BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019D02

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP18560.1|  unnamed protein product                                147   1e-39   Coffea canephora [robusta coffee]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             147   2e-39   Nicotiana benthamiana
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   2e-39   Nicotiana sylvestris
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   5e-39   Nicotiana tomentosiformis
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    142   2e-37   Nelumbo nucifera [Indian lotus]
gb|AAF03099.1|AF162198_1  NADP-dependent glyceraldehyde phosphate...    132   1e-36   Lactuca sativa [cultivated lettuce]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                139   1e-36   Arachis hypogaea [goober]
gb|AAF19788.1|AF162202_1  NADP-dependent glyceraldehyde phosphate...    132   2e-36   Lactuca sativa [cultivated lettuce]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         135   3e-35   Morus notabilis
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    134   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    133   2e-34   Solanum tuberosum [potatoes]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    133   3e-34   Sesamum indicum [beniseed]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    133   3e-34   Fragaria vesca subsp. vesca
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    132   4e-34   Nicotiana tabacum [American tobacco]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   5e-34   Cucumis melo [Oriental melon]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   8e-34   Solanum lycopersicum
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    131   1e-33   Solanum lycopersicum
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         130   2e-33   Medicago truncatula
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   2e-33   Eucalyptus grandis [rose gum]
gb|EPS59235.1|  hypothetical protein M569_15573                         130   2e-33   Genlisea aurea
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    130   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    130   3e-33   Theobroma cacao [chocolate]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   4e-33   Malus domestica [apple tree]
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    128   6e-33   Phaseolus vulgaris [French bean]
emb|CBI21236.3|  unnamed protein product                                127   7e-33   Vitis vinifera
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              129   9e-33   Scoparia dulcis [escobilla]
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                129   9e-33   Bruguiera gymnorhiza [Burma mangrove]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             129   9e-33   Cucumis sativus [cucumbers]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             129   1e-32   Prunus persica
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   1e-32   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    129   1e-32   Glycine soja [wild soybean]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    129   1e-32   Glycine soja [wild soybean]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   1e-32   
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   1e-32   Prunus mume [ume]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   1e-32   Pyrus x bretschneideri [bai li]
gb|ACU21011.1|  unknown                                                 129   1e-32   Glycine max [soybeans]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   1e-32   Malus domestica [apple tree]
gb|KJB11771.1|  hypothetical protein B456_001G276400                    128   1e-32   Gossypium raimondii
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    128   1e-32   Spinacia oleracea
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   1e-32   
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              128   1e-32   Phaseolus vulgaris [French bean]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   2e-32   Cicer arietinum [garbanzo]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             128   2e-32   Phaseolus vulgaris [French bean]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    128   2e-32   Gossypium raimondii
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    128   2e-32   Ricinus communis
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   2e-32   Vitis vinifera
emb|CAN78872.1|  hypothetical protein VITISV_021726                     127   3e-32   Vitis vinifera
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    127   3e-32   
gb|ABK96233.1|  unknown                                                 127   3e-32   Populus trichocarpa x Populus deltoides
gb|ABK96725.1|  unknown                                                 127   3e-32   Populus trichocarpa x Populus deltoides
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   4e-32   Cucumis melo [Oriental melon]
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    127   4e-32   Gossypium arboreum [tree cotton]
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    127   4e-32   Gossypium arboreum [tree cotton]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   4e-32   Populus euphratica
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       127   5e-32   Medicago sativa [alfalfa]
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          126   1e-31   Amborella trichopoda
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                126   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   1e-31   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             125   1e-31   Capsella rubella
ref|XP_002875330.1|  gapa                                               125   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             125   2e-31   Populus trichocarpa [western balsam poplar]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                125   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   2e-31   Camelina sativa [gold-of-pleasure]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    125   2e-31   Arabis alpina [alpine rockcress]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    125   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             125   2e-31   Eutrema salsugineum [saltwater cress]
gb|ACN40000.1|  unknown                                                 125   2e-31   Picea sitchensis
gb|ABK24313.1|  unknown                                                 125   2e-31   Picea sitchensis
gb|ABK25233.1|  unknown                                                 125   2e-31   Picea sitchensis
gb|ACN40537.1|  unknown                                                 125   3e-31   Picea sitchensis
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   3e-31   Populus euphratica
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             125   3e-31   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             124   3e-31   Citrus clementina [clementine]
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   3e-31   
gb|ABK94956.1|  unknown                                                 124   4e-31   Populus trichocarpa [western balsam poplar]
gb|AGJ50596.1|  GAPDH                                                   124   4e-31   Pericallis cruenta
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             124   5e-31   Eutrema salsugineum [saltwater cress]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   5e-31   Brassica rapa
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   5e-31   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          124   5e-31   Brassica napus [oilseed rape]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               124   5e-31   Brassica rapa subsp. chinensis [bok-choy]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    124   6e-31   Arabis alpina [alpine rockcress]
emb|CDY26599.1|  BnaA09g46780D                                          124   7e-31   Brassica napus [oilseed rape]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                124   7e-31   Mangifera indica
emb|CAA33264.1|  unnamed protein product                                123   9e-31   Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    123   9e-31   Pisum sativum [garden pea]
gb|AAA33484.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      117   1e-30   Zea mays [maize]
dbj|BAJ34149.1|  unnamed protein product                                123   1e-30   Eutrema halophilum
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    123   1e-30   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    123   1e-30   
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    123   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    122   2e-30   Brassica rapa
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   2e-30   Citrus sinensis [apfelsine]
emb|CDY13649.1|  BnaA06g32740D                                          122   2e-30   Brassica napus [oilseed rape]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   122   2e-30   Citrus sinensis [apfelsine]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   122   2e-30   Citrus sinensis [apfelsine]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY28536.1|  BnaC02g36240D                                          122   3e-30   Brassica napus [oilseed rape]
emb|CDX83635.1|  BnaC07g23750D                                          121   4e-30   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             121   4e-30   
ref|XP_002892719.1|  GAPA-2                                             121   4e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   6e-30   Camelina sativa [gold-of-pleasure]
emb|CDY16038.1|  BnaC08g40850D                                          121   7e-30   Brassica napus [oilseed rape]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         120   1e-29   Jatropha curcas
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         117   2e-29   
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   3e-29   Tarenaya hassleriana [spider flower]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        119   5e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               118   6e-29   Marchantia polymorpha
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  118   6e-29   Pinus sylvestris [Scotch pine]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   6e-29   Setaria italica
emb|CDY48981.1|  BnaA02g28150D                                          117   1e-28   Brassica napus [oilseed rape]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         117   1e-28   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    117   2e-28   Zea mays [maize]
emb|CAA30152.1|  GADPH (383 AA)                                         116   3e-28   Zea mays [maize]
ref|XP_001771209.1|  predicted protein                                  116   4e-28   
gb|KHN00649.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    114   7e-28   Glycine soja [wild soybean]
ref|NP_001052984.1|  Os04g0459500                                       115   8e-28   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    115   8e-28   Oryza brachyantha
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    113   8e-28   Glycine soja [wild soybean]
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    115   9e-28   
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             115   1e-27   Selaginella moellendorffii
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             115   1e-27   Selaginella moellendorffii
ref|XP_001779769.1|  predicted protein                                  115   1e-27   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    114   2e-27   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    113   3e-27   Marchantia polymorpha
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    113   4e-27   Brachypodium distachyon [annual false brome]
dbj|BAJ90885.1|  predicted protein                                      112   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    111   1e-26   Triticum urartu
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             111   1e-26   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      111   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    110   3e-26   Pyrus x bretschneideri [bai li]
dbj|BAJ90530.1|  predicted protein                                      110   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    110   4e-26   
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    108   9e-26   Camelina sativa [gold-of-pleasure]
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     108   2e-25   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57068.1|  AT1G12900                                              108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001771246.1|  predicted protein                                  108   2e-25   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    107   5e-25   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    107   5e-25   Zea mays [maize]
ref|XP_001766703.1|  predicted protein                                  106   9e-25   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         105   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_001753934.1|  predicted protein                                  105   3e-24   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     104   4e-24   Physcomitrella patens
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    104   5e-24   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                104   5e-24   Lilium regale
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                103   9e-24   Syntrichia caninervis
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    103   1e-23   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779753.1|  predicted protein                                  102   3e-23   
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase     98.6    4e-23   Tragopogon dubius [yellow salsify]
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase     98.2    4e-23   Tragopogon pratensis [Jack-go-to-bed-at-noon]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             102   5e-23   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             102   5e-23   Selaginella moellendorffii
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               102   5e-23   Chara vulgaris
gb|ADE06487.1|  putative glyceraldehyde 3-phosphate dehydrogenase     96.7    6e-23   Tragopogon dubius [yellow salsify]
gb|ADE06488.1|  putative glyceraldehyde 3-phosphate dehydrogenase     96.3    6e-23   Tragopogon porrifolius [oyster plant]
gb|ACJ85309.1|  unknown                                               99.8    8e-23   Medicago truncatula
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              100   1e-22   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           100   1e-22   
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    101   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             100   1e-22   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   2e-22   Cucumis melo [Oriental melon]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   2e-22   
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...  99.8    2e-22
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...  99.8    2e-22   Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...  99.8    2e-22   Spinacia oleracea
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    100   3e-22   Ricinus communis
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              100   3e-22   Medicago truncatula
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    100   3e-22   Spinacia oleracea
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...  99.8    3e-22   Spinacia oleracea
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   3e-22   Populus euphratica
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g           99.8    3e-22   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    100   3e-22   Populus trichocarpa [western balsam poplar]
gb|ACJ84309.1|  unknown                                                 100   4e-22   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           100   4e-22   Medicago truncatula
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.8    4e-22   Setaria italica
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    99.4    5e-22   Mesostigma viride
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase              99.0    5e-22   Vicia sativa [spring vetch]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.8    5e-22   Nicotiana tomentosiformis
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg              96.3    6e-22   Erythranthe guttata [common monkey flower]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  98.6    7e-22   Mesostigma viride
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                 97.4    9e-22   Citrus sinensis [apfelsine]
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase         99.4    9e-22   
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                 97.8    9e-22   Citrus sinensis [apfelsine]
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                 97.4    1e-21   Citrus sinensis [apfelsine]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    1e-21   Populus euphratica
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    1e-21   Populus euphratica
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    1e-21   
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                 96.7    1e-21   Citrus sinensis [apfelsine]
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...  97.4    1e-21   Spinacia oleracea
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg           97.4    1e-21   
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                 97.4    1e-21   Citrus sinensis [apfelsine]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g           98.6    1e-21   
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.6    1e-21   Nicotiana sylvestris
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg           98.6    2e-21   Prunus persica
emb|CAA33262.1|  unnamed protein product                              98.2    2e-21   Pisum sativum [garden pea]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    2e-21   Prunus mume [ume]
gb|KJB57937.1|  hypothetical protein B456_009G186400                  97.1    2e-21   Gossypium raimondii
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  98.2    2e-21   Pisum sativum [garden pea]
emb|CAN69459.1|  hypothetical protein VITISV_021576                   98.2    2e-21   Vitis vinifera
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                 97.8    2e-21   Citrus sinensis [apfelsine]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    2e-21   Vitis vinifera
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    2e-21   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  98.2    2e-21   Elaeis guineensis
gb|KJB57939.1|  hypothetical protein B456_009G186400                  97.1    2e-21   Gossypium raimondii
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    2e-21   Phoenix dactylifera
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    2e-21   Fragaria vesca subsp. vesca
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                 96.7    2e-21   Citrus sinensis [apfelsine]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190        97.4    2e-21   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    2e-21   Cucumis sativus [cucumbers]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Nicotiana sylvestris
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Solanum lycopersicum
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Solanum tuberosum [potatoes]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase             97.8    3e-21   Solanum tuberosum [potatoes]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Citrus sinensis [apfelsine]
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    3e-21   Nicotiana tomentosiformis
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg           97.8    3e-21   Citrus clementina [clementine]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403           96.7    3e-21   Micromonas pusilla CCMP1545
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  97.4    3e-21   Nicotiana tabacum [American tobacco]
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  97.4    4e-21   
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g           97.4    4e-21   Phaseolus vulgaris [French bean]
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  97.1    4e-21   Triticum urartu
dbj|BAJ87214.1|  predicted protein                                    97.1    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86633.1|  predicted protein                                    97.1    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  97.1    4e-21   Gossypium arboreum [tree cotton]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  97.1    5e-21   Gossypium arboreum [tree cotton]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    5e-21   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B            97.1    5e-21   Scoparia dulcis [escobilla]
gb|KJB57936.1|  hypothetical protein B456_009G186400                  97.1    5e-21   Gossypium raimondii
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                  97.1    5e-21   Arabis alpina [alpine rockcress]
gb|ABR16095.1|  unknown                                               94.7    6e-21   Picea sitchensis
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    6e-21   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...  96.7    6e-21   Pyrus x bretschneideri [bai li]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg           96.7    6e-21   Eutrema salsugineum [saltwater cress]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  96.7    6e-21   
ref|NP_001240080.1|  uncharacterized protein LOC100806482             96.7    6e-21   Glycine max [soybeans]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...  96.7    7e-21   Glycine max [soybeans]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    7e-21   Sesamum indicum [beniseed]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B            96.7    7e-21   Pyrus x bretschneideri [bai li]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    7e-21   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    7e-21   
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    8e-21   Pyrus x bretschneideri [bai li]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    8e-21   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  96.3    9e-21   Glycine soja [wild soybean]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    9e-21   
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    1e-20   Eucalyptus grandis [rose gum]
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit    95.5    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14201.1|  hypothetical protein B456_002G114000                  96.3    1e-20   Gossypium raimondii
emb|CDY69523.1|  BnaC08g46180D                                        95.5    1e-20   Brassica napus [oilseed rape]
gb|EPS70760.1|  hypothetical protein M569_03997                       95.9    1e-20   Genlisea aurea
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg           95.9    1e-20   Capsella rubella
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.5    1e-20   Brassica rapa
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B          95.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  95.5    2e-20   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...  95.5    2e-20   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662            94.7    2e-20   Volvox carteri f. nagariensis
gb|ACN40006.1|  unknown                                               95.5    2e-20   Picea sitchensis
gb|ABK24645.1|  unknown                                               95.5    2e-20   Picea sitchensis
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  92.8    2e-20   Oryza sativa Japonica Group [Japonica rice]
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...  94.4    2e-20   Spinacia oleracea
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase         94.4    2e-20   Chlamydomonas reinhardtii
gb|ACN40526.1|  unknown                                               95.1    2e-20   Picea sitchensis
gb|KDP36765.1|  hypothetical protein JCGZ_08056                       95.1    2e-20   Jatropha curcas
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  94.0    3e-20   Chlamydomonas incerta
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  94.0    3e-20   Chlamydomonas incerta
dbj|BAK02737.1|  predicted protein                                    93.6    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase             93.6    3e-20   Capsicum annuum
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    5e-20   Cicer arietinum [garbanzo]
emb|CDP07271.1|  unnamed protein product                              94.4    6e-20   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...  92.8    6e-20   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...  93.2    6e-20   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    8e-20   
gb|KIY96104.1|  hypothetical protein MNEG_11860                       90.1    9e-20   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase              92.4    1e-19   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    92.0    1e-19   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  92.4    1e-19   
gb|ACU20783.1|  unknown                                               93.2    1e-19   
ref|NP_001048847.1|  Os03g0129300                                     93.2    1e-19   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase             91.3    2e-19   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B       94.4    2e-19   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase             90.9    3e-19   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    92.0    4e-19   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase             90.1    5e-19   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B            90.5    6e-19   
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  90.1    9e-19   
ref|XP_010270465.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.8    1e-18   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  89.7    1e-18   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    89.4    1e-18   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  89.4    1e-18   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    89.0    3e-18   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase             87.4    5e-18   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    87.4    5e-18   
gb|KJB57938.1|  hypothetical protein B456_009G186400                  88.2    5e-18   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  87.8    6e-18   
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase             88.6    7e-18   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    86.7    8e-18   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase             86.7    9e-18   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase         87.0    1e-17   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase              86.7    1e-17   
ref|XP_001420043.1|  predicted protein                                86.3    1e-17   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase              85.9    2e-17   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase             84.3    6e-17   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase              84.0    8e-17   
gb|AAP80811.1|  glyceraldehyde-3-phosphate dehydrogenase precursor    81.6    8e-17   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    82.8    2e-16   
gb|ACN41006.1|  unknown                                               84.0    3e-16   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...  82.4    7e-16   
gb|ACN39951.1|  unknown                                               80.5    2e-15   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...  81.3    2e-15   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...  81.3    2e-15   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase         80.9    3e-15   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...  80.9    3e-15   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase  80.5    4e-15   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase         80.1    5e-15   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    79.7    7e-15   
gb|ABR18416.1|  unknown                                               80.1    8e-15   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    79.0    8e-15   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase             77.8    1e-14   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269            76.3    4e-14   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    77.0    6e-14   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase              75.5    8e-14   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  76.6    1e-13   
ref|XP_001415434.1|  predicted protein                                76.3    1e-13   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  76.3    1e-13   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase              73.9    2e-13   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase         73.2    9e-13   
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase         72.8    1e-12   
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase              72.4    1e-12   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase         72.4    1e-12   
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase         72.0    2e-12   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  72.0    2e-12   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase         72.0    2e-12   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  71.6    3e-12   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  71.6    3e-12   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  71.6    3e-12   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...  72.0    4e-12   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       72.0    4e-12   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         71.2    4e-12   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...  70.9    4e-12   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  72.0    4e-12   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         71.6    5e-12   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    5e-12   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  70.9    6e-12   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    7e-12   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase         70.5    8e-12   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         70.5    8e-12   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase         70.1    9e-12   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase         70.1    9e-12   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       70.1    1e-11   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         70.1    1e-11   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  70.1    1e-11   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  69.7    2e-11   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  69.7    2e-11   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...  69.7    2e-11   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  69.3    2e-11   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  69.3    2e-11   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           69.7    2e-11   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       69.3    2e-11   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  69.3    2e-11   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         68.9    2e-11   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+       68.9    3e-11   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  68.6    3e-11   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  68.6    4e-11   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           68.6    4e-11   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           68.6    4e-11   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           68.6    4e-11   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           68.6    4e-11   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      68.6    5e-11   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...  68.2    5e-11   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    5e-11   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    5e-11   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  68.2    6e-11   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  68.2    6e-11   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  68.2    6e-11   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    6e-11   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    8e-11   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  67.8    8e-11   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    8e-11   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    8e-11   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    8e-11   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    8e-11   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  67.4    9e-11   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  67.4    1e-10   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  67.4    1e-10   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  67.4    1e-10   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    1e-10   
gb|AFK38236.1|  unknown                                               64.7    1e-10   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase              67.0    1e-10   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  67.0    1e-10   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    2e-10   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  67.0    2e-10   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.6    2e-10   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  66.6    2e-10   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      66.6    2e-10   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  66.2    2e-10   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.2    3e-10   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.2    3e-10   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase              65.9    4e-10   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    4e-10   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    4e-10   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.9    4e-10   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase              65.9    4e-10   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    5e-10   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2   65.5    5e-10   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.5    5e-10   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    5e-10   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    5e-10   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.5    5e-10   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    6e-10   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.1    6e-10   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              65.1    6e-10   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.1    7e-10   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.1    7e-10   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...  65.1    8e-10   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    9e-10   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    2e-09   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    2e-09   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    3e-09   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    3e-09   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      63.2    3e-09   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  63.2    3e-09   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    3e-09   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    3e-09   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    3e-09   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  63.2    4e-09   
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    4e-09   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  62.8    4e-09   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    6e-09   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase             62.4    6e-09   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase              62.4    9e-09   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase         62.0    9e-09   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase         62.0    9e-09   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-08   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-08   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-08   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-08   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              61.2    1e-08   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-08   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  61.2    2e-08   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-08   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...  61.2    2e-08   
emb|CAC80998.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  60.8    2e-08   
ref|WP_007101108.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-08   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  60.1    3e-08   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  60.1    4e-08   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-08   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  59.7    5e-08   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-08   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    7e-08   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  59.3    7e-08   
emb|CAC81000.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  58.9    8e-08   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase    59.3    9e-08   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-07   
ref|WP_010313976.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    2e-07   



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 90/114 (79%), Gaps = 5/114 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MASAALSVANS+L QVSNKG S       SS      A    DDL SVV+FQTSV+GG K
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFAGLRSSSLPFARKAS---DDLLSVVAFQTSVIGGGK  56

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  57   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  110



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  111



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  58   SKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  111



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MASAAL+VANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALTVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  111



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 90/114 (79%), Gaps = 3/114 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  218
            MASA LSVANS L Q + KG S       SS+S     + S DDL SV++FQTSVVGG  
Sbjct  1    MASATLSVANSAL-QANGKGFSEFSGLRNSSASLPFARKAS-DDLLSVIAFQTSVVGGNG  58

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  112



>gb|AAF03099.1|AF162198_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MAS A S+AN++L QV+ KG S       SS+S     + S DD  S+V+FQT++VGG K
Sbjct  1    MASTAFSMANASL-QVNGKGFSEFAGLRSSSASLPFGRKGS-DDFASMVAFQTTLVGGSK  58

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   TPKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  112



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L     KG S       SSSS LPF+R++ DD HS++SFQTS VG  G
Sbjct  1    MASATLSVAKPALQGNGGKGFSEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSG  60

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  61   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  115



>gb|AAF19788.1|AF162202_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  218
            MAS A S+AN++L QV+ KG S       SS+S     + S DD  S+V+FQT++VGG K
Sbjct  1    MASTAFSMANASL-QVNGKGFSEFAGLRSSSASLPFGRKGS-DDFVSMVAFQTTLVGGSK  58

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   TPKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  112



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q S KG S       S++S     + S DD  SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QASGKGFSEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSG  59

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG+KQASHLL
Sbjct  60   GYKKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLL  114



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  218
            MAS  LSVAN +L Q + KG S       SS+S     + S DD  SV++FQTS VGG  
Sbjct  1    MASTTLSVANPSL-QANGKGFSDFSGLRISSASLPFARKTS-DDFLSVIAFQTSAVGGSG  58

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  112



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +3

Query  51   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  227
            AALSVAN++L +VSNKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVSNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  228  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  109



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            DD  SV++FQTSVVGG K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  38   DDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  97

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  98   DTGGVKQASHLL  109



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +  Q + KG +       SS++SL F RR+ DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPS-PQANGKGFAEFAGLRNSSAASLCFGRRTSDDLFSVIAFQTSAVGTNG  59

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              +R + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  60   GYKRGITEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            DDL SVV+FQTSV+GG   +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  31   DDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  90

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  91   DTGGVKQASHLL  102



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSIQQANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  59

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  60   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +3

Query  51   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  227
            AALSVAN++L +V+NKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVNNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  228  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  109



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 93/119 (78%), Gaps = 6/119 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYD-DLHSVVSFQTSVVGGK  218
            MASAALSVANS++H   NKG  SEF+GLR+SS+         + DL S+V++QTSV+ G 
Sbjct  1    MASAALSVANSSVHVSKNKGSFSEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGA  60

Query  219  QRRA-----VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             +       VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND+GGVKQASHLL
Sbjct  61   GKNNNNNSRVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLL  119



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+SFQT+ VG   
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISFQTNAVGSSG  58

Query  222  RR---AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R     VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   RSKKGVVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASAALSVA  +L Q + KG +       S+S S        +D  SV++FQTS VG  G
Sbjct  1    MASAALSVAKPSL-QANGKGFAEFSGLRNSASVSFGRKNS--EDFLSVIAFQTSAVGSNG  57

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGG+KQASHLL
Sbjct  58   GYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGIKQASHLL  112



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            DD  SV++FQTS VGG K  R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  34   DDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  93

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  94   DTGGVKQASHLL  105



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSAVGSNG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA +SVA  TL Q + KG         SSSS     + S DD  SVV+FQTS +G   
Sbjct  1    MASATVSVAKPTL-QANGKGFGEFSGLRNSSSSLPFPRKTS-DDFLSVVAFQTSALGSNN  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSSVGSNG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLL  113



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLL
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLL  114



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
            +D  SV++FQTS +  K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  38   EDFLSVIAFQTSAIDSKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  97

Query  348  TGGVKQASHLL  380
            TGGVKQASHLL
Sbjct  98   TGGVKQASHLL  108



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 82/116 (71%), Gaps = 4/116 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA LSVA  +  Q + KG +       SS+      + S DD  SVV+FQTS +    
Sbjct  1    MASATLSVAKPSHLQANGKGFTEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSALASSS  59

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  RRA  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  60   GGYRRAAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  115



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  113



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  113



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            M+SA LSVA  +L Q + KGL+       SS+      + S DDL SV++FQTS +G  G
Sbjct  1    MSSAILSVAKPSL-QANGKGLAEFSGLRTSSACLPFGKKTS-DDLFSVITFQTSALGSNG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  +L Q + KG +       S +      + S DDL SV++FQTS +G  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSLACLPFGRKTS-DDLFSVIAFQTSALGSNG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   VYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  338
            DD  SV++FQTS +G   G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA
Sbjct  40   DDFQSVIAFQTSALGINNGGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MAS  LS+AN +L +V NKG S       SS           DDL + VSFQT+ VGGK+
Sbjct  1    MASNMLSIANPSL-RVYNKGFSEFSGLHTSSLPFGRKGS---DDLMAFVSFQTNAVGGKR  56

Query  222  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  57   SSQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  111



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MA+A LSVA  ++ Q + KG         SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLL  113



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA  TL    N    SEFSGLR+S+  LPF+R++ DD HSVVSFQT+ VG  G
Sbjct  1    MASATLSVAKPTLK--GNGKGFSEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNG  58

Query  216  KQRRA--VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              +R   VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKRGGVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLL  115



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLL  113



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +3

Query  42   MASAALSVANSTLH-QVSNKGlssefsglr-ssssslpfarrsYDDLHSVVSFQTSVVG-  212
            MASA +SVA   L  Q   KG+         +SS+SLPFAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  213  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              G  R+ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  61   NNGGYRKGMAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  118



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q + KG         SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATFSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFSKKTS-DDFLSVVAFQTSAVGSSN  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKTVAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLL
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLL  114



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLL
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLL  114



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATFSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  338
            DD  SV++FQTS +G   G  ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA
Sbjct  40   DDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +3

Query  42   MASAALSVANSTLH-QVSNKGlssefsglr-ssssslpfarrsYDDLHSVVSFQTSVVG-  212
            MASA +SVA   L  Q   KG+         +SS+SLPFAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  213  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              G  R+ + EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  61   NNGGYRKGMAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  118



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS  G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSATGNSS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+S QT+ VG  G
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISVQTNAVGSSG  58

Query  216  KQRRAVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            + R+ VV EAK+KVAINGFGR GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   RSRKGVVVEAKIKVAINGFGRTGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +D  SVV+FQTSVV G   +R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  37   EDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  96

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  97   DTGGVKQASHLL  108



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA L+ AN+ L     KG S       +SSS       S DD  SVV+F+TS VG  G
Sbjct  1    MASATLTAANACLQ---GKGFSDFSGLRSASSSIPLRRINSSDDFLSVVAFRTSAVGSSG  57

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASHLL
Sbjct  58   GYRKGAAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASHLL  112



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 1/71 (1%)
 Frame = +3

Query  171  DLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
            D  S VSFQTS+VGG K ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  106  DFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  165

Query  348  TGGVKQASHLL  380
            TGGVKQA+HLL
Sbjct  166  TGGVKQAAHLL  176



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  94   NDTGGVKQASHLL  106



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 81/116 (70%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R++  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKSAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  94   NDTGGVKQASHLL  106



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  94   NDTGGVKQASHLL  106



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  108  DTGGVKQASHLL  119



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  108  DTGGVKQASHLL  119



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  108  DTGGVKQASHLL  119



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  108  DTGGVKQASHLL  119



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 80/116 (69%), Gaps = 5/116 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GGYRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  114



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  215
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MASA LSVA STL      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSTLQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  222  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLL
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLL  113



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  215
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTSV    G
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSVGSNSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLL
Sbjct  59   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLL  113



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  215
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  113



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +3

Query  54   ALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQRRAV  233
            A ++ANS+L QV+ KG S       SS+S   F  +S DD  S+V+ QTS VG K  +  
Sbjct  2    AFTMANSSL-QVNGKGFSEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVG-KNSKGP  59

Query  234  VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI INDTGGVKQASHLL
Sbjct  60   VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVINDTGGVKQASHLL  108



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  97   NDTGGVKQASHLL  109



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  97   NDTGGVKQASHLL  109



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLL
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLL  109



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLL
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLL  109



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLL
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLL  109



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 84/115 (73%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  55   AYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  109



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  55   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  109



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 79/114 (69%), Gaps = 4/114 (4%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  218
            MASA  SVA  +L Q + KG +       S+S          +D  SV++FQTS VG   
Sbjct  1    MASATFSVAKPSL-QANGKGFTDFSGLRNSASLPFSRKTS--EDFLSVIAFQTSAVGNSG  57

Query  219  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
             R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  58   YRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  111



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  335
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  336  AINDTGGVKQASHLL  380
            AINDTGGVKQASHLL
Sbjct  101  AINDTGGVKQASHLL  115



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  335
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  336  AINDTGGVKQASHLL  380
            AINDTGGVKQASHLL
Sbjct  101  AINDTGGVKQASHLL  115



>gb|AAA33484.1| glyceraldehyde-3-phosphate dehydrogenase precursor, partial [Zea 
mays]
Length=125

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  SVV+FQTS +G  G  R+ V EAKLKVAI+GFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 82/122 (67%), Gaps = 7/122 (6%)
 Frame = +3

Query  27   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  206
            P    MASA L+VAN++L Q + KG S       SS           DD  SV+SF+TS 
Sbjct  37   PETKTMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRRINTS--DDFISVISFKTSA  93

Query  207  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  374
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASH
Sbjct  94   VAGGSGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASH  153

Query  375  LL  380
            LL
Sbjct  154  LL  155



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 83/122 (68%), Gaps = 7/122 (6%)
 Frame = +3

Query  27   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  206
            P   AMASA L+VAN++L Q + KG S       SS           DD  SV++F+TS 
Sbjct  37   PDTKAMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRKINTS--DDFLSVIAFKTSA  93

Query  207  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  374
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASH
Sbjct  94   VAGGGGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASH  153

Query  375  LL  380
            LL
Sbjct  154  LL  155



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MAS  LS+AN +L +VSNKG S       SS           DDL ++V+FQT+ + GK+
Sbjct  1    MASNMLSIANPSL-RVSNKGFSEFAGLHTSSLPFARRGS---DDLVALVAFQTNALAGKR  56

Query  222  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ IND+GGVKQASHLL
Sbjct  57   STQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVINDSGGVKQASHLL  111



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  222  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLL
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLL  113



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  222  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLL
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLL  113



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  221
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  222  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLL
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLL  113



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  215
            MASA L+ AN+ L Q S KG S       +S S       S DD  S V+F+T+     G
Sbjct  1    MASATLTAANACL-QASGKGFSDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSG  59

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASHLL
Sbjct  60   GYRKGAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLL  114



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S ++FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S VSFQTS +G     R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP D+IAI
Sbjct  38   DEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDIIAI  97

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  98   NDTGGVKQASHLL  110



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQA+HLL
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQATHLL  109



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 83/115 (72%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  109



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 83/115 (72%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  109



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            D+  S VSFQTS +G  G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ I
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVI  96

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  97   NDTGGVKQASHLL  109



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 83/115 (72%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  215
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
               + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLL
Sbjct  55   GYSKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLL  109



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 82/123 (67%), Gaps = 12/123 (10%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV-----  206
            MASA LSVA  +L Q + KG         SS+      + S DD  SVV+FQTS      
Sbjct  1    MASATLSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSAKRILT  58

Query  207  --VG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  371
              VG   G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS
Sbjct  59   VKVGSNNGGYRKTAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  118

Query  372  HLL  380
            HLL
Sbjct  119  HLL  121



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  212
            MASA LSVA S+L         SEFSGLRSSS      + S D+  S V+FQT  +G   
Sbjct  1    MASATLSVAKSSLQLQG----FSEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNN  56

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLL
Sbjct  57   GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLL  112



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +3

Query  42   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVV--GG  215
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +   G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNG  54

Query  216  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  109



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            DDL + V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ IN
Sbjct  37   DDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVIN  96

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  97   DTGGVKQASHLL  108



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = +3

Query  183  VVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV  359
            +V+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGV
Sbjct  54   LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGV  113

Query  360  KQASHLL  380
            KQASHLL
Sbjct  114  KQASHLL  120



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DSPL+VIAI
Sbjct  39   DDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDDSPLEVIAI  98

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  99   NDTGGVKQASHLL  111



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
            D+  S V+FQTS V     + V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAIND
Sbjct  39   DEFVSAVTFQTSAVS--SLKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAIND  96

Query  348  TGGVKQASHLL  380
            TGGVKQASHLL
Sbjct  97   TGGVKQASHLL  107



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  20   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  79

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  80   INDTGGVKQASHLL  93



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = +3

Query  165  YDDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            +DDL ++V+ Q++V      +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ I
Sbjct  36   HDDLTTIVTAQSAVAASSGAKRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVI  95

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  96   NDTGGVKQASHLL  108



>gb|KHN00649.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=290

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 3/72 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            +D HSV++FQTS VGG++   + VVEAKLKVAINGFGRIGRNFLRCW+GRKDSPL +IAI
Sbjct  44   EDFHSVIAFQTSAVGGREGNTKGVVEAKLKVAINGFGRIGRNFLRCWNGRKDSPLHIIAI  103

Query  342  ND-TGGVKQASH  374
            ND TGGVKQAS 
Sbjct  104  NDTTGGVKQASQ  115



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  39   DDFMNAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIA  98

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  99   INDTGGVKQASHLL  112



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPL+VIA
Sbjct  38   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  98   INDTGGVKQASHLL  111



>gb|KHN13412.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=244

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 2/60 (3%)
 Frame = +3

Query  207  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  23   VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  82



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPL+VIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  99

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  100  INDTGGVKQASHLL  113



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  100  NDTGGVKQASHLL  112



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  341
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  342  NDTGGVKQASHLL  380
            NDTGGVKQASHLL
Sbjct  100  NDTGGVKQASHLL  112



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            DDL ++V+ QT V       RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ IN
Sbjct  38   DDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVIN  97

Query  345  DTGGVKQASHLL  380
            DTGGVKQASHLL
Sbjct  98   DTGGVKQASHLL  109



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 2/60 (3%)
 Frame = +3

Query  207  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  8    VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  67



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +3

Query  186  VSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  362
            V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  363  QASHLL  380
            QASHLL
Sbjct  62   QASHLL  67



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVGGK---QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  335
            +D  S VSF+T  VG      RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVI
Sbjct  39   EDFMSAVSFRTYAVGTSGSGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVI  98

Query  336  AINDTGGVKQASHLL  380
            AINDTGGVKQASHLL
Sbjct  99   AINDTGGVKQASHLL  113



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR D SPL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  98   INDTGGVKQASHLL  111



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR D SPL+VIA
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  88

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASHLL
Sbjct  89   INDTGGVKQASHLL  102



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  60



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLL
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLL  60



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  10   GGYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  65



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  338
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR D SPL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  339  INDTGGVKQASHLL  380
            INDTGG KQASHLL
Sbjct  98   INDTGGAKQASHLL  111



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  335
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRIGRNFLRCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDNDSPLDVI  96

Query  336  AINDTGGVKQASHLL  380
            AINDTG +KQASHLL
Sbjct  97   AINDTGDIKQASHLL  111



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  60



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  60



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  60



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +3

Query  222  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  63   KRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLL  115



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  335
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR  DSPLDVI
Sbjct  8    DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  67

Query  336  AINDTGGVKQASHLL  380
            AINDTG VKQASHLL
Sbjct  68   AINDTGDVKQASHLL  82



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  335
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR  DSPLDVI
Sbjct  56   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  115

Query  336  AINDTGGVKQASHLL  380
            AINDTG VKQASHLL
Sbjct  116  AINDTGDVKQASHLL  130



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLD++ INDTGGVKQASHLL
Sbjct  34   RAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDIVVINDTGGVKQASHLL  85



>gb|AAB82133.1| glyceralehyde-3-phosphate dehydrogenase subunit [Oryza sativa 
Indica Group]
Length=343

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVIA  338
            D+  + VSF+T  VG  G  RRA  EAKLKVAINGFGR GRNFLRCWHGR  DSPL++I 
Sbjct  39   DNFMNPVSFRTHAVGTNGGARRAPTEAKLKVAINGFGRFGRNFLRCWHGRGDDSPLNIIP  98

Query  339  INDTGGVKQASHLL  380
            INDTGGVKQASH L
Sbjct  99   INDTGGVKQASHRL  112



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLL
Sbjct  64   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLL  115



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLL
Sbjct  36   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLL  87



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  335
            D+  S VSF+   +G   G+ RRA  EAKLKVA+NGFGRIGRN +RCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAMNGFGRIGRNLMRCWHGRDNDSPLDVI  96

Query  336  AINDTGGVKQASHLL  380
            AINDTG VKQAS+LL
Sbjct  97   AINDTGDVKQASYLL  111



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  222  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPL++IAINDTGGVKQASHLL
Sbjct  2    RKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLL  54



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RAV EAK++VAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVKQASHLL
Sbjct  36   RAVTEAKIRVAINGFGRIGRNFVRCWHGRKDSPLEVVVINDTGGVKQASHLL  87



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 60/84 (71%), Gaps = 13/84 (15%)
 Frame = +3

Query  168  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGR----------IGRNFLRCWHGR  311
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGR          IGRNFLRCWHGR
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRAQRIGRNFLRCWHGR  88

Query  312  KD-SPLDVIAINDTGGVKQASHLL  380
             D SPL+VIAINDTGGVKQASHLL
Sbjct  89   GDSSPLEVIAINDTGGVKQASHLL  112



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLL
Sbjct  1    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLL  47



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  237  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  68   EAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLL  115



>gb|ABC68432.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=143

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTSVVGGKQRRAVVE--AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +        A VE  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  62   FFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  121

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  122  SGGVKNASHLL  132



>gb|ABC68431.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
pratensis]
Length=143

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTSVVGGKQRRAVVE--AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +        A VE  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  62   FFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  121

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  122  SGGVKNASHLL  132



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  174  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  350
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  351  GGVKQASHLL  380
            GGVK ASHLL
Sbjct  100  GGVKNASHLL  109



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  174  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  350
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  351  GGVKQASHLL  380
            GGVK ASHLL
Sbjct  100  GGVKNASHLL  109



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  174  LHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTG  353
            + SV    +S V G   R   EAKL+VAINGFGRIGRNFLRCWHGR DSPL+VIAIND+G
Sbjct  88   VDSVTRDVSSKVIGSGHRGETEAKLRVAINGFGRIGRNFLRCWHGRPDSPLEVIAINDSG  147

Query  354  GVKQASHLL  380
            GVKQA+HLL
Sbjct  148  GVKQATHLL  156



>gb|ADE06487.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=90

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTSVVGGKQRRAVVE--AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +        A VE  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  9    FFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  68

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  69   SGGVKNASHLL  79



>gb|ADE06488.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
porrifolius]
Length=86

 Score = 96.3 bits (238),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTSVVGGKQRRAVVE--AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +        A VE  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  5    FFDVVSAQFTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  64

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  65   SGGVKNASHLL  75



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV+QASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVEQASHLL  46



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  348  TGGVKQASHLL  380
            +GGVK A+HLL
Sbjct  119  SGGVKSATHLL  129



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  204  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  71   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  204  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  72   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  130



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  46



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  46



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  46



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  348  TGGVKQASHLL  380
            +GGVK A+HLL
Sbjct  119  SGGVKSATHLL  129



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLL  46



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  48   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  99



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSPLDV+ +ND+GGV+ ASHLL
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLL  122



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  ++ V EAKLKVAINGFGRIGRNFLRCW GR++SPL+V+AIND+GGVKQA+HLL
Sbjct  38   GSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQAAHLL  93



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTSV--VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
             + VV+ Q S    G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  38   FYDVVAAQLSTKRTGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  97

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  98   SGGVKNASHLL  108



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
            L  VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND
Sbjct  58   LFDVVSAQLTPKTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND  117

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  118  SGGVKNASHLL  128



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLL  131



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  213  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G  ++ V EAKLKVAINGFGRIGRNFLRCW GR++SPL+V+AIND+GGVKQA+HLL
Sbjct  10   GSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQAAHLL  65



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSP+DV+ +ND+GGV+ ASHLL
Sbjct  71   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLL  127



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  243  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ IND GGVKQASHLL
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDAGGVKQASHLL  46



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  101  RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  152



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  128



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  70   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  126



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  130



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLL
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLL  133



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  74   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  131



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLL
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLL  131



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FFDVVSAQLTPKTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  119  SGGVKNASHLL  129



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            +  VG    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDV+ +ND+GGVK ASHL
Sbjct  70   SKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLL
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLL  133



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  377
            +  VG    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDV+ +ND+GGVK ASHL
Sbjct  70   SKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASHL  129

Query  378  L  380
            L
Sbjct  130  L  130



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +3

Query  165  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +D + + ++ QTS  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTPQTS--GSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  345  DTGGVKQASHLL  380
            D+GGVK ASHLL
Sbjct  119  DSGGVKNASHLL  130



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK A+HLL
Sbjct  46   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNAAHLL  92



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  78   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +3

Query  174  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  347
               VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  58   FFDVVSAQLTPKTTGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  117

Query  348  TGGVKQASHLL  380
            +GGVK ASHLL
Sbjct  118  SGGVKNASHLL  128



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  130



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  128



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  131



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  237  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            +AK+KVAINGFGRIGRNFLRCWHGRKDS LDV+AIND+GGVKQASHL+
Sbjct  40   KAKIKVAINGFGRIGRNFLRCWHGRKDSLLDVVAINDSGGVKQASHLV  87



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLL
Sbjct  53   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  99



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLL
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLL  122



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLL
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLL  122



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLL
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLL  122



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLL
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLL  122



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +3

Query  165  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +D L + ++ ++  V     R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +N
Sbjct  61   FDVLAAQLTPKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVN  120

Query  345  DTGGVKQASHLL  380
            D+GGVK ASHLL
Sbjct  121  DSGGVKNASHLL  132



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLL
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLL  133



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +3

Query  165  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  344
            +D + + ++ +T+  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTLKTA--GSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  345  DTGGVKQASHLL  380
            D+GGVK ASHLL
Sbjct  119  DSGGVKNASHLL  130



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLL
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLL  133



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  126



>gb|ABR16095.1| unknown [Picea sitchensis]
Length=229

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  92   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  138



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  126



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  130



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  130



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  75   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  131



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +3

Query  210  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI +ND+GGV+ ASHLL
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLL  122



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+V+ IND+GGV+ ASHLL
Sbjct  74   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGGVRNASHLL  125



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  240  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLL
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  131



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  225  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  380
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLL
Sbjct  81   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLL  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551036074875