypothetical protein B456_002G263500                  63.9    6e-09   Gossypium raimondii
ref|XP_008243696.1|  PREDICTED: uncharacterized protein LOC103341...  62.8    2e-08   Prunus mume [ume]
ref|XP_008243690.1|  PREDICTED: uncharacterized protein LOC103341...  62.8    2e-08   Prunus mume [ume]
ref|XP_008243700.1|  PREDICTED: uncharacterized protein LOC103341...  61.2    4e-08   Prunus mume [ume]
ref|XP_007207438.1|  hypothetical protein PRUPE_ppa005117mg           60.8    6e-08   Prunus persica
ref|XP_007205144.1|  hypothetical protein PRUPE_ppa005237mg           60.1    1e-07   Prunus persica
ref|XP_008390694.1|  PREDICTED: uncharacterized protein LOC103452949  60.1    1e-07   
ref|XP_010653293.1|  PREDICTED: uncharacterized protein LOC100247...  59.7    1e-07   
ref|XP_009377761.1|  PREDICTED: uncharacterized protein LOC103966331  60.1    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_002264526.1|  PREDICTED: uncharacterized protein LOC100247...  59.7    1e-07   Vitis vinifera
emb|CDP06483.1|  unnamed protein product                              59.7    2e-07   Coffea canephora [robusta coffee]
ref|XP_002525648.1|  ubiquitin-protein ligase, putative               59.3    2e-07   
ref|XP_007026700.1|  RING/U-box superfamily protein, putative iso...  59.3    3e-07   
ref|XP_007026703.1|  RING/U-box superfamily protein, putative iso...  58.9    3e-07   
ref|XP_007026701.1|  RING/U-box superfamily protein, putative iso...  58.9    3e-07   
ref|XP_007026702.1|  RING/U-box superfamily protein, putative iso...  58.9    3e-07   
ref|XP_007026704.1|  RING/U-box superfamily protein, putative iso...  58.5    4e-07   
ref|XP_010037700.1|  PREDICTED: uncharacterized protein LOC104426377  58.5    4e-07   Eucalyptus grandis [rose gum]
emb|CDX80772.1|  BnaC03g00260D                                        58.2    5e-07   
ref|XP_009130651.1|  PREDICTED: uncharacterized protein LOC103855419  58.2    5e-07   Brassica rapa
emb|CDY11200.1|  BnaA03g00360D                                        58.2    5e-07   Brassica napus [oilseed rape]
gb|KDP24449.1|  hypothetical protein JCGZ_25013                       58.2    6e-07   Jatropha curcas
ref|XP_008220824.1|  PREDICTED: uncharacterized protein LOC103320859  58.2    6e-07   Prunus mume [ume]
ref|XP_008370095.1|  PREDICTED: uncharacterized protein LOC103433605  57.8    8e-07   
ref|NP_195765.3|  RING/U-box domain-containing protein                57.0    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870915.1|  protein binding protein                          57.0    1e-06   
gb|KFK24649.1|  hypothetical protein AALP_AA8G007200                  56.6    1e-06   Arabis alpina [alpine rockcress]
ref|XP_004302551.1|  PREDICTED: uncharacterized protein LOC101309361  57.0    1e-06   Fragaria vesca subsp. vesca
ref|XP_010543205.1|  PREDICTED: uncharacterized protein LOC104816193  55.5    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_009347262.1|  PREDICTED: uncharacterized protein LOC103938936  55.1    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_010451984.1|  PREDICTED: uncharacterized protein LOC104734158  55.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008384801.1|  PREDICTED: uncharacterized protein LOC103447392  54.7    7e-06   
ref|XP_010676738.1|  PREDICTED: uncharacterized protein LOC104892488  53.9    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006481039.1|  PREDICTED: uncharacterized protein LOC102608051  53.9    1e-05   Citrus sinensis [apfelsine]
ref|XP_011019119.1|  PREDICTED: uncharacterized protein LOC105121...  53.9    1e-05   Populus euphratica
ref|XP_011019118.1|  PREDICTED: uncharacterized protein LOC105121...  53.9    1e-05   Populus euphratica
ref|XP_010423955.1|  PREDICTED: uncharacterized protein LOC104708994  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010490564.1|  PREDICTED: uncharacterized protein LOC104768319  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006429391.1|  hypothetical protein CICLE_v100136622mg          53.1    1e-05   
gb|KDO56640.1|  hypothetical protein CISIN_1g017401mg                 53.5    1e-05   Citrus sinensis [apfelsine]
ref|XP_006411024.1|  hypothetical protein EUTSA_v10016735mg           53.1    2e-05   
ref|XP_002308218.2|  hypothetical protein POPTR_0006s10120g           52.8    3e-05   Populus trichocarpa [western balsam poplar]
emb|CDY14482.1|  BnaC03g21130D                                        52.8    3e-05   Brassica napus [oilseed rape]
ref|XP_009133237.1|  PREDICTED: uncharacterized protein LOC103857...  52.8    3e-05   
emb|CDY07747.1|  BnaA03g17640D                                        52.8    3e-05   Brassica napus [oilseed rape]
ref|XP_009133239.1|  PREDICTED: uncharacterized protein LOC103857...  52.4    3e-05   Brassica rapa
ref|NP_181357.2|  RING-finger domain-containing protein               52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KCW52521.1|  hypothetical protein EUGRSUZ_J01909                   52.0    5e-05   Eucalyptus grandis [rose gum]
ref|XP_010530429.1|  PREDICTED: uncharacterized protein LOC104807018  52.0    5e-05   Tarenaya hassleriana [spider flower]
gb|AAO86832.1|  hypothetical protein                                  51.2    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAC27171.1|  hypothetical protein                                  51.2    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033006.1|  PREDICTED: uncharacterized protein LOC104422...  52.0    6e-05   Eucalyptus grandis [rose gum]
ref|XP_011095011.1|  PREDICTED: uncharacterized protein LOC105174...  51.6    7e-05   Sesamum indicum [beniseed]
ref|XP_011095012.1|  PREDICTED: uncharacterized protein LOC105174...  51.2    9e-05   Sesamum indicum [beniseed]
ref|XP_010505439.1|  PREDICTED: uncharacterized protein LOC104782256  51.2    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008355058.1|  PREDICTED: uncharacterized protein LOC103418723  51.2    1e-04   
ref|XP_010033005.1|  PREDICTED: uncharacterized protein LOC104422...  50.8    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010509208.1|  PREDICTED: uncharacterized protein LOC104785651  50.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|NP_001118468.1|  protein ABERRANT POLLEN DEVELOPMENT 4            50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279069.2|  PREDICTED: uncharacterized protein LOC100258653  50.4    2e-04   Vitis vinifera
ref|XP_011460949.1|  PREDICTED: uncharacterized protein LOC101291...  50.1    2e-04   Fragaria vesca subsp. vesca
ref|XP_011006557.1|  PREDICTED: uncharacterized protein LOC105112530  50.1    2e-04   Populus euphratica
ref|XP_011460948.1|  PREDICTED: uncharacterized protein LOC101291...  50.1    2e-04   Fragaria vesca subsp. vesca
ref|XP_002528092.1|  ubiquitin-protein ligase, putative               50.1    2e-04   
emb|CAN70836.1|  hypothetical protein VITISV_015872                   50.1    3e-04   Vitis vinifera
ref|XP_006425068.1|  hypothetical protein CICLE_v10030173mg           49.7    4e-04   Citrus clementina [clementine]
ref|XP_010517110.1|  PREDICTED: uncharacterized protein LOC104792619  48.9    4e-04   
ref|XP_010262861.1|  PREDICTED: uncharacterized protein LOC104601271  49.3    5e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_006365595.1| PREDICTED: uncharacterized protein LOC102603607 [Solanum tuberosum]
Length=466

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +2

Query  218  DDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            DDRR P PFP+R+   ++A  P+F  T+N+E V+ + DDT S +VV+ TFW FVSMTLI 
Sbjct  38   DDRRPPLPFPERNNVFHNA--PYFPATDNEEAVRLARDDTCSYIVVILTFWLFVSMTLIL  95

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            GVYG  NLQLGPNSSIMIKPNPLFV+ I VEE+D A
Sbjct  96   GVYGPGNLQLGPNSSIMIKPNPLFVKNIKVEEMDGA  131



>ref|XP_010326077.1| PREDICTED: uncharacterized protein LOC101252808 isoform X3 [Solanum 
lycopersicum]
Length=326

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  218  DDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            DDRR P PFP+R+   ++A  P+F  T+N+E V+   DDT S +VV+ TFW FV MTLI 
Sbjct  38   DDRRPPLPFPERNNVFHNA--PYFPATDNEEVVRLDRDDTCSYIVVILTFWLFVYMTLIL  95

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            GVYG  NLQLGPNSSI+IKPN LFV+ I VEE+D+A
Sbjct  96   GVYGPGNLQLGPNSSILIKPNSLFVKNIKVEEMDDA  131



>ref|XP_009796832.1| PREDICTED: uncharacterized protein LOC104243355 isoform X1 [Nicotiana 
sylvestris]
Length=460

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 95/147 (65%), Gaps = 23/147 (16%)
 Frame = +2

Query  68   MDEADRAQSTSLIVPVSETASGSGVREAEEVddddrrppqpfpqrSTAVYDDRRHPQPFP  247
            M+++DR  S       S  AS S  RE EEV   D               DDRR P PFP
Sbjct  1    MEDSDRNPS------FSGDASASTSREEEEVPVIDD--------------DDRRPPLPFP  40

Query  248  QRSTAVYDAYPPHFQPTNNDETVQ-SSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQ  424
            +R++  ++A  P+F   +N+E V   + DDTWSCVVVV TFWFFVSMTLI GVYG SNLQ
Sbjct  41   ERNSVFHNA--PYFPAADNEEAVVPLARDDTWSCVVVVLTFWFFVSMTLILGVYGPSNLQ  98

Query  425  LGPNSSIMIKPNPLFVEQITVEEIDNA  505
            LGPNSSI+IKPNPLFVE I VEE+D+A
Sbjct  99   LGPNSSILIKPNPLFVENIKVEEMDDA  125



>ref|XP_004246765.1| PREDICTED: uncharacterized protein LOC101252808 isoform X1 [Solanum 
lycopersicum]
Length=466

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  218  DDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            DDRR P PFP+R+   ++A  P+F  T+N+E V+   DDT S +VV+ TFW FV MTLI 
Sbjct  38   DDRRPPLPFPERNNVFHNA--PYFPATDNEEVVRLDRDDTCSYIVVILTFWLFVYMTLIL  95

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            GVYG  NLQLGPNSSI+IKPN LFV+ I VEE+D+A
Sbjct  96   GVYGPGNLQLGPNSSILIKPNSLFVKNIKVEEMDDA  131



>ref|XP_009598980.1| PREDICTED: uncharacterized protein LOC104094705 isoform X1 [Nicotiana 
tomentosiformis]
Length=466

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +2

Query  218  DDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQ-SSSDDtwscvvvvttfwffvsMTLI  394
            DDRR P PFP+R++  ++A  P+F   +N+E V   + DDTWSCVVVV TFWFFVSMTLI
Sbjct  37   DDRRPPLPFPERNSVFHNA--PYFPAADNEEAVVPLTRDDTWSCVVVVFTFWFFVSMTLI  94

Query  395  WGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
             GVYG SNLQLGPNSSI+IKPNPLFVE I VEE+D+A
Sbjct  95   LGVYGPSNLQLGPNSSILIKPNPLFVENIKVEEMDDA  131



>ref|XP_010326076.1| PREDICTED: uncharacterized protein LOC101252808 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 14/96 (15%)
 Frame = +2

Query  218  DDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            DDRR P PFP+R+   ++A  P+F  T+N+E V+   DDT S +V          + L +
Sbjct  38   DDRRPPLPFPERNNVFHNA--PYFPATDNEEVVRLDRDDTCSYIV----------VILTF  85

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
             ++G  NLQLGPNSSI+IKPN LFV+ I VEE+D+A
Sbjct  86   WLFG--NLQLGPNSSILIKPNSLFVKNIKVEEMDDA  119



>ref|XP_009796835.1| PREDICTED: uncharacterized protein LOC104243355 isoform X3 [Nicotiana 
sylvestris]
Length=376

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            MTLI GVYG SNLQLGPNSSI+IKPNPLFVE I VEE+D+A
Sbjct  1    MTLILGVYGPSNLQLGPNSSILIKPNPLFVENIKVEEMDDA  41



>ref|XP_009796833.1| PREDICTED: uncharacterized protein LOC104243355 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009796834.1| PREDICTED: uncharacterized protein LOC104243355 isoform X2 [Nicotiana 
sylvestris]
Length=384

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            MTLI GVYG SNLQLGPNSSI+IKPNPLFVE I VEE+D+A
Sbjct  9    MTLILGVYGPSNLQLGPNSSILIKPNPLFVENIKVEEMDDA  49



>ref|XP_009598981.1| PREDICTED: uncharacterized protein LOC104094705 isoform X2 [Nicotiana 
tomentosiformis]
Length=387

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            MTLI GVYG SNLQLGPNSSI+IKPNPLFVE I VEE+D+A
Sbjct  12   MTLILGVYGPSNLQLGPNSSILIKPNPLFVENIKVEEMDDA  52



>gb|KHG23614.1| Putative E3 ubiquitin-protein ligase XBAT35 [Gossypium arboreum]
Length=458

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  293  PTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFV  472
            P  ND +     DDTWSC++VV TFWFFVSMTLI GVYG  NLQLGPN S++I+PNPLFV
Sbjct  78   PAFNDNSSSVIRDDTWSCIIVVFTFWFFVSMTLILGVYGPMNLQLGPNCSLLIQPNPLFV  137

Query  473  EQITVEEIDN  502
            + +TVEE D 
Sbjct  138  QSVTVEEKDG  147



>gb|KJB17075.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=479

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  293  PTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFV  472
            P  ND +     DDTWSC++VV TFWFFVSMTLI GVYG  NLQLGPN S++I+PNPLFV
Sbjct  73   PAFNDNSSSVIRDDTWSCIIVVFTFWFFVSMTLILGVYGPMNLQLGPNCSLLIQPNPLFV  132

Query  473  EQITVEEIDN  502
            + +TVEE D 
Sbjct  133  QSVTVEEKDG  142



>gb|KJB17074.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=475

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  293  PTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFV  472
            P  ND +     DDTWSC++VV TFWFFVSMTLI GVYG  NLQLGPN S++I+PNPLFV
Sbjct  73   PAFNDNSSSVIRDDTWSCIIVVFTFWFFVSMTLILGVYGPMNLQLGPNCSLLIQPNPLFV  132

Query  473  EQITVEEIDN  502
            + +TVEE D 
Sbjct  133  QSVTVEEKDG  142



>gb|KHG23613.1| Putative E3 ubiquitin-protein ligase XBAT35 [Gossypium arboreum]
Length=481

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  293  PTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFV  472
            P  ND +     DDTWSC++VV TFWFFVSMTLI GVYG  NLQLGPN S++I+PNPLFV
Sbjct  78   PAFNDNSSSVIRDDTWSCIIVVFTFWFFVSMTLILGVYGPMNLQLGPNCSLLIQPNPLFV  137

Query  473  EQITVEEIDN  502
            + +TVEE D 
Sbjct  138  QSVTVEEKDG  147



>gb|KJB17073.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=476

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  293  PTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFV  472
            P  ND +     DDTWSC++VV TFWFFVSMTLI GVYG  NLQLGPN S++I+PNPLFV
Sbjct  73   PAFNDNSSSVIRDDTWSCIIVVFTFWFFVSMTLILGVYGPMNLQLGPNCSLLIQPNPLFV  132

Query  473  EQITVEEIDN  502
            + +TVEE D 
Sbjct  133  QSVTVEEKDG  142



>ref|XP_008243696.1| PREDICTED: uncharacterized protein LOC103341919 isoform X2 [Prunus 
mume]
Length=456

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +2

Query  215  YDDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLI  394
            + D RHP+     +  +  +Y  +  P   DE      DDTWSC++V+ TFWFFVSMTLI
Sbjct  35   HTDFRHPEV---ETHEIGTSYGANLSPF--DEVSTIIRDDTWSCIIVLLTFWFFVSMTLI  89

Query  395  WGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
             GVYG+S+L+LGPNSSI+++PNP+FV+ + VEE++
Sbjct  90   LGVYGSSSLELGPNSSILLQPNPIFVQSVKVEEVN  124



>ref|XP_008243690.1| PREDICTED: uncharacterized protein LOC103341919 isoform X1 [Prunus 
mume]
Length=471

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +2

Query  215  YDDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLI  394
            + D RHP+     +  +  +Y  +  P   DE      DDTWSC++V+ TFWFFVSMTLI
Sbjct  50   HTDFRHPEV---ETHEIGTSYGANLSPF--DEVSTIIRDDTWSCIIVLLTFWFFVSMTLI  104

Query  395  WGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
             GVYG+S+L+LGPNSSI+++PNP+FV+ + VEE++
Sbjct  105  LGVYGSSSLELGPNSSILLQPNPIFVQSVKVEEVN  139



>ref|XP_008243700.1| PREDICTED: uncharacterized protein LOC103341919 isoform X3 [Prunus 
mume]
 ref|XP_008243709.1| PREDICTED: uncharacterized protein LOC103341919 isoform X3 [Prunus 
mume]
 ref|XP_008243717.1| PREDICTED: uncharacterized protein LOC103341919 isoform X4 [Prunus 
mume]
Length=371

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI GVYG+S+L+LGPNSSI+++PNP+FV+ + VEE++
Sbjct  1    MTLILGVYGSSSLELGPNSSILLQPNPIFVQSVKVEEVN  39



>ref|XP_007207438.1| hypothetical protein PRUPE_ppa005117mg [Prunus persica]
 gb|EMJ08637.1| hypothetical protein PRUPE_ppa005117mg [Prunus persica]
Length=476

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 0/96 (0%)
 Frame = +2

Query  212  VYDDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTL  391
            +Y+++       Q+   +   +  H     +D       DD WSC+VV+ TFWFF SMTL
Sbjct  45   IYNEQSQHNHIEQQQQRISRTFTYHMNLLVSDVAASEMKDDVWSCLVVLVTFWFFASMTL  104

Query  392  IWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            I G YG++NL+LGPN S++I+PNP FV+ I  +E+D
Sbjct  105  ILGFYGSANLKLGPNCSLLIQPNPFFVQSIKAQELD  140



>ref|XP_007205144.1| hypothetical protein PRUPE_ppa005237mg [Prunus persica]
 gb|EMJ06343.1| hypothetical protein PRUPE_ppa005237mg [Prunus persica]
Length=471

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +2

Query  215  YDDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLI  394
            + D RHP+     +  +  +Y  +  P   DE      DDTWSC++V+ TFWFFVSMTLI
Sbjct  50   HTDFRHPEV---ETHEIGTSYGANLSPF--DEVSTIIRDDTWSCIIVLLTFWFFVSMTLI  104

Query  395  WGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
             GVYG+S+L+LGPNSSI+++P+P+FV+ + VEE++
Sbjct  105  LGVYGSSSLELGPNSSILLQPSPIFVQSVKVEELN  139



>ref|XP_008390694.1| PREDICTED: uncharacterized protein LOC103452949 [Malus domestica]
Length=489

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +2

Query  227  RHPQPFPQRSTAV-YDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGV  403
            RHP+          Y    P F     DE     +DD+WSC+VV+ TFWFFVSMTLI GV
Sbjct  74   RHPELEQNHEIGTSYGGNVPAF-----DEVSTVITDDSWSCIVVLLTFWFFVSMTLILGV  128

Query  404  YGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            YG+S L+LGPNSSI+++PNP FV+ I VEE++
Sbjct  129  YGSSILELGPNSSILLQPNPFFVQSIKVEELN  160



>ref|XP_010653293.1| PREDICTED: uncharacterized protein LOC100247198 isoform X2 [Vitis 
vinifera]
Length=338

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI GVYG+ N++LGPN SI++ PNPLFV+ + VEE+D
Sbjct  104  MTLILGVYGSVNMRLGPNCSILLHPNPLFVQYLKVEELD  142



>ref|XP_009377761.1| PREDICTED: uncharacterized protein LOC103966331 [Pyrus x bretschneideri]
Length=481

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = +2

Query  227  RHPQPFPQRSTA-VYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGV  403
            RHP+         +Y    P F     DE     +DDTWSC++V+ TFWFFVSMTLI GV
Sbjct  63   RHPELEQNHEIGTLYGGNVPAF-----DEVSTVITDDTWSCIIVLLTFWFFVSMTLILGV  117

Query  404  YGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            YG+S+L+LGPN+SI+++PNP FV+ I V+E++
Sbjct  118  YGSSSLELGPNTSILLQPNPFFVQSIKVQELN  149



>ref|XP_002264526.1| PREDICTED: uncharacterized protein LOC100247198 isoform X1 [Vitis 
vinifera]
 emb|CBI22791.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI GVYG+ N++LGPN SI++ PNPLFV+ + VEE+D
Sbjct  104  MTLILGVYGSVNMRLGPNCSILLHPNPLFVQYLKVEELD  142



>emb|CDP06483.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +2

Query  227  RHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVY  406
            R+P+   QR++  Y+AY       N  + V     D+ SC VV+  +WFFVSMT+I GVY
Sbjct  59   RYPELIQQRTSLSYNAYST--VTENAHDVVGRMRGDSLSCFVVILAYWFFVSMTMIMGVY  116

Query  407  GTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            G ++L LGP SSI+IKPN  FVE + + EI  A
Sbjct  117  GPASLLLGPYSSILIKPNSFFVEYVKIAEIHEA  149



>ref|XP_002525648.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36766.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=502

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI G YG+ NL+LGPN S +IK NPLFV+ I VEE+D
Sbjct  134  MTLILGFYGSVNLELGPNCSYLIKTNPLFVQSIKVEEVD  172



>ref|XP_007026700.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07202.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=556

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +2

Query  215  YDDRRHPQPF--PQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMT  388
            ++ R+H Q F  P+      D        +  D++     DDTWSC++VV TFWFFVSMT
Sbjct  56   HEYRQHLQHFHNPELENQHIDLVSYRGNLSGFDDSSTVIGDDTWSCIIVVLTFWFFVSMT  115

Query  389  LIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            LI GVYG  N+++GPN S++++PNP+FV+ + VEE+D+
Sbjct  116  LILGVYGAVNIRVGPNCSLLLQPNPIFVQSVKVEEVDD  153



>ref|XP_007026703.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY07205.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=484

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  RRHPQPF--PQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            R+H Q F  P+      D        +  D++     DDTWSC++VV TFWFFVSMTLI 
Sbjct  59   RQHLQHFHNPELENQHIDLVSYRGNLSGFDDSSTVIGDDTWSCIIVVLTFWFFVSMTLIL  118

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            GVYG  N+++GPN S++++PNP+FV+ + VEE+D+
Sbjct  119  GVYGAVNIRVGPNCSLLLQPNPIFVQSVKVEEVDD  153



>ref|XP_007026701.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07203.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=488

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  RRHPQPF--PQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            R+H Q F  P+      D        +  D++     DDTWSC++VV TFWFFVSMTLI 
Sbjct  59   RQHLQHFHNPELENQHIDLVSYRGNLSGFDDSSTVIGDDTWSCIIVVLTFWFFVSMTLIL  118

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            GVYG  N+++GPN S++++PNP+FV+ + VEE+D+
Sbjct  119  GVYGAVNIRVGPNCSLLLQPNPIFVQSVKVEEVDD  153



>ref|XP_007026702.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY07204.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=491

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  RRHPQPF--PQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            R+H Q F  P+      D        +  D++     DDTWSC++VV TFWFFVSMTLI 
Sbjct  59   RQHLQHFHNPELENQHIDLVSYRGNLSGFDDSSTVIGDDTWSCIIVVLTFWFFVSMTLIL  118

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            GVYG  N+++GPN S++++PNP+FV+ + VEE+D+
Sbjct  119  GVYGAVNIRVGPNCSLLLQPNPIFVQSVKVEEVDD  153



>ref|XP_007026704.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
 gb|EOY07206.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
Length=464

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +2

Query  224  RRHPQPF--PQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIW  397
            R+H Q F  P+      D        +  D++     DDTWSC++VV TFWFFVSMTLI 
Sbjct  59   RQHLQHFHNPELENQHIDLVSYRGNLSGFDDSSTVIGDDTWSCIIVVLTFWFFVSMTLIL  118

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            GVYG  N+++GPN S++++PNP+FV+ + VEE+D+
Sbjct  119  GVYGAVNIRVGPNCSLLLQPNPIFVQSVKVEEVDD  153



>ref|XP_010037700.1| PREDICTED: uncharacterized protein LOC104426377 [Eucalyptus grandis]
 gb|KCW49455.1| hypothetical protein EUGRSUZ_K02982 [Eucalyptus grandis]
Length=479

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI GVYG+ +++LGPN+SI+++PNP+FV+ + VEE+D+
Sbjct  105  MTLILGVYGSVSMRLGPNTSIIVQPNPIFVQSLKVEELDD  144



>emb|CDX80772.1| BnaC03g00260D [Brassica napus]
Length=445

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+N+ LGPNSS +IKP  LFV+ + VEE+ N
Sbjct  85   MTLILGLYGTTNVWLGPNSSFLIKPTSLFVQTVIVEELGN  124



>ref|XP_009130651.1| PREDICTED: uncharacterized protein LOC103855419 [Brassica rapa]
Length=444

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  266  YDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSI  445
            YD        + N     +SS+D WSCVVVV TF  FVSMTLI G+YGT+N+ LGPNSS 
Sbjct  45   YDYRHGSIVASENPRNTSTSSEDPWSCVVVVATFCVFVSMTLILGLYGTTNVWLGPNSSF  104

Query  446  MIKPNPLFVEQITVEEIDN  502
            +IKP  +FV+ + VEE+ N
Sbjct  105  LIKPTSVFVQTVIVEELGN  123



>emb|CDY11200.1| BnaA03g00360D [Brassica napus]
Length=444

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +2

Query  266  YDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSI  445
            YD        + N     +SS+D WSCVVVV TF  FVSMTLI G+YGT+N+ LGPNSS 
Sbjct  45   YDYRHGSIVASENPRNTSTSSEDPWSCVVVVATFCVFVSMTLILGLYGTTNVWLGPNSSF  104

Query  446  MIKPNPLFVEQITVEEIDN  502
            +IKP  +FV+ + VEE+ N
Sbjct  105  LIKPTSVFVQTVIVEELGN  123



>gb|KDP24449.1| hypothetical protein JCGZ_25013 [Jatropha curcas]
Length=481

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI GVYG +++ +GPNSS +I+PNP+FV+ I VEE+D+
Sbjct  107  MTLILGVYGAASIMIGPNSSALIQPNPIFVQSIKVEELDS  146



>ref|XP_008220824.1| PREDICTED: uncharacterized protein LOC103320859 [Prunus mume]
Length=481

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI G YG++NL+LGPN S++I+PNP FV+ I  +E+D
Sbjct  107  MTLILGFYGSANLKLGPNCSLLIQPNPFFVQSIKAQELD  145



>ref|XP_008370095.1| PREDICTED: uncharacterized protein LOC103433605 [Malus domestica]
Length=481

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            +TLI GVYG+S+L+LGPN+SI+++PNP FV+ I V+E++
Sbjct  111  LTLILGVYGSSSLELGPNTSILLQPNPFFVQSIKVQELN  149



>ref|NP_195765.3| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAT71924.1| At5g01450 [Arabidopsis thaliana]
 gb|AAU94421.1| At5g01450 [Arabidopsis thaliana]
 dbj|BAF00891.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90346.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=444

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+N+ LGPNSS +IKP  +FV+ + VEE+ N
Sbjct  86   MTLILGLYGTTNVWLGPNSSFLIKPTSVFVQNVIVEELGN  125



>ref|XP_002870915.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47174.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+N+ LGPNSS +IKP  +FV+ + VEE+ N
Sbjct  86   MTLILGLYGTTNVWLGPNSSFLIKPTSVFVQNVIVEELGN  125



>gb|KFK24649.1| hypothetical protein AALP_AA8G007200 [Arabis alpina]
Length=440

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+N+ LGPNSS +IKP  +FV+ + VEE+ N
Sbjct  82   MTLILGLYGTTNVWLGPNSSFLIKPTSVFVQTVIVEELGN  121



>ref|XP_004302551.1| PREDICTED: uncharacterized protein LOC101309361 [Fragaria vesca 
subsp. vesca]
Length=470

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  305  DETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQIT  484
            DET     DDTWSC++V+ TFWFFVSMTLI GVYG+  ++LGP++SI+++PNP+FV+ + 
Sbjct  79   DETASVIRDDTWSCIIVLLTFWFFVSMTLILGVYGSETMELGPDTSILLQPNPIFVQSMK  138

Query  485  VEEID  499
            VEE++
Sbjct  139  VEELN  143



>ref|XP_010543205.1| PREDICTED: uncharacterized protein LOC104816193 [Tarenaya hassleriana]
Length=443

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 11/93 (12%)
 Frame = +2

Query  221  DRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLIWG  400
            DRRH   F  R          H     +D    S++DD WSCVVVV TF+ FVSMTLI G
Sbjct  43   DRRH-DSFAHR----------HGSVATSDNAGDSTTDDPWSCVVVVVTFYVFVSMTLIMG  91

Query  401  VYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            +YGT+ + LGPNSS +++P  +FV+ + VE++D
Sbjct  92   LYGTTTVWLGPNSSFLVQPTSVFVQSVIVEQLD  124



>ref|XP_009347262.1| PREDICTED: uncharacterized protein LOC103938936 [Pyrus x bretschneideri]
Length=460

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEE  493
            V+ S DD WS + V+ TFWFF SMT+I G YG+ NLQLGPN S +I+ NP FV+ I  +E
Sbjct  63   VEVSEDDIWSALAVLVTFWFFASMTMILGFYGSGNLQLGPNCSRLIQTNPFFVQSIKAQE  122

Query  494  ID  499
            +D
Sbjct  123  LD  124



>ref|XP_010451984.1| PREDICTED: uncharacterized protein LOC104734158 [Camelina sativa]
Length=448

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +2

Query  215  YDDRRHPQPFPQRSTAVYDAYPPHFQPTNNDETVQSSSDDtwscvvvvttfwffvsMTLI  394
            +D R  P   P   T  YD        + N     +SS+D WSCVVVV TF  FVSMTLI
Sbjct  38   FDQRDRP---PWNRTE-YDYRHGSIVASENVRDSSTSSEDPWSCVVVVATFCIFVSMTLI  93

Query  395  WGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
             G+YGT+ + LGPNSS +IKP  +FV+ + VEE+ N
Sbjct  94   LGLYGTTTVWLGPNSSFLIKPTSVFVQNVIVEELGN  129



>ref|XP_008384801.1| PREDICTED: uncharacterized protein LOC103447392 [Malus domestica]
Length=467

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MTLI G YG+ NLQLGPN S +I+ NP FV+ I  +E+D
Sbjct  93   MTLILGFYGSGNLQLGPNCSRLIQTNPFFVQSIKAQELD  131



>ref|XP_010676738.1| PREDICTED: uncharacterized protein LOC104892488 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVE  490
            MTLI G++G+ NLQ+GP SSI+++PNPLFV  + VE
Sbjct  90   MTLIMGIFGSENLQVGPCSSILLRPNPLFVHTLKVE  125



>ref|XP_006481039.1| PREDICTED: uncharacterized protein LOC102608051 [Citrus sinensis]
Length=476

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI GVYG  NL LGP SSI+++P+P FV+++ V+EI
Sbjct  104  MTLILGVYGPENLTLGPKSSILLQPSPFFVQKVKVQEI  141



>ref|XP_011019119.1| PREDICTED: uncharacterized protein LOC105121941 isoform X2 [Populus 
euphratica]
Length=403

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI GVYG++ L LGP  SI++ PNPLFV+ I VE++
Sbjct  30   MTLILGVYGSTRLTLGPKCSILLPPNPLFVQSIKVEQL  67



>ref|XP_011019118.1| PREDICTED: uncharacterized protein LOC105121941 isoform X1 [Populus 
euphratica]
Length=466

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI GVYG++ L LGP  SI++ PNPLFV+ I VE++
Sbjct  93   MTLILGVYGSTRLTLGPKCSILLPPNPLFVQSIKVEQL  130



>ref|XP_010423955.1| PREDICTED: uncharacterized protein LOC104708994 [Camelina sativa]
Length=445

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+ + LGPN+S +IKP  +FV+ + VEE+ N
Sbjct  87   MTLILGLYGTTTVWLGPNASFLIKPTSVFVQNVIVEELGN  126



>ref|XP_010490564.1| PREDICTED: uncharacterized protein LOC104768319 [Camelina sativa]
Length=443

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI G+YGT+ + LGPN+S +IKP  +FV+ + VEE+ N
Sbjct  85   MTLILGLYGTTTVWLGPNASFLIKPTSVFVQNVIVEELGN  124



>ref|XP_006429391.1| hypothetical protein CICLE_v100136622mg, partial [Citrus clementina]
 gb|ESR42631.1| hypothetical protein CICLE_v100136622mg, partial [Citrus clementina]
Length=263

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  326  SDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            SDDTWS ++V  TFWFFVSMTLI GVYG  NL LGP SSI+++P+P FV+++ V+EI
Sbjct  85   SDDTWSFIIVALTFWFFVSMTLILGVYGPENLTLGPKSSILLQPSPFFVQKVKVQEI  141



>gb|KDO56640.1| hypothetical protein CISIN_1g017401mg [Citrus sinensis]
Length=372

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI GVYG  NL LGP SSI+++P+P FV+++ V+EI
Sbjct  116  MTLILGVYGPENLTLGPKSSILLQPSPFFVQKVKVQEI  153



>ref|XP_006411024.1| hypothetical protein EUTSA_v10016735mg [Eutrema salsugineum]
 gb|ESQ52477.1| hypothetical protein EUTSA_v10016735mg [Eutrema salsugineum]
Length=408

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            M +I GVYG  N+ +GPNSSI+I+PNP+FV+ + V+++D
Sbjct  72   MVMIEGVYGPENVWIGPNSSILIEPNPIFVQSVKVKDLD  110



>ref|XP_002308218.2| hypothetical protein POPTR_0006s10120g [Populus trichocarpa]
 gb|EEE91741.2| hypothetical protein POPTR_0006s10120g [Populus trichocarpa]
Length=471

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI GVYG+  L LGP  SI++ PNPLFV+ I VE++
Sbjct  98   MTLILGVYGSMRLTLGPKCSILLPPNPLFVQSIKVEQL  135



>emb|CDY14482.1| BnaC03g21130D [Brassica napus]
Length=415

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            M +I GVYG  N+ LGPNSS++I+PN +FV+ + V+E+D++
Sbjct  72   MAMIVGVYGPRNVCLGPNSSVLIEPNTIFVQSVKVKELDDS  112



>ref|XP_009133237.1| PREDICTED: uncharacterized protein LOC103857765 isoform X1 [Brassica 
rapa]
 ref|XP_009133238.1| PREDICTED: uncharacterized protein LOC103857765 isoform X1 [Brassica 
rapa]
Length=434

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            M +I GVYG  N+ +GPNSSI+I+PN +FV+ + V+E+D++
Sbjct  72   MAMIVGVYGPRNVWIGPNSSILIEPNTIFVQSVKVKELDDS  112



>emb|CDY07747.1| BnaA03g17640D [Brassica napus]
Length=435

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            M +I GVYG  N+ +GPNSSI+I+PN +FV+ + V+E+D++
Sbjct  73   MAMIVGVYGPRNVWIGPNSSILIEPNTIFVQSVKVKELDDS  113



>ref|XP_009133239.1| PREDICTED: uncharacterized protein LOC103857765 isoform X2 [Brassica 
rapa]
Length=407

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            M +I GVYG  N+ +GPNSSI+I+PN +FV+ + V+E+D++
Sbjct  45   MAMIVGVYGPRNVWIGPNSSILIEPNTIFVQSVKVKELDDS  85



>ref|NP_181357.2| RING-finger domain-containing protein [Arabidopsis thaliana]
 gb|AEC09510.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=404

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            + LI+GVYG+  + LGPNSSI++KP+ +FV+ I V+E+D
Sbjct  54   VCLIFGVYGSETVWLGPNSSILVKPSSIFVKSIKVKELD  92



>gb|KCW52521.1| hypothetical protein EUGRSUZ_J01909 [Eucalyptus grandis]
Length=518

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 12/99 (12%)
 Frame = +2

Query  221  DRRHPQPFPQRSTAVYDAYPPH--FQPTNNDETVQSS--SDDtwscvvvvttfwffvsMT  388
            DR+ P+P+  R        PPH  ++   N   +  S  +DD  S +VV+  FWFF S+T
Sbjct  68   DRQRPRPWLWR--------PPHVSYRVDVNFSNLNPSGMTDDVRSSLVVLVVFWFFASLT  119

Query  389  LIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            LI G YG  N +LGPN S +I+ NP+FV  I VEE D +
Sbjct  120  LILGFYGPENFELGPNCSRLIQTNPIFVHSIKVEEFDES  158



>ref|XP_010530429.1| PREDICTED: uncharacterized protein LOC104807018 [Tarenaya hassleriana]
Length=483

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI GVYG+ N  +GPNSS+++  NP FV+ I V ++D+
Sbjct  103  MTLILGVYGSKNTWIGPNSSVLVDLNPFFVQSIKVNQLDD  142



>gb|AAO86832.1| hypothetical protein [Arabidopsis thaliana]
Length=221

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            + LI+GVYG+  + LGPNSSI++KP+ +FV+ I V+E+D
Sbjct  54   VCLIFGVYGSETVWLGPNSSILVKPSSIFVKSIKVKELD  92



>gb|AAC27171.1| hypothetical protein [Arabidopsis thaliana]
Length=257

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            + LI+GVYG+  + LGPNSSI++KP+ +FV+ I V+E+D
Sbjct  54   VCLIFGVYGSETVWLGPNSSILVKPSSIFVKSIKVKELD  92



>ref|XP_010033006.1| PREDICTED: uncharacterized protein LOC104422386 isoform X2 [Eucalyptus 
grandis]
 gb|KCW52520.1| hypothetical protein EUGRSUZ_J01909 [Eucalyptus grandis]
Length=491

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 12/99 (12%)
 Frame = +2

Query  221  DRRHPQPFPQRSTAVYDAYPPH--FQPTNNDETVQSS--SDDtwscvvvvttfwffvsMT  388
            DR+ P+P+  R        PPH  ++   N   +  S  +DD  S +VV+  FWFF S+T
Sbjct  68   DRQRPRPWLWR--------PPHVSYRVDVNFSNLNPSGMTDDVRSSLVVLVVFWFFASLT  119

Query  389  LIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            LI G YG  N +LGPN S +I+ NP+FV  I VEE D +
Sbjct  120  LILGFYGPENFELGPNCSRLIQTNPIFVHSIKVEEFDES  158



>ref|XP_011095011.1| PREDICTED: uncharacterized protein LOC105174567 isoform X1 [Sesamum 
indicum]
Length=461

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  DETVQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQIT  484
            +E   S  DD  SC +  TTF F V+MT+ +G+YG+  L+LGPN+SI+I PN LFVE + 
Sbjct  66   NENSSSLRDDDKSCFIASTTFSFLVAMTVAFGLYGSETLRLGPNTSILITPNHLFVESVK  125

Query  485  VEEIDNA  505
            V E+  A
Sbjct  126  VVELGAA  132



>ref|XP_011095012.1| PREDICTED: uncharacterized protein LOC105174567 isoform X2 [Sesamum 
indicum]
Length=460

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            MT+ +G+YG+  L+LGPN+SI+I PN LFVE + V E+  A
Sbjct  91   MTVAFGLYGSETLRLGPNTSILITPNHLFVESVKVVELGAA  131



>ref|XP_010505439.1| PREDICTED: uncharacterized protein LOC104782256 [Camelina sativa]
Length=367

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            + LI GVYG+ N+ LGPNSSI+++P+ +FV+ I V+E+D
Sbjct  46   VVLIEGVYGSQNIWLGPNSSILVEPSSIFVQSIKVKELD  84



>ref|XP_008355058.1| PREDICTED: uncharacterized protein LOC103418723 [Malus domestica]
Length=460

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            MT+I G YG+ NLQLGPN S +I+ NP FV+ I  +E D
Sbjct  87   MTMILGFYGSDNLQLGPNCSRLIQTNPFFVQSIKAQEHD  125



>ref|XP_010033005.1| PREDICTED: uncharacterized protein LOC104422386 isoform X1 [Eucalyptus 
grandis]
Length=492

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDNA  505
            +TLI G YG  N +LGPN S +I+ NP+FV  I VEE D +
Sbjct  119  LTLILGFYGPENFELGPNCSRLIQTNPIFVHSIKVEEFDES  159



>ref|XP_010509208.1| PREDICTED: uncharacterized protein LOC104785651 [Camelina sativa]
Length=365

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  389  LIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            LI GVYG+ N+ LGPNSSI+++P+ +FV+ I V+E+D
Sbjct  48   LIVGVYGSQNIWLGPNSSILVEPSSIFVQSIKVKELD  84



>ref|NP_001118468.1| protein ABERRANT POLLEN DEVELOPMENT 4 [Arabidopsis thaliana]
 gb|AEC09508.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=399

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            + LI+GVYG+  + LGPNSSI++KP+ +FV+ I  +E+D
Sbjct  54   VCLIFGVYGSETVWLGPNSSILVKPSSIFVKSINAKELD  92



>ref|XP_002279069.2| PREDICTED: uncharacterized protein LOC100258653 [Vitis vinifera]
 emb|CBI15953.3| unnamed protein product [Vitis vinifera]
Length=485

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            M LI G YG++N+QLGP+ S ++K N  FV+ I V+EID
Sbjct  108  MALILGFYGSANVQLGPHCSRLVKANSFFVQTIKVQEID  146



>ref|XP_011460949.1| PREDICTED: uncharacterized protein LOC101291029 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=449

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MT+I G +G+++LQLGPN S +I+ NP FV+ I  +EI+ 
Sbjct  78   MTMILGFFGSADLQLGPNCSRLIRTNPFFVQTIKAQEIEG  117



>ref|XP_011006557.1| PREDICTED: uncharacterized protein LOC105112530 [Populus euphratica]
Length=470

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VQSSSDDtwscvvvvttfwffvsMTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEE  493
            V S  DDT SCVVVV TFWFFVSMT+I GVYG+  L LGP  S++++P P+FV+ I VE+
Sbjct  74   VASVRDDTCSCVVVVLTFWFFVSMTMILGVYGSMRLTLGPKCSVLLQPTPIFVQSIKVEQ  133

Query  494  I  496
            +
Sbjct  134  L  134



>ref|XP_011460948.1| PREDICTED: uncharacterized protein LOC101291029 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=452

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MT+I G +G+++LQLGPN S +I+ NP FV+ I  +EI+ 
Sbjct  78   MTMILGFFGSADLQLGPNCSRLIRTNPFFVQTIKAQEIEG  117



>ref|XP_002528092.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF34271.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=460

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEIDN  502
            MTLI GVYG  ++ +GPN+S +I+ NP FV+ I V+E+D+
Sbjct  86   MTLILGVYGPVSVMIGPNTSALIRTNPFFVQSIKVQELDS  125



>emb|CAN70836.1| hypothetical protein VITISV_015872 [Vitis vinifera]
Length=922

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            M LI G YG++N+QLGP+ S ++K N  FV+ I V+EID
Sbjct  108  MALILGFYGSANVQLGPHCSRLVKANSFFVQTIKVQEID  146



>ref|XP_006425068.1| hypothetical protein CICLE_v10030173mg [Citrus clementina]
 gb|ESR38308.1| hypothetical protein CICLE_v10030173mg [Citrus clementina]
Length=449

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  386  TLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            T+I+GVYG+S LQLGP+ S  I  NPLFV+ I  +E+D
Sbjct  74   TMIFGVYGSSELQLGPHCSRPIHTNPLFVQSIKAQELD  111



>ref|XP_010517110.1| PREDICTED: uncharacterized protein LOC104792619 [Camelina sativa]
Length=303

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  398  GVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEID  499
            GVYG+ N+ LGPNSSI+++P+ +FV+ I V+E+D
Sbjct  14   GVYGSQNIWLGPNSSILVEPSSIFVQSIKVKELD  47



>ref|XP_010262861.1| PREDICTED: uncharacterized protein LOC104601271 [Nelumbo nucifera]
Length=469

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  MTLIWGVYGTSNLQLGPNSSIMIKPNPLFVEQITVEEI  496
            MTLI G YG+ NLQLGPN S +++ N +FV+ I V+E+
Sbjct  101  MTLILGFYGSVNLQLGPNYSRLLQANSIFVQDIKVQEL  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905