BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019C11

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP12744.1|  unnamed protein product                                120   3e-28   Coffea canephora [robusta coffee]
ref|XP_002512773.1|  dead box ATP-dependent RNA helicase, putative      119   5e-28   
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...    118   1e-27   
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   3e-27   Populus euphratica
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20             117   3e-27   Morus notabilis
ref|XP_006439906.1|  hypothetical protein CICLE_v10019394mg             115   7e-27   
ref|XP_006476871.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   8e-27   
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg             115   2e-26   Citrus clementina [clementine]
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   2e-26   Citrus sinensis [apfelsine]
emb|CBI14965.3|  unnamed protein product                                115   3e-26   Vitis vinifera
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   4e-26   Vitis vinifera
emb|CAN78903.1|  hypothetical protein VITISV_026451                     115   4e-26   Vitis vinifera
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   1e-25   Nicotiana sylvestris
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g             112   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    112   4e-25   Solanum tuberosum [potatoes]
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    112   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    112   4e-25   Solanum lycopersicum
gb|KDP31038.1|  hypothetical protein JCGZ_11414                         111   5e-25   Jatropha curcas
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   5e-25   
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                  110   5e-25   Glycine soja [wild soybean]
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   5e-25   Nicotiana tomentosiformis
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                    110   6e-25   Arabis alpina [alpine rockcress]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    110   1e-24   
ref|XP_010459859.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   1e-24   Camelina sativa [gold-of-pleasure]
gb|AHZ57095.1|  cold responsive DEAD-box RNA helicase                   108   2e-24   Chorispora bungeana
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                  108   3e-24   Glycine soja [wild soybean]
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg             108   4e-24   Prunus persica
ref|XP_007155471.1|  hypothetical protein PHAVU_003G204200g             107   4e-24   Phaseolus vulgaris [French bean]
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   5e-24   Populus euphratica
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   5e-24   Tarenaya hassleriana [spider flower]
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                   108   5e-24   Chorispora bungeana
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   7e-24   Glycine max [soybeans]
ref|XP_008464518.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    107   7e-24   Cucumis melo [Oriental melon]
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   7e-24   Fragaria vesca subsp. vesca
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g             108   8e-24   Phaseolus vulgaris [French bean]
ref|XP_007036327.1|  P-loop containing nucleoside triphosphate hy...    107   9e-24   
ref|XP_010444192.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010484039.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    107   1e-23   Cucumis melo [Oriental melon]
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...    107   1e-23   
ref|NP_568964.1|  DEAD-box ATP-dependent RNA helicase 30                105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280217.1|  hypothetical protein CARUB_v10026128mg             105   2e-23   
gb|KHG00890.1|  DEAD-box ATP-dependent RNA helicase 30                  105   2e-23   Gossypium arboreum [tree cotton]
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg                106   3e-23   Erythranthe guttata [common monkey flower]
gb|KJB40104.1|  hypothetical protein B456_007G047000                    105   3e-23   Gossypium raimondii
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   4e-23   Sesamum indicum [beniseed]
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494             105   5e-23   
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg             105   5e-23   Capsella rubella
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein                105   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30                105   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KJB40103.1|  hypothetical protein B456_007G047000                    105   5e-23   Gossypium raimondii
gb|KGN63542.1|  hypothetical protein Csa_1G004080                       105   5e-23   Cucumis sativus [cucumbers]
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   5e-23   Sesamum indicum [beniseed]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg             105   6e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009112064.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   7e-23   Brassica rapa
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   7e-23   Cucumis sativus [cucumbers]
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   1e-22   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                          104   1e-22   Brassica napus [oilseed rape]
gb|KEH31792.1|  DEAD-box ATP-dependent RNA helicase-like protein        103   1e-22   Medicago truncatula
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein        104   2e-22   Medicago truncatula
emb|CDY48128.1|  BnaCnng15700D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   3e-22   Prunus mume [ume]
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   3e-22   Elaeis guineensis
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   1e-21   Cicer arietinum [garbanzo]
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   2e-21   Phoenix dactylifera
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980        99.8    8e-21   Amborella trichopoda
ref|XP_001763089.1|  predicted protein                                97.1    4e-20   
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.7    9e-20   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85074.1|  predicted protein                                    94.7    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16327.1|  unknown                                               94.7    3e-19   Picea sitchensis
tpg|DAA56211.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  92.8    5e-19   
gb|ACN39916.1|  unknown                                               94.4    6e-19   Picea sitchensis
emb|CDM85602.1|  unnamed protein product                              94.0    7e-19   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA56212.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  92.8    1e-18   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450        93.2    1e-18   Sorghum bicolor [broomcorn]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.8    2e-18   Setaria italica
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  92.8    2e-18   
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                92.8    2e-18   Triticum urartu
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.4    2e-18   
gb|KCW83295.1|  hypothetical protein EUGRSUZ_B00227                   91.7    2e-18   Eucalyptus grandis [rose gum]
dbj|BAD82428.1|  putative DEAD box RNA helicase                       92.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.0    3e-18   
gb|KCW83293.1|  hypothetical protein EUGRSUZ_B00227                   91.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700        91.7    3e-18   Amborella trichopoda
dbj|BAD82427.1|  putative DEAD box RNA helicase                       91.7    4e-18   Oryza sativa Japonica Group [Japonica rice]
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  92.0    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  91.7    4e-18   Eucalyptus grandis [rose gum]
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.9    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.0    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342           83.6    2e-15   
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552            83.2    3e-15   
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.4    6e-15   Elaeis guineensis
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    1e-14   Phoenix dactylifera
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    1e-14   Phoenix dactylifera
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    2e-14   Fragaria vesca subsp. vesca
gb|EEC70110.1|  hypothetical protein OsI_00766                        80.9    2e-14   Oryza sativa Indica Group [Indian rice]
gb|AFK42127.1|  unknown                                               80.9    2e-14   Medicago truncatula
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase              80.9    2e-14   Medicago truncatula
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    2e-14   Solanum tuberosum [potatoes]
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    2e-14   Populus euphratica
emb|CAN70592.1|  hypothetical protein VITISV_026736                   75.9    3e-14   Vitis vinifera
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative    80.1    4e-14   Ricinus communis
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.7    5e-14   Glycine max [soybeans]
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    5e-14   Glycine max [soybeans]
emb|CDY10596.1|  BnaC03g70180D                                        79.3    6e-14   Brassica napus [oilseed rape]
ref|XP_006385358.1|  DEAD box RNA helicase family protein             79.3    6e-14   
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    7e-14   Glycine max [soybeans]
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    7e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.3    7e-14   Vitis vinifera
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.0    7e-14   Brassica rapa
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  79.0    8e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54050.1|  hypothetical protein OsJ_00740                        79.0    8e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40778.1|  hypothetical protein JCGZ_24777                       79.0    9e-14   Jatropha curcas
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase            79.0    1e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDY02459.1|  BnaA08g00660D                                        78.6    1e-13   
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    1e-13   Oryza brachyantha
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    1e-13   Cucumis sativus [cucumbers]
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    1e-13   Cucumis melo [Oriental melon]
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.2    1e-13   Cicer arietinum [garbanzo]
gb|KJB70270.1|  hypothetical protein B456_011G066000                  78.2    2e-13   Gossypium raimondii
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.2    2e-13   Setaria italica
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    2e-13   
ref|XP_006426527.1|  hypothetical protein CICLE_v10025421mg           77.4    2e-13   
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    2e-13   
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg           77.4    2e-13   
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                 77.4    2e-13   Citrus sinensis [apfelsine]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg           77.4    3e-13   
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg           77.4    3e-13   Citrus clementina [clementine]
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg           77.4    3e-13   Citrus clementina [clementine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.4    3e-13   Citrus sinensis [apfelsine]
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.4    3e-13   Citrus sinensis [apfelsine]
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                 77.0    3e-13   Citrus sinensis [apfelsine]
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                 77.0    3e-13   Citrus sinensis [apfelsine]
ref|NP_001142117.1|  uncharacterized protein LOC100274281             77.0    4e-13   Zea mays [maize]
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20           77.0    4e-13   
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                  77.0    4e-13   Eucalyptus grandis [rose gum]
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    4e-13   Eucalyptus grandis [rose gum]
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  77.0    4e-13   Gossypium arboreum [tree cotton]
gb|AHA84137.1|  DEAD-box ATP-dependent RNA helicase 20                76.6    4e-13   Phaseolus vulgaris [French bean]
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860        76.6    5e-13   
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.6    5e-13   Pyrus x bretschneideri [bai li]
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080            76.6    6e-13   Chlorella variabilis
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g           76.3    6e-13   Phaseolus vulgaris [French bean]
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570           76.3    6e-13   
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg              76.3    7e-13   Erythranthe guttata [common monkey flower]
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.3    7e-13   Nicotiana sylvestris
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    8e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007215260.1|  hypothetical protein PRUPE_ppa004545mg           75.5    8e-13   
ref|XP_007215259.1|  hypothetical protein PRUPE_ppa004545mg           75.5    8e-13   
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    8e-13   Camelina sativa [gold-of-pleasure]
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20              75.9    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.9    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg           75.5    1e-12   Prunus persica
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg           75.5    1e-12   Capsella rubella
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                  75.5    1e-12   Monoraphidium neglectum
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.5    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.1    1e-12   Tarenaya hassleriana [spider flower]
gb|KJE94426.1|  hypothetical protein CAOG_008856                      75.5    2e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.1    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.1    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg           74.7    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  74.7    2e-12   Prunus mume [ume]
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  74.3    3e-12   Gossypium arboreum [tree cotton]
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                  74.3    3e-12   Arabis alpina [alpine rockcress]
emb|CDM81540.1|  unnamed protein product                              73.9    4e-12   Triticum aestivum [Canadian hard winter wheat]
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                73.9    4e-12   Triticum urartu
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein         73.9    4e-12   
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.6    5e-12   Malus domestica [apple tree]
ref|XP_002618773.1|  conserved hypothetical protein                   72.8    8e-12   Clavispora lusitaniae ATCC 42720
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  72.8    8e-12   Camelina sativa [gold-of-pleasure]
gb|AAI35356.1|  LOC549535 protein                                     72.4    9e-12   Xenopus tropicalis [western clawed frog]
gb|AAH54236.1|  LOC398649 protein                                     72.4    1e-11   Xenopus laevis [clawed frog]
ref|XP_005166300.1|  PREDICTED: probable ATP-dependent RNA helica...  72.4    1e-11   Danio rerio [leopard danio]
ref|XP_001923830.1|  PREDICTED: probable ATP-dependent RNA helica...  73.2    1e-11   
gb|AAI34864.1|  LOC556764 protein                                     72.4    1e-11   Danio rerio [leopard danio]
ref|NP_001016781.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           72.8    1e-11   Xenopus tropicalis [western clawed frog]
gb|KJB56889.1|  hypothetical protein B456_009G140700                  72.0    1e-11   Gossypium raimondii
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           72.8    1e-11   Xenopus laevis [clawed frog]
ref|XP_001690022.1|  DEAD-box RNA helicase                            72.4    1e-11   Chlamydomonas reinhardtii
gb|AAI17661.1|  LOC556764 protein                                     72.4    1e-11   Danio rerio [leopard danio]
gb|AAI54494.1|  LOC556764 protein                                     72.4    1e-11   Danio rerio [leopard danio]
gb|KJB56890.1|  hypothetical protein B456_009G140700                  72.0    2e-11   Gossypium raimondii
gb|KJB56888.1|  hypothetical protein B456_009G140700                  72.0    2e-11   Gossypium raimondii
ref|XP_008228304.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  71.6    2e-11   Prunus mume [ume]
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  71.6    2e-11   Prunus mume [ume]
ref|XP_007216293.1|  hypothetical protein PRUPE_ppa019394mg           66.2    3e-11   
ref|XP_008228055.1|  PREDICTED: uncharacterized protein LOC103327496  68.2    5e-11   
ref|XP_008029812.1|  hypothetical protein SETTUDRAFT_156478           71.2    5e-11   Exserohilum turcica Et28A
ref|XP_005994328.1|  PREDICTED: probable ATP-dependent RNA helica...  70.9    6e-11   Latimeria chalumnae
ref|XP_005994327.1|  PREDICTED: probable ATP-dependent RNA helica...  70.9    6e-11   Latimeria chalumnae
ref|XP_008924609.1|  PREDICTED: probable ATP-dependent RNA helica...  70.9    6e-11   
gb|KFW74934.1|  putative ATP-dependent RNA helicase DDX5              70.5    6e-11   Manacus vitellinus
ref|XP_003964460.1|  PREDICTED: probable ATP-dependent RNA helica...  70.5    8e-11   
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_002955411.1|  DEAD-box RNA helicase, ATP-dependent             69.7    1e-10   Volvox carteri f. nagariensis
gb|KFV15852.1|  putative ATP-dependent RNA helicase DDX5              69.7    1e-10   Pterocles gutturalis
ref|XP_010082418.1|  PREDICTED: probable ATP-dependent RNA helica...  69.7    1e-10   Pterocles gutturalis
ref|XP_005526732.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  69.7    1e-10   
ref|XP_005056207.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  69.3    1e-10   
ref|XP_004177017.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  69.3    1e-10   
dbj|BAP72968.1|  ATP-dependent RNA helicase DBP2                      68.9    2e-10   Kluyveromyces marxianus
ref|XP_005490530.1|  PREDICTED: probable ATP-dependent RNA helica...  69.7    2e-10   
ref|XP_008946713.1|  PREDICTED: probable ATP-dependent RNA helica...  69.3    2e-10   Merops nubicus
ref|XP_009900998.1|  PREDICTED: probable ATP-dependent RNA helica...  69.7    2e-10   Picoides pubescens
ref|XP_005425834.1|  PREDICTED: probable ATP-dependent RNA helica...  69.3    2e-10   
gb|KFO62141.1|  putative ATP-dependent RNA helicase DDX5              69.3    2e-10   Corvus brachyrhynchos
dbj|BAO41526.1|  ATP-dependent RNA helicase DBP2                      68.9    2e-10   Kluyveromyces marxianus DMKU3-1042
ref|XP_008635819.1|  PREDICTED: probable ATP-dependent RNA helica...  69.3    2e-10   
emb|CDO96429.1|  unnamed protein product                              68.9    2e-10   Kluyveromyces dobzhanskii CBS 2104
gb|KFV69016.1|  putative ATP-dependent RNA helicase DDX5              68.9    2e-10   Picoides pubescens
ref|XP_005146198.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  68.9    2e-10   
gb|KFQ45816.1|  putative ATP-dependent RNA helicase DDX5              68.9    2e-10   Nestor notabilis
gb|KFP01441.1|  putative ATP-dependent RNA helicase DDX5              68.9    2e-10   Calypte anna
ref|XP_010001089.1|  PREDICTED: probable ATP-dependent RNA helica...  68.9    2e-10   Chaetura pelagica
gb|KFQ83777.1|  putative ATP-dependent RNA helicase DDX5              68.9    2e-10   Phoenicopterus ruber ruber
ref|XP_010142923.1|  PREDICTED: probable ATP-dependent RNA helica...  68.9    2e-10   Buceros rhinoceros silvestris
ref|XP_010007531.1|  PREDICTED: probable ATP-dependent RNA helica...  68.9    2e-10   Nestor notabilis
ref|XP_009067616.1|  PREDICTED: probable ATP-dependent RNA helica...  68.9    2e-10   Acanthisitta chloris
gb|KFU93470.1|  putative ATP-dependent RNA helicase DDX5              68.9    2e-10   Chaetura pelagica
ref|XP_008492881.1|  PREDICTED: probable ATP-dependent RNA helica...  68.9    3e-10   Calypte anna
gb|EMP40180.1|  Putative ATP-dependent RNA helicase DDX5              68.6    3e-10   Chelonia mydas [green seaturtle]
ref|XP_001798683.1|  hypothetical protein SNOG_08367                  68.9    3e-10   Parastagonospora nodorum SN15
emb|CDQ93346.1|  unnamed protein product                              66.6    3e-10   Oncorhynchus mykiss
gb|KGL79977.1|  putative ATP-dependent RNA helicase DDX5              67.4    3e-10   Tinamus guttatus
ref|XP_007055161.1|  PREDICTED: probable ATP-dependent RNA helica...  68.6    3e-10   Chelonia mydas [green seaturtle]
ref|XP_009503052.1|  PREDICTED: probable ATP-dependent RNA helica...  68.6    3e-10   Phalacrocorax carbo [common cormorant]
ref|XP_007055160.1|  PREDICTED: probable ATP-dependent RNA helica...  68.6    3e-10   Chelonia mydas [green seaturtle]
gb|EDK39933.2|  conserved hypothetical protein                        68.2    3e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_010216886.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    3e-10   Tinamus guttatus
ref|XP_001483302.1|  conserved hypothetical protein                   67.8    4e-10   Meyerozyma guilliermondii ATCC 6260
gb|KIW08158.1|  ATP-dependent RNA helicase DBP2                       68.2    4e-10   Verruconis gallopava
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative         68.6    4e-10   Acanthamoeba castellanii str. Neff
gb|EMD89203.1|  hypothetical protein COCHEDRAFT_1141168               68.2    4e-10   Bipolaris maydis C5
ref|XP_010124485.1|  PREDICTED: probable ATP-dependent RNA helica...  68.2    4e-10   Chlamydotis macqueenii
ref|NP_990158.1|  probable ATP-dependent RNA helicase DDX5            68.2    4e-10   Gallus gallus [bantam]
ref|XP_456137.1|  hypothetical protein                                68.2    4e-10   Kluyveromyces lactis
sp|A5DL80.3|DBP2_PICGU  RecName: Full=ATP-dependent RNA helicase ...  67.8    4e-10   Meyerozyma guilliermondii ATCC 6260
ref|XP_003866103.1|  Dbp2 protein                                     67.8    4e-10   Candida orthopsilosis Co 90-125
ref|XP_010719980.1|  PREDICTED: probable ATP-dependent RNA helica...  68.2    4e-10   Meleagris gallopavo [common turkey]
ref|XP_009562292.1|  PREDICTED: probable ATP-dependent RNA helica...  68.2    5e-10   Cuculus canorus
gb|KIW08159.1|  ATP-dependent RNA helicase DBP2, variant              67.8    5e-10   Verruconis gallopava
emb|CDS08010.1|  hypothetical protein LRAMOSA01959                    68.2    5e-10   Lichtheimia ramosa
ref|XP_005508068.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   Columba livia [carrier pigeon]
gb|KFQ98716.1|  putative ATP-dependent RNA helicase DDX5              67.8    5e-10   Nipponia nippon
gb|KFV83443.1|  putative ATP-dependent RNA helicase DDX5              67.8    5e-10   Struthio camelus australis
gb|KFP59594.1|  putative ATP-dependent RNA helicase DDX5              67.8    5e-10   Cariama cristata
ref|XP_005171626.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   
ref|XP_005012363.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   
ref|XP_007910174.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_009893086.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  67.8    5e-10   Charadrius vociferus
ref|XP_009634343.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   Egretta garzetta
ref|XP_005012364.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    5e-10   
gb|KGL87778.1|  putative ATP-dependent RNA helicase DDX5              67.8    5e-10   Charadrius vociferus
ref|XP_005012366.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|NP_997777.1|  probable ATP-dependent RNA helicase DDX5            67.4    6e-10   
gb|KFP13648.1|  putative ATP-dependent RNA helicase DDX5              67.8    6e-10   Egretta garzetta
ref|XP_005441278.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_010576927.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Haliaeetus leucocephalus
ref|XP_009322055.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Pygoscelis adeliae
ref|XP_009286004.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_005012367.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_005171624.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_009480183.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Pelecanus crispus
ref|XP_009959611.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Leptosomus discolor
ref|XP_005237584.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Falco peregrinus [peregrine]
ref|XP_005282962.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Chrysemys picta bellii
ref|XP_009574646.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Fulmarus glacialis
ref|XP_010156926.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Eurypyga helias
ref|XP_009981048.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   Tauraco erythrolophus
gb|KFQ23010.1|  putative ATP-dependent RNA helicase DDX5              67.8    6e-10   Mesitornis unicolor
ref|XP_009465280.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_009923408.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
gb|EOB06682.1|  Putative ATP-dependent RNA helicase DDX5              67.8    6e-10   
ref|XP_010279916.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
ref|XP_007708543.1|  hypothetical protein COCCADRAFT_33556            68.2    6e-10   
ref|XP_005012365.1|  PREDICTED: probable ATP-dependent RNA helica...  67.8    6e-10   
gb|EUN26543.1|  hypothetical protein COCVIDRAFT_38180                 67.8    6e-10   
ref|XP_007688487.1|  hypothetical protein COCMIDRAFT_37248            67.8    6e-10   
gb|ENI05079.1|  hypothetical protein COCC4DRAFT_60914                 67.8    7e-10   
ref|XP_005282961.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
ref|XP_009677266.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
gb|AAI59199.1|  Ddx5 protein                                          67.0    7e-10   
gb|EAW60244.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  63.5    7e-10   
ref|XP_006271274.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
ref|XP_006017456.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
ref|XP_007231410.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
ref|XP_007703324.1|  hypothetical protein COCSADRAFT_174289           67.8    7e-10   
ref|XP_005282960.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    7e-10   
gb|KFR13783.1|  putative ATP-dependent RNA helicase DDX5              67.4    8e-10   
ref|XP_002599469.1|  hypothetical protein BRAFLDRAFT_122755           67.4    8e-10   
ref|XP_006119019.1|  PREDICTED: probable ATP-dependent RNA helica...  67.4    8e-10   
ref|XP_009872276.1|  PREDICTED: probable ATP-dependent RNA helica...  67.0    8e-10   
emb|CCE41717.1|  hypothetical protein CPAR2_802670                    67.0    9e-10   
ref|XP_010746315.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    9e-10   
gb|EMG48788.1|  ATP-dependent RNA helicase DBP2                       67.0    9e-10   
ref|XP_001630124.1|  predicted protein                                66.6    9e-10   
ref|XP_004198636.1|  Piso0_002019                                     67.0    9e-10   
ref|XP_006110660.1|  PREDICTED: probable ATP-dependent RNA helica...  67.0    9e-10   
ref|XP_002421819.1|  ATP-dependent RNA helicase, putative             67.0    9e-10   
emb|CCD51310.1|  hypothetical protein BofuT4_P016160.1                67.0    9e-10   
emb|CCG81197.1|  ATP-dependent RNA helicase dbp2                      67.0    1e-09   
gb|KIM94898.1|  hypothetical protein OIDMADRAFT_171759                67.0    1e-09   
gb|ACN11269.1|  Probable ATP-dependent RNA helicase DDX5              67.0    1e-09   
ref|XP_710708.1|  potential nonsense-mediated decay helicase Dbp2...  66.6    1e-09   
emb|CDH49080.1|  atp-dependent rna helicase dbp2                      67.0    1e-09   
ref|XP_009936711.1|  PREDICTED: probable ATP-dependent RNA helica...  67.0    1e-09   
gb|EEQ43358.1|  hypothetical protein CAWG_01593                       66.6    1e-09   
gb|KGR07069.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
gb|KHC54337.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
gb|KGQ81587.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
sp|Q59LU0.2|DBP2_CANAL  RecName: Full=ATP-dependent RNA helicase ...  66.6    1e-09   
gb|KHC67218.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
gb|KHC61282.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
gb|KGQ83987.1|  ATP-dependent RNA helicase DBP2                       66.6    1e-09   
ref|XP_007069155.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  67.0    1e-09   
ref|XP_001597985.1|  conserved hypothetical protein                   66.6    1e-09   
gb|EAW60247.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  63.9    1e-09   
ref|XP_010169367.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    1e-09   
gb|KDR17563.1|  putative ATP-dependent RNA helicase DDX5              67.0    1e-09   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...  67.0    1e-09   
ref|XP_004401955.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    1e-09   
emb|CDQ77070.1|  unnamed protein product                              67.0    1e-09   
ref|XP_010746314.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    1e-09   
ref|XP_010196579.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    1e-09   
emb|CAA63974.1|  p68 RNA helicase                                     63.5    1e-09   
gb|EXX56940.1|  Dbp2p                                                 66.2    1e-09   
ref|XP_011476809.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    2e-09   
emb|CCF54040.1|  probable RNA helicase dbp2 (DEAD box protein)        66.2    2e-09   
ref|XP_003227208.1|  PREDICTED: probable ATP-dependent RNA helica...  66.6    2e-09   
gb|EXX56938.1|  Dbp2p                                                 66.2    2e-09   
ref|XP_004563117.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
gb|EMP27021.1|  Putative ATP-dependent RNA helicase DDX17             66.6    2e-09   
ref|XP_004563116.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
ref|XP_504478.1|  YALI0E27715p                                        66.2    2e-09   
ref|XP_005737995.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
emb|CDQ70726.1|  unnamed protein product                              66.2    2e-09   
gb|ESA04306.1|  hypothetical protein GLOINDRAFT_235162                65.9    2e-09   
ref|XP_005737994.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
gb|EXX56939.1|  Dbp2p                                                 66.2    2e-09   
emb|CAF88737.1|  unnamed protein product                              65.1    2e-09   
ref|XP_002546141.1|  hypothetical protein CTRG_00923                  65.9    2e-09   
ref|XP_005940780.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
gb|AAX22124.1|  DEAD-box RNA-dependent helicase p68                   66.2    2e-09   
gb|EPB85904.1|  hypothetical protein HMPREF1544_07320                 66.2    2e-09   
ref|XP_006798015.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
ref|XP_007239642.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
ref|XP_005468481.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
dbj|BAE02001.1|  unnamed protein product                              64.7    2e-09   
ref|XP_003443250.1|  PREDICTED: probable ATP-dependent RNA helica...  66.2    2e-09   
ref|XP_004563118.1|  PREDICTED: probable ATP-dependent RNA helica...  65.9    2e-09   
ref|XP_007239643.1|  PREDICTED: probable ATP-dependent RNA helica...  65.9    2e-09   
ref|XP_006958620.1|  p68 RNA helicase                                 65.9    2e-09   
gb|ESW95879.1|  ATP-dependent RNA helicase DBP2                       65.9    2e-09   
emb|CCX12941.1|  Similar to ATP-dependent RNA helicase dbp2; acc....  65.9    2e-09   
gb|EMR82333.1|  putative atp-dependent rna helicase dbp2 protein      65.9    2e-09   
dbj|GAN02653.1|  ATP-dependent RNA helicase dbp-2                     66.2    2e-09   
ref|XP_001549899.1|  p68 RNA helicase                                 65.5    2e-09   
ref|XP_007431409.1|  PREDICTED: probable ATP-dependent RNA helica...  65.9    3e-09   
sp|A6SFW7.2|DBP2_BOTFB  RecName: Full=ATP-dependent RNA helicase ...  65.5    3e-09   
emb|CBQ67715.1|  probable RNA helicase dbp2 (DEAD box protein)        65.5    3e-09   
gb|ETE73116.1|  putative ATP-dependent RNA helicase DDX5              65.5    3e-09   
ref|XP_003646993.1|  hypothetical protein Ecym_5422                   65.5    3e-09   
ref|XP_010895017.1|  PREDICTED: probable ATP-dependent RNA helica...  65.9    3e-09   
ref|XP_007751641.1|  ATP-dependent RNA helicase dbp2                  65.5    3e-09   
ref|XP_003321253.2|  hypothetical protein PGTG_02295                  65.5    3e-09   
ref|XP_004201815.1|  Piso0_002019                                     65.5    3e-09   
ref|XP_003321244.1|  hypothetical protein PGTG_02286                  65.5    3e-09   
gb|KGO41467.1|  Helicase, C-terminal                                  65.5    3e-09   
gb|EAW60245.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  64.3    3e-09   
gb|AAI51769.1|  DDX17 protein                                         64.3    4e-09   
ref|XP_003428757.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  65.5    4e-09   
ref|XP_008294587.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
dbj|BAG64169.1|  unnamed protein product                              64.7    4e-09   
gb|KIW91519.1|  ATP-dependent RNA helicase DBP2                       65.1    4e-09   
emb|CDQ98828.1|  unnamed protein product                              63.9    4e-09   
gb|KDO69503.1|  hypothetical protein CISIN_1g013176mg                 64.3    4e-09   
gb|KDO69504.1|  hypothetical protein CISIN_1g013176mg                 64.3    4e-09   
ref|XP_004088478.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    4e-09   
ref|XP_003677495.1|  hypothetical protein NCAS_0G02560                65.1    4e-09   
emb|CDR45538.1|  CYFA0S19e00144g1_1                                   64.7    4e-09   
ref|XP_002599305.1|  hypothetical protein BRAFLDRAFT_64339            65.1    4e-09   
ref|XP_006521352.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    4e-09   
gb|EAW60242.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  64.7    4e-09   
dbj|BAE36146.1|  unnamed protein product                              64.7    4e-09   
ref|XP_006934164.2|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
ref|XP_007373953.1|  ATP-dependent RNA helicase DBP2                  65.1    4e-09   
ref|XP_001527692.1|  hypothetical protein LELG_00212                  64.7    4e-09   
gb|AAH62910.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17             64.7    4e-09   
ref|NP_951061.1|  probable ATP-dependent RNA helicase DDX17 isofo...  64.3    4e-09   
ref|XP_001938922.1|  ATP-dependent RNA helicase dbp2                  65.1    4e-09   
ref|XP_004787459.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
ref|XP_004675716.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    4e-09   
ref|XP_002914626.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  65.1    4e-09   
ref|XP_010612310.1|  PREDICTED: probable ATP-dependent RNA helica...  64.3    5e-09   
gb|ELR53727.1|  Putative ATP-dependent RNA helicase DDX17             65.1    5e-09   
ref|XP_001527693.1|  hypothetical protein LELG_00213                  64.7    5e-09   
ref|XP_004630228.1|  PREDICTED: probable ATP-dependent RNA helica...  63.5    5e-09   
gb|EHH65839.1|  hypothetical protein EGM_02689                        65.1    5e-09   
ref|XP_003771058.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    5e-09   
ref|XP_006747482.1|  PREDICTED: probable ATP-dependent RNA helica...  64.3    5e-09   
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    5e-09   
ref|XP_008142845.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    5e-09   
ref|NP_006377.2|  probable ATP-dependent RNA helicase DDX17 isofo...  65.1    5e-09   
ref|NP_001091974.1|  probable ATP-dependent RNA helicase DDX17 is...  65.1    5e-09   
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                 64.7    5e-09   
ref|XP_456892.1|  DEHA2A12958p                                        64.7    5e-09   
ref|XP_008575122.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
gb|EHH20234.1|  hypothetical protein EGK_03044                        65.1    5e-09   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004743517.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    5e-09   
ref|XP_005883259.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
dbj|BAD92832.1|  DEAD box polypeptide 17 isoform p82 variant          65.1    5e-09   
ref|XP_860668.3|  PREDICTED: probable ATP-dependent RNA helicase ...  65.1    5e-09   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006979213.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006865246.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008977406.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004007674.1|  PREDICTED: probable ATP-dependent RNA helica...  65.1    5e-09   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...  64.7    5e-09   
ref|XP_005066907.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  64.7    5e-09   
ref|NP_001267194.1|  probable ATP-dependent RNA helicase DDX17        64.7    5e-09   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008849475.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004589559.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004279534.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004410825.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006155419.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007519377.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007519378.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007189119.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
emb|CAH10627.2|  hypothetical protein                                 64.7    5e-09   
ref|XP_004634676.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004634675.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006071392.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005379315.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005003904.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004883535.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_003783252.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007652929.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_003821639.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17        64.7    5e-09   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...  64.7    5e-09   
ref|XP_003126098.2|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_005322310.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004650368.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_004373916.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
gb|KFH65694.1|  hypothetical protein MVEG_09167                       64.7    5e-09   
ref|XP_008565102.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008565101.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_007939857.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_008067648.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...  64.7    5e-09   
ref|XP_004485165.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...  64.7    5e-09   
ref|NP_951062.1|  probable ATP-dependent RNA helicase DDX17 isofo...  64.7    5e-09   
ref|XP_008849477.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_010597633.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    5e-09   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
ref|XP_006890183.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
gb|KIW32492.1|  ATP-dependent RNA helicase DBP2                       64.3    6e-09   
ref|XP_005681228.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   
ref|NP_989229.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 5               64.7    6e-09   
ref|XP_007431410.1|  PREDICTED: probable ATP-dependent RNA helica...  64.3    6e-09   
ref|XP_008509242.1|  PREDICTED: probable ATP-dependent RNA helica...  64.7    6e-09   



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LPKQ+FGNLV FEKNFY ESPSV AMTE EVA+YRARRE+TV+G D+PKPIRMF
Sbjct  151  DLDNLALPKQEFGNLVPFEKNFYVESPSVRAMTEQEVAVYRARREMTVDGHDVPKPIRMF  210

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  211  HEANFPDY  218



>ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF49276.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=540

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI+LPKQDFGNLV FEKNFY E+PSV AM+EHEV +YRARR++TVEG D+PKPIR+F
Sbjct  168  DLDNIALPKQDFGNLVPFEKNFYIENPSVQAMSEHEVIMYRARRDITVEGHDVPKPIRIF  227

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  228  QEANFPGY  235



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDNI+LPKQDFGNLV FEKNFY E+PS+ A++EHEV +YR RRE+TVEG D+PKPIR+F
Sbjct  65   ELDNIALPKQDFGNLVPFEKNFYFENPSIRALSEHEVVMYRTRREITVEGHDVPKPIRLF  124

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  125  HEANFPDY  132



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDNI+LPKQDFGNLV FEKNFY E+PS+ A++EHEV +YR RRE+TVEG D+PKPIR+F
Sbjct  147  ELDNIALPKQDFGNLVPFEKNFYIENPSIRALSEHEVVMYRTRREITVEGHDVPKPIRLF  206

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  207  HEANFPDY  214



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LP+QDFGNLV FEKNFY ESPSV AMTEHEV  YR RRE+TVEG D+PKPIR F
Sbjct  148  DLDNVALPRQDFGNLVPFEKNFYVESPSVRAMTEHEVVQYRVRREITVEGQDVPKPIRRF  207

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  208  EEANFPGY  215



>ref|XP_006439906.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 ref|XP_006439907.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 ref|XP_006439908.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53146.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53147.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53148.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=493

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +YRARRE+TVEG D+P+PIR+F 
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMYRARREITVEGHDVPRPIRIFQ  181

Query  523  EANFPAY  543
            EANFP Y
Sbjct  182  EANFPDY  188



>ref|XP_006476871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Citrus sinensis]
Length=493

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +YRARRE+TVEG D+P+PIR+F 
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMYRARREITVEGHDVPRPIRIFQ  181

Query  523  EANFPAY  543
            EANFP Y
Sbjct  182  EANFPDY  188



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +YRARRE+TVEG D+P+PIR+F 
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMYRARREITVEGHDVPRPIRIFQ  181

Query  523  EANFPAY  543
            EANFP Y
Sbjct  182  EANFPDY  188



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +YRARRE+TVEG D+P+PIR+F 
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMYRARREITVEGHDVPRPIRIFQ  181

Query  523  EANFPAY  543
            EANFP Y
Sbjct  182  EANFPDY  188



>emb|CBI14965.3| unnamed protein product [Vitis vinifera]
Length=611

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LYRARRE+TVEG D+PKPIR F
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLYRARREITVEGYDVPKPIRHF  298

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  299  QEANFPGY  306



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LPKQDFG LV FEKNFY+ESPSV AM+EH+V +YR RRE+TVEG DIPKPI+MF
Sbjct  134  DLDNIVLPKQDFGTLVPFEKNFYAESPSVRAMSEHDVMVYRTRREITVEGHDIPKPIQMF  193

Query  520  HEANFPAY  543
             +ANFP Y
Sbjct  194  EDANFPDY  201



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LYRARRE+TVEG D+PKPIR F
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLYRARREITVEGYDVPKPIRHF  298

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  299  QEANFPGY  306



>emb|CAN78903.1| hypothetical protein VITISV_026451 [Vitis vinifera]
Length=692

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LYRARRE+TVEG D+PKPIR F
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLYRARREITVEGYDVPKPIRHF  298

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  299  QEANFPGY  306



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LPKQDFG LV FEKNFY+ESPSV AM+EH+V +YR RRE+TVEG DIPKPI+MF
Sbjct  133  DLDNIMLPKQDFGTLVPFEKNFYAESPSVRAMSEHDVMVYRTRREITVEGHDIPKPIQMF  192

Query  520  HEANFPAY  543
             +ANFP Y
Sbjct  193  EDANFPDY  200



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LPK DFGNLV FEKNFY E  SV AMTE +VALYRARRE+TVEG D+P+PI+MF
Sbjct  172  DLDNLTLPKVDFGNLVPFEKNFYVEHHSVRAMTEEDVALYRARREITVEGHDVPRPIQMF  231

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  232  HEANFPDY  239


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 6/52 (12%)
 Frame = +1

Query  4    ADSNSYRQRRSDLIGPPHI-----AGGAALSNSRGAPTPYGGPVVAPPRYSG  144
             DS SYRQRRSDL+GPPHI     AGGAA S  RG P PYGGP  APP  +G
Sbjct  11   GDSGSYRQRRSDLMGPPHIYSRPMAGGAAASYGRGGPVPYGGP-QAPPMDAG  61



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDNI+LPKQDFG+LV FEKN Y E+PS+ AM+EHEV  +RARRE+TVEG D+P+PIR+F
Sbjct  135  ELDNIALPKQDFGDLVPFEKNLYFENPSIRAMSEHEVVTFRARREITVEGHDVPRPIRIF  194

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  195  HEANFPDY  202



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LPKQDFGNLV FEKNFY E+ +V AMT+ EVA YRARR++T+EG D+P+PI+MF
Sbjct  171  DLDNLTLPKQDFGNLVPFEKNFYVENHAVRAMTDQEVAHYRARRDITIEGQDVPRPIQMF  230

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  231  HEANFPDY  238



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD+I+LPKQDFGNLV FEKNFY ES SV AMTE E A+YR RRE+TVEG DIPKPIR+F
Sbjct  239  ELDSIALPKQDFGNLVPFEKNFYIESSSVEAMTEQETAIYRKRREITVEGYDIPKPIRLF  298

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  299  QEANFPDY  306



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LPKQDFGNLV FEKNFY E+ +V AMT+ EVA YRARR++T+EG D+P+PI+MF
Sbjct  173  DLDNLTLPKQDFGNLVPFEKNFYVENHAVRAMTDQEVAHYRARRDITIEGQDVPRPIQMF  232

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  233  HEANFPDY  240



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD+I+LPKQDFGNLV F+KNFY ESPSV +M+E++  +YRARR++TVEG D+PKPIRMF
Sbjct  150  DLDDIALPKQDFGNLVPFKKNFYIESPSVQSMSENDAMMYRARRDITVEGHDVPKPIRMF  209

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  210  QEANFPEY  217



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LPKQDFGNLV FEKNFY+ESPSV AM+EH+V +YR RRE+T EG DIPKPI+MF
Sbjct  165  DLDNIMLPKQDFGNLVPFEKNFYAESPSVRAMSEHDVMVYRTRREITTEGHDIPKPIQMF  224

Query  520  HEANFPAY  543
             + +FP Y
Sbjct  225  EDTDFPDY  232



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  YRA RE+TV+G D+PKP+RMF
Sbjct  36   DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHYRASREITVQGNDVPKPVRMF  95

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  96   HEANFPDY  103



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN++LPK DFGNLV FEKNFY E  SV AM E +VALYRARRE+TVEG D+P+PI+MF
Sbjct  172  DLDNLTLPKVDFGNLVPFEKNFYVEHHSVRAMAEEDVALYRARREITVEGHDVPRPIQMF  231

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  232  HEANFPDY  239


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 34/48 (71%), Gaps = 6/48 (13%)
 Frame = +1

Query  4    ADSNSYRQRRSDLIGPPHI-----AGGAALSNSRGAPTPYGGPVVAPP  132
             DS+SYRQRRSDL+GPPHI      GGAA S  RG P PYGGP  APP
Sbjct  11   GDSSSYRQRRSDLVGPPHIYSRPMPGGAAASYGRGGPLPYGGP-QAPP  57



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D D++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+YR  R++TVEG D+PKPI+MF
Sbjct  102  DFDSVSLPKQNFGNLVHFEKNFYVESPAVQAMTEQDVAMYRTERDITVEGRDVPKPIKMF  161

Query  520  HEANFP  537
            H+ANFP
Sbjct  162  HDANFP  167



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  YRA RE+TV+G D+PKP+RMF
Sbjct  124  DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHYRASREITVQGNDVPKPVRMF  183

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  184  HEANFPDY  191



>ref|XP_010459859.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Camelina sativa]
Length=494

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  173

Query  520  HEANFP  537
            H+ANFP
Sbjct  174  HDANFP  179



>gb|AHZ57095.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=487

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDN+SLPKQ+FGNLV FEKNFY ESP V AMTE +VA+YR  R+++VEG D+PKPIRMF
Sbjct  110  ELDNVSLPKQNFGNLVHFEKNFYVESPDVQAMTEQDVAMYRTGRDISVEGRDVPKPIRMF  169

Query  520  HEANFP  537
             +ANFP
Sbjct  170  QDANFP  175



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  YRA RE+TV+G D+PKPI MF
Sbjct  36   DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHYRASREITVQGNDVPKPIMMF  95

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  96   HEANFPDY  103



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  173

Query  520  HEANFP  537
            H+ANFP
Sbjct  174  HDANFP  179



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LPKQDFG+LV FEKNFY ES SV AM+E EV +YR RRE+TVEG DIPKPI+MF
Sbjct  162  DLDNIVLPKQDFGSLVPFEKNFYVESSSVRAMSEQEVMVYRNRREITVEGHDIPKPIQMF  221

Query  520  HEANFPAY  543
             +ANFP Y
Sbjct  222  EDANFPDY  229



>ref|XP_007155471.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 ref|XP_007155473.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27465.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27467.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=501

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQ F NLV FEKNFY E P+V AMTE EV  YRA RE+TV+G D+PKP+RMF
Sbjct  122  DLNNITLPKQSFRNLVPFEKNFYVECPAVRAMTEQEVTHYRACREITVQGHDVPKPVRMF  181

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  182  HEANFPDY  189



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDNI+LPKQDFG+LV FEKN Y E+PS+ +M+EHEV  +RARRE+TVEG D+P+PIR+F
Sbjct  138  ELDNIALPKQDFGDLVPFEKNLYFENPSIRSMSEHEVVTFRARREITVEGHDVPRPIRIF  197

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  198  QEANFPDY  205



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDN+SLP+Q+FGNLV FEKNFY E PSV AMTE +VA+YR+ R+++VEG D+PKPIRMF
Sbjct  102  ELDNVSLPRQNFGNLVPFEKNFYVECPSVQAMTEQDVAMYRSSRDISVEGRDVPKPIRMF  161

Query  520  HEANFPAY  543
             EANFP +
Sbjct  162  QEANFPDH  169



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDN+SLPKQ+FGNLV FEKNFY ESP V AMTE +VA+YR  R+++VEG D+PKPIRMF
Sbjct  110  ELDNVSLPKQNFGNLVHFEKNFYVESPDVQAMTEQDVAMYRTGRDISVEGRDVPKPIRMF  169

Query  520  HEANFP  537
             +ANFP
Sbjct  170  QDANFP  175



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  YRA RE+TV+G D+PKPI MF
Sbjct  121  DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHYRASREITVQGNDVPKPIMMF  180

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  181  HEANFPDY  188



>ref|XP_008464518.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Cucumis melo]
Length=536

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LP Q+FGNLV FEKNFY+E PSV  MTE EV +YR RR++ VEG D+PKPIR F
Sbjct  144  DLDNIVLPSQNFGNLVPFEKNFYTECPSVRVMTESEVKIYRERRDIRVEGYDVPKPIRSF  203

Query  520  HEANFPAY  543
             EANFPAY
Sbjct  204  QEANFPAY  211



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD I LPKQDFG+LV FEKNFY ESPSV AM+EHEV  YR RRE+TVEG D+PKPI+ F
Sbjct  133  DLDGIVLPKQDFGDLVPFEKNFYVESPSVKAMSEHEVVAYRGRREITVEGHDVPKPIQTF  192

Query  520  HEANFPAY  543
             +A+FP Y
Sbjct  193  RDASFPGY  200



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQ F NLV FEKNFY E P+V AMTE EV  YRA RE+TV+G D+PKP+RMF
Sbjct  122  DLNNITLPKQSFRNLVPFEKNFYVECPAVRAMTEQEVTHYRACREITVQGHDVPKPVRMF  181

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  182  HEANFPDY  189



>ref|XP_007036327.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY20828.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=523

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN+SLP+Q+FGNLV FEKNFY ESP+V  MTE E  +YR  R++T++G D+PKP RMF
Sbjct  148  DLDNVSLPRQNFGNLVPFEKNFYVESPAVRGMTEQEAMVYRKTRDITIQGHDVPKPTRMF  207

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  208  HEANFPDY  215



>ref|XP_010444192.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Camelina sativa]
Length=488

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  167

Query  520  HEANFP  537
             +ANFP
Sbjct  168  QDANFP  173



>ref|XP_010484039.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  110  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  169

Query  520  HEANFP  537
             +ANFP
Sbjct  170  QDANFP  175



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI LP Q+FGNLV FEKNFY+E PSV  MTE EV +YR RR++ VEG D+PKPIR F
Sbjct  144  DLDNIVLPSQNFGNLVPFEKNFYTECPSVRVMTESEVKIYRERRDIRVEGYDVPKPIRSF  203

Query  520  HEANFPAY  543
             EANFPAY
Sbjct  204  QEANFPAY  211



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDN+SLP+Q+FGNLV FEKNFY ESP+V  MTE E  +YR  R++T++G D+PKP RMF
Sbjct  148  DLDNVSLPRQNFGNLVPFEKNFYVESPAVRGMTEQEAMVYRKTRDITIQGHDVPKPTRMF  207

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  208  HEANFPDY  215



>ref|NP_568964.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 gb|AAL31214.1| AT5g63120/MDC12_8 [Arabidopsis thaliana]
 gb|AAN18177.1| At5g63120/MDC12_8 [Arabidopsis thaliana]
 gb|AED97707.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=484

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+YR  R+++VEG D+PKP++MF
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMF  167

Query  520  HEANFP  537
             +ANFP
Sbjct  168  QDANFP  173



>ref|XP_006280217.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13115.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=486

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  109  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKVF  168

Query  520  HEANFP  537
             +ANFP
Sbjct  169  QDANFP  174



>gb|KHG00890.1| DEAD-box ATP-dependent RNA helicase 30 [Gossypium arboreum]
Length=516

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 105/211 (50%), Gaps = 39/211 (18%)
 Frame = +1

Query  4    ADSNSYRQRRSDLIGPPHIAG------GAALSNS--RGAPTPYG---------------G  114
             D  SYRQRRSD +G P   G      G A+ +S  RG   PYG               G
Sbjct  9    GDPQSYRQRRSDFMGQPPPVGPTTMGPGMAMPSSYPRGGQIPYGGPPTAHPPSFHGRVHG  68

Query  115  PVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghggrggg  270
            PV     +  + SF+             F++ RGG        R S     R  G  GGG
Sbjct  69   PVRGQGDFDSYSSFRPPVGR--------FEMGRGGDIGHSHADRRSDGIRGREAGRGGGG  120

Query  271  rsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEV  450
            R G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  MTE EV
Sbjct  121  RGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREMTEQEV  180

Query  451  ALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
              YR  R++TV+G D+PKPIRMF +ANFP Y
Sbjct  181  MFYRRTRDITVQGHDVPKPIRMFRDANFPDY  211



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLDNI+L K DF  L+ F+K+FY ESPSV AMTE EV +YRA RE+TVEG D+PKP+RMF
Sbjct  111  DLDNITLTKPDFRGLIPFKKDFYVESPSVRAMTEQEVLMYRAHREITVEGQDVPKPVRMF  170

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  171  HEANFPDY  178



>gb|KJB40104.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
 gb|KJB40105.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
 gb|KJB40106.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=516

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 105/211 (50%), Gaps = 39/211 (18%)
 Frame = +1

Query  4    ADSNSYRQRRSDL------IGPPHIAGGAALSNS--RGAPTPYG---------------G  114
             D  SYRQRRSD       +GPP +  G  + +S  RG   PYG               G
Sbjct  9    GDPQSYRQRRSDFMGQPPPVGPPTMGPGMVMPSSYPRGGQIPYGGPPTAHPPSFHGRVHG  68

Query  115  PVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghggrggg  270
            PV     +  + SF+             F++ RGG        R S     R  G  GGG
Sbjct  69   PVRGQGDFDSYSSFRPPAGR--------FEMGRGGDIGHSHADRRSDGIRVREAGRGGGG  120

Query  271  rsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEV  450
            R G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  MTE EV
Sbjct  121  RGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREMTEQEV  180

Query  451  ALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
              YR  R++TV+G ++PKPIRMF +ANFP Y
Sbjct  181  MFYRRTRDITVQGHNVPKPIRMFRDANFPDY  211



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  110  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  169

Query  520  HEANFP  537
             +ANFP
Sbjct  170  QDANFP  175



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKLF  167

Query  520  HEANFP  537
             +ANFP
Sbjct  168  QDANFP  173



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD ISLPK DF  L+ F+K+FY ESPSV AMTE EV +YRARR++T+EG D+PKPIRMF
Sbjct  122  DLDAISLPKPDFRGLIAFKKDFYVESPSVRAMTEQEVMIYRARRDITIEGHDVPKPIRMF  181

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  182  QEANFPDY  189



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKP+++F
Sbjct  105  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPVKLF  164

Query  520  HEANFP  537
             +ANFP
Sbjct  165  QDANFP  170



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+YR  R+++VEG D+PKPI++F
Sbjct  109  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMYRTERDISVEGRDVPKPIKVF  168

Query  520  HEANFP  537
             +ANFP
Sbjct  169  QDANFP  174



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD I+LPKQ+F +L+ FEKNFY ES SV AM+E +V LYR RRE+TVEG DIPKPIR F
Sbjct  223  DLDKIALPKQNFHDLIPFEKNFYIESLSVQAMSEQDVMLYRKRREITVEGRDIPKPIRFF  282

Query  520  HEANFPA  540
            HEANFPA
Sbjct  283  HEANFPA  289



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+YR  R+++VEG D+PKP++MF
Sbjct  81   ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMF  140

Query  520  HEANFP  537
             +ANFP
Sbjct  141  QDANFP  146



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+YR  R+++VEG D+PKP++MF
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMYRTERDISVEGRDVPKPMKMF  167

Query  520  HEANFP  537
             +ANFP
Sbjct  168  QDANFP  173



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 105/211 (50%), Gaps = 39/211 (18%)
 Frame = +1

Query  4    ADSNSYRQRRSDL------IGPPHIAGGAALSNS--RGAPTPYG---------------G  114
             D  SYRQRRSD       +GPP +  G  + +S  RG   PYG               G
Sbjct  9    GDPQSYRQRRSDFMGQPPPVGPPTMGPGMVMPSSYPRGGQIPYGGPPTAHPPSFHGRVHG  68

Query  115  PVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghggrggg  270
            PV     +  + SF+             F++ RGG        R S     R  G  GGG
Sbjct  69   PVRGQGDFDSYSSFRPPAGR--------FEMGRGGDIGHSHADRRSDGIRVREAGRGGGG  120

Query  271  rsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEV  450
            R G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  MTE EV
Sbjct  121  RGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREMTEQEV  180

Query  451  ALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
              YR  R++TV+G ++PKPIRMF +ANFP Y
Sbjct  181  MFYRRTRDITVQGHNVPKPIRMFRDANFPDY  211



>gb|KGN63542.1| hypothetical protein Csa_1G004080 [Cucumis sativus]
Length=550

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDNI LP Q+FGNLV FEKNFY+E PSV AMTE EV +YR RR++ VEG D+P+PIR F 
Sbjct  145  LDNIVLPSQNFGNLVPFEKNFYTECPSVRAMTESEVKIYRERRDIRVEGYDVPRPIRSFQ  204

Query  523  EANFPAY  543
            EANFPAY
Sbjct  205  EANFPAY  211



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD ISLPK DF  L+ F+K+FY ESPSV AMTE EV +YRARR++T+EG D+PKPIRMF
Sbjct  148  DLDAISLPKPDFRGLIAFKKDFYVESPSVRAMTEQEVMIYRARRDITIEGHDVPKPIRMF  207

Query  520  HEANFPAY  543
             EANFP Y
Sbjct  208  QEANFPDY  215



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+YR  R+++VEG D+PKPI+MF
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPAVQAMTEQDVAMYRTGRDISVEGRDVPKPIKMF  173

Query  520  HEANFP  537
             +ANFP
Sbjct  174  EDANFP  179



>ref|XP_009112064.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Brassica rapa]
Length=488

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALYR  ++++VEG D+PKPI+MF
Sbjct  109  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALYRTEKDISVEGRDVPKPIKMF  168

Query  520  HEANFP  537
             +ANFP
Sbjct  169  QDANFP  174



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDNI LP Q+FGNLV FEKNFY+E PSV AMTE EV +YR RR++ VEG D+P+PIR F 
Sbjct  145  LDNIVLPSQNFGNLVPFEKNFYTECPSVRAMTESEVKIYRERRDIRVEGYDVPRPIRSFQ  204

Query  523  EANFPAY  543
            EANFPAY
Sbjct  205  EANFPAY  211



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALYR  ++++VEG D+PKPI+MF
Sbjct  109  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALYRTEKDISVEGRDVPKPIKMF  168

Query  520  HEANFP  537
             +ANFP
Sbjct  169  QDANFP  174



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALYR  ++++VEG D+PKPI+MF
Sbjct  110  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALYRTEKDISVEGRDVPKPIKMF  169

Query  520  HEANFP  537
             +ANFP
Sbjct  170  QDANFP  175



>gb|KEH31792.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=523

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV F+KNFY ESP + AM++ +V  YRA R++TVEG D+PKPIR F
Sbjct  144  DLNNITLPKQDFRNLVPFQKNFYVESPMIQAMSDQQVMQYRASRDITVEGHDVPKPIRAF  203

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  204  HEANFPDY  211



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV F+KNFY ESP + AM++ +V  YRA R++TVEG D+PKPIR F
Sbjct  144  DLNNITLPKQDFRNLVPFQKNFYVESPMIQAMSDQQVMQYRASRDITVEGHDVPKPIRAF  203

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  204  HEANFPDY  211



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VA+YR  ++++VEG D+PKPI+MF
Sbjct  112  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEQDVAMYRTEKDISVEGRDVPKPIKMF  171

Query  520  HEANFP  537
             +ANFP
Sbjct  172  QDANFP  177



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LDNI LPKQDF +LV FEKNFY ES SV AM+E EV +YR RRE+TVEG DIPKPI+MF 
Sbjct  134  LDNIVLPKQDFRSLVPFEKNFYVESSSVRAMSEQEVMVYRNRREITVEGHDIPKPIQMFE  193

Query  523  EANFPAY  543
            +ANFP Y
Sbjct  194  DANFPDY  200



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD +SLPKQDF +L+ FEKNFY ESP+V AM+E +  LYR  RE+TVEG D+PKPIR F
Sbjct  227  DLDKLSLPKQDFHDLIPFEKNFYVESPAVQAMSEQDAMLYRKGREITVEGRDVPKPIRFF  286

Query  520  HEANFPA  540
            HEANFP+
Sbjct  287  HEANFPS  293



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DL+NI+LPKQDF NLV F+KNFY ES S+ AM++H+V  YRA R++TVEG D+PKPIR F
Sbjct  140  DLNNINLPKQDFRNLVPFQKNFYVESSSIAAMSDHQVMHYRASRDITVEGHDVPKPIRGF  199

Query  520  HEANFP  537
            HEANFP
Sbjct  200  HEANFP  205



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD +SLPKQDF +L  FEKNFY ESP+V AM+E +  LYR  RE+TVEG D+PKPIR F
Sbjct  209  DLDKLSLPKQDFRDLNPFEKNFYVESPAVQAMSEQDAMLYRKSREITVEGRDVPKPIRFF  268

Query  520  HEANFP  537
            HEANFP
Sbjct  269  HEANFP  274



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LD+I LP +DFG L+ FEKNFY E+P+V  M+E +V LYR  R++TVEG D+PKPIR F
Sbjct  194  ELDSIELPPEDFGELIPFEKNFYVENPAVQVMSEQDVVLYRKSRDITVEGRDVPKPIRYF  253

Query  520  HEANFPAY  543
            HEANFP Y
Sbjct  254  HEANFPDY  261



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD+I+LP Q+F NL+ FEKNFY E P+V A+TE EVA YR +RE+TVEG  +PKP+R F
Sbjct  37   DLDDIALPAQEFENLIPFEKNFYVEHPAVSALTEEEVAAYRRKREITVEGRTVPKPVRTF  96

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  97   EEASFPDY  104



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD+++LPKQ+F NLV FEK+FY ES SV AM++ EV +YRA R++TVEG D+P+PI+ F
Sbjct  169  DLDSMALPKQEFRNLVPFEKDFYLESSSVRAMSDQEVMMYRASRDITVEGHDVPRPIQSF  228

Query  520  HEANFPAY  543
            HEA  PAY
Sbjct  229  HEAGLPAY  236



>dbj|BAJ85074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF  L+ FEK+FY E P+V AM+E EVA YR  R++TVEG ++PKPIR FH
Sbjct  98   LDSLSLPKPDFRGLIPFEKSFYVECPAVQAMSETEVAQYRQLRDITVEGREVPKPIRFFH  157

Query  523  EANFPAY  543
            EANFP Y
Sbjct  158  EANFPDY  164



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D D+ISLPKQDF NL+ FEKNFY E+P + +MTE EV  YR RRE+T++G D+PKP++ F
Sbjct  42   DFDSISLPKQDFENLIPFEKNFYVETPGIASMTEDEVREYRNRREITIDGRDVPKPVKNF  101

Query  520  HEANFPAY  543
             +A FP Y
Sbjct  102  GDAGFPDY  109



>tpg|DAA56211.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=397

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA YR  R++T+EG D+PKP+R F 
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQYRRLRDITIEGRDVPKPVRYFQ  156

Query  523  EANFPAY  543
            EANFP Y
Sbjct  157  EANFPDY  163



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK+DF NL+ FEKNFY E P+V A+++HEV+ YR RRE+TVEG D+PKP+R F 
Sbjct  114  LDSVALPKEDFDNLIPFEKNFYVEHPAVAALSDHEVSAYRKRREITVEGRDVPKPLRSFR  173

Query  523  EANF  534
            EA+F
Sbjct  174  EASF  177



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF  L+ FEK+FY E P+V AM++ EVA YR  R++TVEG ++PKPIR FH
Sbjct  98   LDSLSLPKADFRGLIPFEKSFYVECPAVQAMSDTEVAQYRQLRDITVEGREVPKPIRFFH  157

Query  523  EANFPAY  543
            EANFP Y
Sbjct  158  EANFPDY  164



>tpg|DAA56212.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=473

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA YR  R++T+EG D+PKP+R F 
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQYRRLRDITIEGRDVPKPVRYFQ  156

Query  523  EANFPAY  543
            EANFP Y
Sbjct  157  EANFPDY  163



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA YR  R++TVEG D+PKP+R F 
Sbjct  103  LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQYRRLRDITVEGRDVPKPVRYFQ  162

Query  523  EANFPAY  543
            EANFP Y
Sbjct  163  EANFPDY  169



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD ++LPK DF +L+ FEKNFY ESPSV AM++ +VA YR  R++TVEG D+PKP+R F 
Sbjct  95   LDTLALPKPDFRSLIPFEKNFYVESPSVQAMSDADVAQYRRLRDITVEGRDVPKPVRYFQ  154

Query  523  EANFPAY  543
            EANFP Y
Sbjct  155  EANFPDY  161



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA YR  R++T+EG D+PKP+R F 
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQYRRLRDITIEGRDVPKPVRYFQ  156

Query  523  EANFPAY  543
            EANFP Y
Sbjct  157  EANFPDY  163



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD+++LPK DF  L+ FEK+FY E P+V AM++ EVA YR  R++TVEG ++PKPIR FH
Sbjct  98   LDSLNLPKADFRGLIPFEKSFYVECPAVQAMSDTEVAQYRQLRDITVEGREVPKPIRFFH  157

Query  523  EANFPAY  543
            EANFP Y
Sbjct  158  EANFPDY  164



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD ++LPK DF +L+ FEKNFY ESPSV AM++ +VA YR  R++TVEG D+PKP+R F 
Sbjct  95   LDTLALPKPDFRSLIPFEKNFYVESPSVQAMSDADVAQYRRLRDITVEGRDVPKPVRYFQ  154

Query  523  EANFPAY  543
            EANFP Y
Sbjct  155  EANFPDY  161



>gb|KCW83295.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=464

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D +    PK +F  LV FEKN Y ESP V AM+EHEV  YRARR++TVEG D+PKPIR F
Sbjct  84   DHEKFDFPKPNFDQLVPFEKNLYVESPMVAAMSEHEVRTYRARRDITVEGNDVPKPIRTF  143

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  144  QEASFPGY  151



>dbj|BAD82428.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82340.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
Length=477

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ YR +R++TVEG D+PKP+R F 
Sbjct  100  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQYRRQRDITVEGHDVPKPVRYFQ  159

Query  523  EANFPAY  543
            EANFP Y
Sbjct  160  EANFPDY  166



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD +SLPK DF +L+ FEKNFY E P+V AM++ +VA YR  R++TVEG D+PKP+R F 
Sbjct  76   LDTLSLPKPDFRSLIPFEKNFYVECPAVQAMSDTDVAQYRRHRDITVEGHDVPKPVRYFQ  135

Query  523  EANFPAY  543
            EANFP Y
Sbjct  136  EANFPDY  142



>gb|KCW83293.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
 gb|KCW83294.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=512

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D +    PK +F  LV FEKN Y ESP V AM+EHEV  YRARR++TVEG D+PKPIR F
Sbjct  135  DHEKFDFPKPNFDQLVPFEKNLYVESPMVAAMSEHEVRTYRARRDITVEGNDVPKPIRTF  194

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  195  QEASFPGY  202



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D DNISLPKQDF  L  FEKNFY ES +V +MTE EV  YR RR++TV+G D+PKP+  F
Sbjct  38   DFDNISLPKQDFDGLTHFEKNFYVESEAVASMTEEEVEAYRQRRQITVDGRDVPKPVTNF  97

Query  520  HEANFPAY  543
             +  FP Y
Sbjct  98   CDIGFPDY  105



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ YR +R++TVEG D+PKP+R F 
Sbjct  100  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQYRRQRDITVEGHDVPKPVRYFQ  159

Query  523  EANFPAY  543
            EANFP Y
Sbjct  160  EANFPDY  166



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ YR +R++TVEG D+PKP+R F 
Sbjct  195  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQYRRQRDITVEGHDVPKPVRYFQ  254

Query  523  EANFPAY  543
            EANFP Y
Sbjct  255  EANFPDY  261



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D +    PK +F  LV FEKN Y ESP V AM+EHEV  YRARR++TVEG D+PKPIR F
Sbjct  135  DHEKFDFPKPNFDQLVPFEKNLYVESPMVAAMSEHEVRTYRARRDITVEGNDVPKPIRTF  194

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  195  QEASFPGY  202



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            LD++SLPK DF +L+ FEK+FY E P+V AM++ EVA YR  R++TVEG ++PKPIR F 
Sbjct  101  LDSLSLPKPDFRDLIPFEKSFYVECPAVQAMSDMEVAQYRQLRDITVEGREVPKPIRYFQ  160

Query  523  EANFPAY  543
            EANFP Y
Sbjct  161  EANFPDY  167



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            KQD   L+ FEKNFY+ESP+V AMTE EV  YR RRE+TVEG DIPKP++ FH+  FP Y
Sbjct  50   KQDLDGLIPFEKNFYAESPAVAAMTEAEVENYRQRREITVEGRDIPKPVKNFHDVGFPDY  109



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D D++ LPK+ F NL  FEKNFY E PSV A+T+ EV  +R R+++TV+G ++PKP+R F
Sbjct  28   DFDSMVLPKEQFDNLSPFEKNFYIEHPSVAALTDDEVVDFRRRKDITVQGRNVPKPVRSF  87

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  88   AEASFPDY  95



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            D D++ LPK+ F NL  FEKNFY E PSV A+T+ EV  +R R+++TV+G ++PKP+R F
Sbjct  33   DFDSMVLPKEQFDNLSPFEKNFYIEHPSVAALTDDEVVDFRRRKDITVQGRNVPKPVRSF  92

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  93   AEASFPDY  100



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L  FEKNFY ESPSV+AMTE EV  YR +RE+T+EG D+PKPIR F +A FP Y
Sbjct  45   DLDGLTLFEKNFYVESPSVVAMTESEVEAYRRKREITIEGRDVPKPIREFRDAGFPDY  102



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L  FEKNFY ESPSV+AMTE EV  YR +RE+T+EG D+PKPIR F +A FP Y
Sbjct  45   DLDGLTPFEKNFYVESPSVVAMTEAEVEAYRRKREITIEGRDVPKPIREFRDAGFPDY  102



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L  FEKNFY ESPSV+AMTE EV  YR +RE+T+EG D+PKPIR F +A FP Y
Sbjct  45   DLDGLTPFEKNFYVESPSVVAMTEAEVEAYRRKREITIEGRDVPKPIREFRDAGFPDY  102



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    PK+ D   L  FEKNFY ESP V AMTE EV  YR RRE+TVEG D+PKPI+ 
Sbjct  41   DYDGAESPKKLDLDGLTPFEKNFYVESPEVEAMTEREVEEYRKRREITVEGRDVPKPIKS  100

Query  517  FHEANFPAY  543
            F ++ FP Y
Sbjct  101  FRDSGFPEY  109



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  46   DLDGLPRFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  103



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +   L  FEKNFYSESPSV AMTE EV  YR RRE+TVEG D+PKP++ F +A FP Y
Sbjct  46   KINLDGLPHFEKNFYSESPSVRAMTEAEVTEYRLRREITVEGKDVPKPVKSFSDAAFPDY  105



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +   L  FEKNFYSESPSV AMTE EV  YR RRE+TVEG D+PKP++ F +A FP Y
Sbjct  46   KINLDGLPHFEKNFYSESPSVRAMTEAEVTEYRLRREITVEGKDVPKPVKSFSDAAFPDY  105



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +  +L  FEKNFY ESPS+ AMTE EV  YR RRE+T+EG D+PKPI+ FH+  FP Y
Sbjct  47   KVNLDDLTPFEKNFYVESPSIAAMTEGEVEEYRLRREITIEGRDVPKPIKSFHDIGFPDY  106



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNF+ ESPSV AM+E EV  YR RRE+TVEG D+PKP++ FH+  FP Y
Sbjct  51   KSDLDGLTPFEKNFHVESPSVAAMSEREVEEYRQRREITVEGRDVPKPVKSFHDVGFPDY  110



>emb|CAN70592.1| hypothetical protein VITISV_026736 [Vitis vinifera]
Length=115

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            DLD +  P++ D   L  FEKNFY ESP+V AM+E EV  YR RRE+TVEG D+PKP+  
Sbjct  42   DLDGVESPRKPDLDGLTPFEKNFYVESPAVAAMSEKEVEQYRERREITVEGRDVPKPVMN  101

Query  517  FHEANFPA  540
            F +   P 
Sbjct  102  FRDVGLPV  109



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            IS  K D   L  FEKNFY ESPSV AM+E EV  YR RRE+TVEG D+PKP++ F +  
Sbjct  46   ISPRKSDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQRREITVEGRDVPKPVKSFRDVG  105

Query  532  FPAY  543
            FP Y
Sbjct  106  FPDY  109



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  DLDNISLPKQDFG--NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIR  513
            D D+   PK++     L  FEKNFY ESP+V AMT+ EV  YR +RE+TVEG DIPKP++
Sbjct  42   DYDDGGSPKRNLSLDGLPHFEKNFYIESPAVRAMTDAEVNEYRQQREITVEGRDIPKPVK  101

Query  514  MFHEANFPAY  543
             FH+A FP Y
Sbjct  102  TFHDAGFPEY  111



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  DLDNISLPKQDFG--NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIR  513
            D D+   PK++     L  FEKNFY ESP+V AMT+ EV  YR +RE+TVEG DIPKP++
Sbjct  42   DYDDGGSPKRNLSLDGLPHFEKNFYVESPAVRAMTDAEVNEYRQQREITVEGRDIPKPVK  101

Query  514  MFHEANFPAY  543
             FH+A FP Y
Sbjct  102  SFHDAGFPEY  111



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AMTE EV  YR +RE+TVEG DIPKP++ F +  FP Y
Sbjct  48   KPDLDGLTPFEKNFYVESPSVAAMTEAEVEEYRKKREITVEGRDIPKPVKSFRDVGFPDY  107



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNF+ ESPSV AM+E +V  YR RRE+TVEG D+PKP++ FH+  FP Y
Sbjct  42   KSDLDGLTPFEKNFHVESPSVAAMSERDVEEYRLRREITVEGRDVPKPVKSFHDVGFPDY  101



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  DLDNISLPKQDFG--NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIR  513
            D D+   PK++     L  FEKNFY ESP+V AMT+ EV  YR +RE+TVEG DIPKP++
Sbjct  42   DYDDGGSPKRNLSLDGLPHFEKNFYVESPAVRAMTDAEVNEYRQQREITVEGRDIPKPVK  101

Query  514  MFHEANFPAY  543
             FH+A FP Y
Sbjct  102  SFHDAGFPEY  111



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  QDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
             D   L  FEKNFY ESPSV AMTE EV  YR RR++TVEG D+P P+R F EA FP Y
Sbjct  58   HDLDGLPHFEKNFYIESPSVAAMTESEVEEYRQRRQITVEGRDVPNPVREFREAGFPEY  116



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            DLD +  P++ D   L  FEKNFY ESP+V AM+E EV  YR RRE+TVEG D+PKP+  
Sbjct  42   DLDGVESPRKPDLDGLTPFEKNFYVESPAVAAMSEKEVEQYRERREITVEGRDVPKPVMN  101

Query  517  FHEANFPAY  543
            F +   P Y
Sbjct  102  FRDVGLPEY  110



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AMTE EV  YR +RE+TVEG DIPKP++ F +  FP Y
Sbjct  48   KPDLDGLTPFEKNFYVESPSVAAMTEAEVEEYRKKREITVEGRDIPKPVKSFRDVGFPDY  107



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  LVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            L RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  48   LPRFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  101



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  LVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            L RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  48   LPRFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  101



>gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  49   KSDLDGLTPFEKNFYIESPSVAAMSEREVDEYRQRREITVEGRDVPKPVKSFRDMGFPEY  108



>dbj|BAD73320.1| putative ethylene-responsive RNA helicase [Oryza sativa Japonica 
Group]
Length=521

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  388  RFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  50   RFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  101



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AMTE EV  YR +RE+TVEG DIPKP++ F +  FP Y
Sbjct  48   KPDLDGLTPFEKNFYVESPSVAAMTEAEVEEYRNKREITVEGRDIPKPVKSFRDVGFPDY  107



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  LVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            L RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  39   LPRFEKNFYVESPSVAGMTEDEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  92



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY E+PSV AMTE EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLPHFEKNFYIEAPSVAAMTEREVEEYRQRREITVEGRDVPKPVKSFRDVGFPDY  109



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY E+PSV AMTE EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KVDLDGLPHFEKNFYIEAPSVAAMTEREVEEYRQRREITVEGRDVPKPVKSFRDVGFPDY  109



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +   L  FEKNFY+ESPSV AMTE EV  YR RRE+TVEG D+PKP++ F +A FP Y
Sbjct  48   KINLDGLPHFEKNFYNESPSVRAMTEAEVNEYRLRREITVEGKDVPKPVQSFSDAAFPDY  107



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQRREITVEGRDVPKPVKSFADVGFPDY  109



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY ESP+V  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  42   ELDGLPRFEKNFYVESPAVAGMTEDEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  99



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY ESP+V  MTE EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  42   ELDGLPRFEKNFYVESPAVAGMTEDEVEAYRRRREITVEGRDVPKPVREFRDVGFPEY  99



>ref|XP_006426527.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39767.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|KDO65285.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=433

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  109



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +   L  FEKNFY+ESPSV AMTE EV  YR RRE+TVEG D+PKP++ F +A FP Y
Sbjct  48   KINLDGLPHFEKNFYNESPSVRAMTEAEVNEYRLRREITVEGKDVPKPVQSFSDAAFPDY  107



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  GNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            G L  FEKNFY E+PSV AMTE EV  YR +RE+TVEG D+PKP+R F +  FP Y
Sbjct  50   GLLTPFEKNFYVEAPSVAAMTEEEVEAYRRKREITVEGRDVPKPVREFQDIGFPEY  105



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  109



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  109



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ 
Sbjct  41   DYDGAESPRKLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKS  100

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  101  FRDVGFPDY  109



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ 
Sbjct  41   DYDGAESPRKLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKS  100

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  101  FRDVGFPDY  109



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ 
Sbjct  41   DYDGAESPRKLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKS  100

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  101  FRDVGFPDY  109



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  109



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  109



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  37   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  96



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  44   KLDLDGLTPFEKNFYVESPSVAAMSEREVEEYRQQREITVEGRDVPKPVKSFRDVGFPDY  103



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY ESP+V  MTE EV  YR RRE+TV+G D+PKP+R F +  FP Y
Sbjct  44   ELDGLPRFEKNFYVESPAVAGMTEEEVEAYRRRREITVDGRDVPKPVREFRDVGFPEY  101



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    PK+ D   L  FEKNFY ESPSV +M+E EV  YR RRE+TVEG D+PKP++ 
Sbjct  36   DYDGGESPKKFDVDGLTPFEKNFYVESPSVASMSEREVEEYRQRREITVEGRDVPKPVKN  95

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  96   FRDVGFPDY  104



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L  FEKNFY ESPSV AMT+ +V  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   RTDLDGLTPFEKNFYIESPSVAAMTDKDVEDYRKRREITVEGQDVPKPVKSFEDVGFPDY  109



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L  FEKNFY ESPSV AMT+ +V  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   RTDLDGLTPFEKNFYIESPSVAAMTDKDVEDYRKRREITVEGQDVPKPVKSFEDVGFPDY  109



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM+E EV  YR +RE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPSVAAMSEMEVEEYRQKREITVEGRDVPKPVKSFADVRFPDY  109



>gb|AHA84137.1| DEAD-box ATP-dependent RNA helicase 20 [Phaseolus vulgaris]
Length=507

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  DLDNISLPKQDFG--NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIR  513
            D D+   PK++     L  FEKNFY ESP+V AMT+ EV  YR +RE+TVEG DIPKP++
Sbjct  42   DHDDGGSPKRNLSLDGLPHFEKNFYIESPAVRAMTDAEVNEYRQQREITVEGRDIPKPVK  101

Query  514  MFHEANFPAY  543
             F +A FP Y
Sbjct  102  TFQDAGFPEY  111



>ref|XP_002455005.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
 gb|EES00125.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
Length=488

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY ESPSV  MTE EV  YR RRE+TVEG D+PKP+  F +  FP Y
Sbjct  44   ELDGLPRFEKNFYVESPSVAGMTEEEVEAYRRRREITVEGRDVPKPVLEFRDVGFPEY  101



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L+ FEKNFY ESP V  M+E EV  YR RRE+TVEG D+PKPI+ F +  FP Y
Sbjct  50   KLDLDGLIPFEKNFYVESPEVEKMSEVEVEEYRKRREITVEGRDVPKPIKSFRDTGFPEY  109



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFH  522
            +++  LPK+DF NL +FEKNFY E P+V A +E EV  YR  RE+ V G  IPKP+  F 
Sbjct  72   INSTFLPKEDFSNLPKFEKNFYYEHPAVTARSEEEVRRYREMREIHVTGEGIPKPVSNFE  131

Query  523  EANFPAY  543
            EA+FP Y
Sbjct  132  EASFPEY  138



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  DLDNISLPKQDFG--NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIR  513
            D D+   PK++     L  FEKNFY ESP+V AMT+ EV  YR +RE+TVEG DIPKP++
Sbjct  42   DHDDGGSPKRNLSLDGLPHFEKNFYIESPAVRAMTDAEVNEYRQQREITVEGRDIPKPVK  101

Query  514  MFHEANFPAY  543
             F +A FP Y
Sbjct  102  TFQDAGFPEY  111



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP+V AMT+ EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPTVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDY  109



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K +   L  FEKNFY ESPS+ AM+E EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  54   KSNLDGLTPFEKNFYVESPSIAAMSEGEVEEYRLRREITVEGKDVPKPVKSFDDVGFPDY  113



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP + AMTE EV  YR +RE+TVEG ++PKP++ FH+  FP Y
Sbjct  47   KVDLDGLTPFEKNFYVESPFIAAMTESEVEEYRRQREITVEGREVPKPVKSFHDVGFPDY  106



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K DF  L  FEKNFY ES +V AMTE EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  13   KLDFDGLTPFEKNFYVESQAVAAMTEAEVEEYRKLREITVEGRDIPKPVKSFRDVGFPDY  72



>ref|XP_007215260.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16459.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=424

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESP V  M+E EV  YR RRE+T+EG D+PKPI+ 
Sbjct  40   DCDGAESPRKFDLDGLTPFEKNFYVESPEVERMSEKEVEDYRQRREITIEGRDVPKPIKS  99

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  100  FRDTGFPEY  108



>ref|XP_007215259.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16458.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=421

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESP V  M+E EV  YR RRE+T+EG D+PKPI+ 
Sbjct  40   DCDGAESPRKFDLDGLTPFEKNFYVESPEVERMSEKEVEDYRQRREITIEGRDVPKPIKS  99

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  100  FRDTGFPEY  108



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K DF  L  FEKNFY ES +V AMTE EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  51   KLDFDGLTPFEKNFYVESQAVAAMTEAEVEEYRKLREITVEGRDIPKPVKSFRDVGFPDY  110



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP+V AMT+ EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPAVAAMTDTEVEEYRKLREITVEGKDIPKPVKSFRDVGFPDY  109



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            KQ    L  FEKNFY ES SV AMTE EV  YR RR++TVEG D+PKP++ F +  FP Y
Sbjct  57   KQGLDGLTHFEKNFYIESASVAAMTESEVEEYRQRRQITVEGRDVPKPVQDFRDVGFPDY  116



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            KQ    L  FEKNFY ES SV AMTE EV  YR RR++TVEG D+PKP++ F +  FP Y
Sbjct  51   KQGLDGLTHFEKNFYIESASVAAMTESEVEEYRQRRQITVEGRDVPKPVQDFRDVGFPDY  110



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            KQ    L  FEKNFY ES SV AMTE EV  YR RR++TVEG D+PKP++ F +  FP Y
Sbjct  58   KQGLDGLTHFEKNFYIESASVAAMTESEVEEYRQRRQITVEGRDVPKPVQDFRDVGFPDY  117



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  DLDNISLPKQ-DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRM  516
            D D    P++ D   L  FEKNFY ESP V  M+E EV  YR RRE+T+EG D+PKPI+ 
Sbjct  40   DCDGAESPRKFDLDGLTPFEKNFYVESPEVERMSEKEVEDYRQRREITIEGRDVPKPIKS  99

Query  517  FHEANFPAY  543
            F +  FP Y
Sbjct  100  FRDTGFPEY  108



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP+V AMT+ EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  48   KLDLDGLTPFEKNFYVESPAVAAMTDSEVDEYRKLREITVEGRDIPKPVKSFRDVGFPDY  107



>gb|KIZ00407.1| ATP-dependent RNA helicase DDX5/DBP2 [Monoraphidium neglectum]
Length=552

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD I L + DF NL  FEKNFY E P+V A +E E+  YR +R + V G  +PKP+  F
Sbjct  83   DLDTIQLSRPDFSNLPVFEKNFYFEHPAVTARSEGEIEAYRVKRSIHVYGEGVPKPVETF  142

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  143  EEASFPEY  150



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY E+PS+ AMT+ EVA YR  R++T+EG D+PKP++ F +  FP Y
Sbjct  49   KLDLDGLTPFEKNFYVETPSIAAMTDEEVAQYRRVRDITIEGRDVPKPVKTFSDVGFPEY  108



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            KQD   L  FEKNFY ESP+V AMTE EV  YR     TVEG DIPKP++ FH+  FP Y
Sbjct  50   KQDLAGLTPFEKNFYVESPAVAAMTEAEVEEYRQGGGNTVEGRDIPKPVKTFHDVGFPDY  109



>gb|KJE94426.1| hypothetical protein CAOG_008856 [Capsaspora owczarzaki ATCC 
30864]
Length=650

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            +S P+ D   L +FEKNFY E P+V AM++ EV  +R  REVTV G ++PKP+R F EA 
Sbjct  132  LSKPQWDLSRLPKFEKNFYVEHPAVSAMSQQEVDEFRRSREVTVNGRNVPKPVRTFEEAG  191

Query  532  FPAY  543
            FP Y
Sbjct  192  FPDY  195



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  NISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEA  528
            N+S  K D   L  FEKNFY ES +V +MTE EV  YR  RE+TVEG DIPKP++ F + 
Sbjct  8    NVSPRKLDLDGLTPFEKNFYVESQAVASMTEAEVEEYRKLREITVEGRDIPKPVKSFRDV  67

Query  529  NFPAY  543
             FP Y
Sbjct  68   GFPDY  72



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  NISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEA  528
            N+S  K D   L  FEKNFY ES +V +MTE EV  YR  RE+TVEG DIPKP++ F + 
Sbjct  46   NVSPRKLDLDGLTPFEKNFYVESQAVASMTEAEVEEYRKLREITVEGRDIPKPVKSFRDV  105

Query  529  NFPAY  543
             FP Y
Sbjct  106  GFPDY  110



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP+V AMTE +V  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  50   KPDLDGLTPFEKNFYVESPAVAAMTEAQVEEYRRLREITVEGRDIPKPVKSFRDVGFPDY  109



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  SLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANF  534
            SL   D   L  FEKNFY ESP V  M+E EV  YR RRE+T+EG D+PKPI+ F +  F
Sbjct  46   SLRTFDLDGLTPFEKNFYVESPEVERMSEKEVEEYRQRREITIEGRDVPKPIKSFRDTGF  105

Query  535  PAY  543
            P Y
Sbjct  106  PEY  108



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESPSV AM++ EV  YR RRE+TVEG D+PKP+  F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYIESPSVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDY  109



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP V AMT+ EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  48   KLDLDGLTPFEKNFYVESPVVAAMTDAEVDEYRKLREITVEGRDIPKPVKSFRDVGFPDY  107



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY E P+V  MT  EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  46   ELDGLPRFEKNFYVEVPAVAGMTAEEVEAYRRRREITVEGNDVPKPVRDFRDVGFPEY  103



>gb|EMS55994.1| DEAD-box ATP-dependent RNA helicase 20 [Triticum urartu]
Length=491

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY E P+V  MT  EV  YR RRE+TVEG D+PKP+R F +  FP Y
Sbjct  46   ELDGLPRFEKNFYGEVPAVAGMTAEEVEAYRRRREITVEGNDVPKPVRDFRDVGFPDY  103



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP V AM+  EV  YR RRE+TVEG D+PKP++ F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYVESPLVAAMSATEVEEYRQRREITVEGRDVPKPVKSFRDMGFPEY  109



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L+ FEKNFY ES  V  M+E EV  YR RRE+TVEG D+PKPI+ F +  FP Y
Sbjct  50   KLDLDGLIPFEKNFYVESAEVEKMSEVEVEEYRKRREITVEGRDVPKPIKSFRDTGFPEY  109



>ref|XP_002618773.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38109.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
Length=419

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  349  NISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEA  528
             ++ P+ D  +L +FEKNFY+E P V A ++ EVA +R   ++TVEG DIPKPI  F EA
Sbjct  50   ELTTPEWDLDSLPKFEKNFYTEHPDVAARSDAEVAAFRKEHDMTVEGQDIPKPITSFEEA  109

Query  529  NFPAY  543
             FP Y
Sbjct  110  GFPDY  114



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ES +V +MTE EV  YR  RE+TVEG DIPKP++ F +  FP Y
Sbjct  51   KLDLDGLTPFEKNFYVESQAVASMTEAEVEEYRKLREITVEGRDIPKPVKSFRDVGFPDY  110



>gb|AAI35356.1| LOC549535 protein [Xenopus (Silurana) tropicalis]
Length=420

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L +FEKNFY+E P V  MT+H+V   R ++E+T+ G + PKPI  FH+ANFP Y
Sbjct  33   RWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQY  92



>gb|AAH54236.1| LOC398649 protein, partial [Xenopus laevis]
Length=415

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L +FEKNFY+E P V  MT+H+V   R ++E+T+ G + PKP+  FH+ANFP Y
Sbjct  33   RWDLNELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPLYAFHQANFPQY  92



>ref|XP_005166300.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Danio rerio]
Length=411

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   K D   L +FEKNFY+E+P V  M++++V  YR +RE+TV G+  PKP+  FH+
Sbjct  40   DRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQ  99

Query  526  ANFPAY  543
            A FP Y
Sbjct  100  AQFPQY  105



>ref|XP_001923830.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Danio rerio]
Length=671

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   K D   L +FEKNFY+E+P V  M++++V  YR +RE+TV G+  PKP+  FH+
Sbjct  40   DRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQ  99

Query  526  ANFPAY  543
            A FP Y
Sbjct  100  AQFPQY  105



>gb|AAI34864.1| LOC556764 protein [Danio rerio]
Length=519

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   K D   L +FEKNFY+E+P V  M++++V  YR +RE+TV G+  PKP+  FH+
Sbjct  40   DRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTSFHQ  99

Query  526  ANFPAY  543
            A FP Y
Sbjct  100  AQFPQY  105



>ref|NP_001016781.1| DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Xenopus (Silurana) tropicalis]
Length=609

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L +FEKNFY+E P V  MT+H+V   R ++E+T+ G + PKPI  FH+ANFP Y
Sbjct  33   RWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQY  92



>gb|KJB56889.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=424

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP V AM++ EV  YR RRE+TVEG D+PKP+  F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYIESPLVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDY  109



>ref|NP_001082679.1| DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Xenopus laevis]
 gb|AAH80992.1| LOC398649 protein [Xenopus laevis]
Length=610

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            + D   L +FEKNFY+E P V  MT+H+V   R ++E+T+ G + PKP+  FH+ANFP Y
Sbjct  33   RWDLNELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPLYAFHQANFPQY  92



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            DLD ++LP+ DF NL +FEK FY E P+V   T  EV  YR  +++ V G  +PKP++ F
Sbjct  52   DLDRMALPRPDFTNLPKFEKCFYLEHPAVSGRTPEEVEQYRREKQIHVYGDGVPKPVKTF  111

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  112  EEASFPEY  119



>gb|AAI17661.1| LOC556764 protein [Danio rerio]
Length=519

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   K D   L +FEKNFY+E+P V  M++++V  YR +RE+TV G+  PKP+  FH+
Sbjct  40   DRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQ  99

Query  526  ANFPAY  543
            A FP Y
Sbjct  100  AQFPQY  105



>gb|AAI54494.1| LOC556764 protein [Danio rerio]
Length=519

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   K D   L +FEKNFY+E+P V  M++++V  YR +RE+TV G+  PKP+  FH+
Sbjct  40   DRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQ  99

Query  526  ANFPAY  543
            A FP Y
Sbjct  100  AQFPQY  105



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP V AM++ EV  YR RRE+TVEG D+PKP+  F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYIESPLVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDY  109



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L  FEKNFY ESP V AM++ EV  YR RRE+TVEG D+PKP+  F +  FP Y
Sbjct  50   KLDLDGLTPFEKNFYIESPLVAAMSDAEVEDYRRRREITVEGRDVPKPVNSFRDIGFPDY  109



>ref|XP_008228304.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Prunus mume]
Length=424

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  SLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANF  534
            SL   D   L  FEKNFY ESP V  M+E EV  YR R E+T+EG D+PKPI+ F    F
Sbjct  46   SLRTFDLDGLTPFEKNFYVESPEVERMSEKEVEQYRQRTEITIEGRDVPKPIKSFRHTGF  105

Query  535  PAY  543
            P Y
Sbjct  106  PEY  108



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  355  SLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANF  534
            SL   D   L  FEKNFY ESP V  M+E EV  YR R E+T+EG D+PKPI+ F    F
Sbjct  46   SLRTFDLDGLTPFEKNFYVESPEVERMSEKEVEQYRQRTEITIEGRDVPKPIKSFRHTGF  105

Query  535  PAY  543
            P Y
Sbjct  106  PEY  108



>ref|XP_007216293.1| hypothetical protein PRUPE_ppa019394mg [Prunus persica]
 gb|EMJ17492.1| hypothetical protein PRUPE_ppa019394mg [Prunus persica]
Length=73

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESP-SVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPA  540
            K D   L  FEKNFY ESP  V  M+E EV  YR RRE+T+EG D+PKPI+ F++  FP 
Sbjct  8    KFDLDGLTPFEKNFYVESPVEVERMSEKEVEEYRQRREITIEGRDVPKPIKSFYDTGFPG  67



>ref|XP_008228055.1| PREDICTED: uncharacterized protein LOC103327496 [Prunus mume]
Length=219

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  355  SLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANF  534
            SL   D   L  FEKNFY ESP V  M+E EV  YR R E+T+EG D+PKPI+ F    F
Sbjct  33   SLRTFDLDGLTPFEKNFYVESPEVERMSEKEVEQYRQRTEITIEGRDVPKPIKSFRHTGF  92

Query  535  P  537
            P
Sbjct  93   P  93



>ref|XP_008029812.1| hypothetical protein SETTUDRAFT_156478 [Setosphaeria turcica 
Et28A]
 gb|EOA82807.1| hypothetical protein SETTUDRAFT_156478 [Setosphaeria turcica 
Et28A]
Length=1064

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D  +L +FEK+FY E P+V A +E EVA YR   ++TV+G DIPKP+  F EA FP+Y
Sbjct  608  DLDSLPKFEKSFYKEDPAVTARSEAEVAEYRKEHQMTVKGVDIPKPVTTFDEAGFPSY  665



>ref|XP_005994328.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Latimeria chalumnae]
Length=697

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L +FEKNFY E P V  ++++EV  +R ++E+T+ GT  PKP+ MFH+A+FP Y
Sbjct  48   KWDLNELPKFEKNFYVEHPEVARLSQYEVDEFRRKKEITIRGTGYPKPVMMFHQASFPQY  107



>ref|XP_005994327.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Latimeria chalumnae]
Length=699

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L +FEKNFY E P V  ++++EV  +R ++E+T+ GT  PKP+ MFH+A+FP Y
Sbjct  48   KWDLNELPKFEKNFYVEHPEVARLSQYEVDEFRRKKEITIRGTGYPKPVMMFHQASFPQY  107



>ref|XP_008924609.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Manacus 
vitellinus]
Length=758

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T+ EV  YRA +EVTV G + PKPI  F+E
Sbjct  189  EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTQQEVEQYRASKEVTVRGHNCPKPIINFYE  248

Query  526  ANFPA  540
            ANFPA
Sbjct  249  ANFPA  253



>gb|KFW74934.1| putative ATP-dependent RNA helicase DDX5, partial [Manacus vitellinus]
Length=593

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T+ EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTQQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_003964460.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Takifugu 
rubripes]
Length=634

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            D +   + D   L +FEKNFYSE P V  M++ E+  YR ++E+T+ G+  PKPI  FH+
Sbjct  39   DRLRKKRWDLDELPKFEKNFYSEHPEVQRMSQSELEDYRRKKEITIRGSGCPKPIIKFHQ  98

Query  526  ANFPAY  543
            A+FP Y
Sbjct  99   AHFPQY  104



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            +   L RFEKNFY E PSV  MT  EV  YR RRE+TV+G D+PKP+  F +  FP Y
Sbjct  46   ELDGLPRFEKNFYVEVPSVAGMTADEVEAYRRRREITVDGHDVPKPVCDFRDVGFPEY  103



>ref|XP_002955411.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
 gb|EFJ43482.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
Length=535

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMF  519
            +LDN++LPK DF NL +FEK FY E P+V + +  +V  +R  +++ V G  +PKP+  F
Sbjct  56   ELDNMALPKPDFSNLPKFEKCFYLEHPAVGSRSSEQVEAFRRSKQIHVYGDGVPKPVTSF  115

Query  520  HEANFPAY  543
             EA+FP Y
Sbjct  116  EEASFPEY  123



>gb|KFV15852.1| putative ATP-dependent RNA helicase DDX5, partial [Pterocles 
gutturalis]
Length=588

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V   T+ EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVARRTQQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_010082418.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Pterocles gutturalis]
Length=603

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V   T+ EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVARRTQQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_005526732.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX5 [Pseudopodoces humilis]
Length=608

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  39   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  98

Query  526  ANFPA  540
            ANFPA
Sbjct  99   ANFPA  103



>ref|XP_005056207.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX5 [Ficedula albicollis]
Length=608

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  39   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  98

Query  526  ANFPA  540
            ANFPA
Sbjct  99   ANFPA  103



>ref|XP_004177017.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX5 [Taeniopygia guttata]
 ref|XP_009092584.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX5 [Serinus canaria]
Length=608

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  39   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  98

Query  526  ANFPA  540
            ANFPA
Sbjct  99   ANFPA  103



>dbj|BAP72968.1| ATP-dependent RNA helicase DBP2 [Kluyveromyces marxianus]
Length=436

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  QDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            ++  NL  FEKNFY E P V  M++ EVA +R   E+T+ G D+PKPIR F EA FP+Y
Sbjct  66   EELPNLPVFEKNFYQEHPDVTKMSDAEVAQFRKENEMTITGHDVPKPIRTFDEAGFPSY  124



>ref|XP_005490530.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Zonotrichia 
albicollis]
Length=795

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  226  EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  285

Query  526  ANFPA  540
            ANFPA
Sbjct  286  ANFPA  290



>ref|XP_008946713.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Merops nubicus]
 gb|KFQ17074.1| putative ATP-dependent RNA helicase DDX5, partial [Merops nubicus]
Length=592

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_009900998.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Picoides 
pubescens]
Length=760

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  191  EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVKQYRASKEVTVRGHNCPKPIINFYE  250

Query  526  ANFPA  540
            ANFPA
Sbjct  251  ANFPA  255



>ref|XP_005425834.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Geospiza 
fortis]
Length=607

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  38   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  97

Query  526  ANFPA  540
            ANFPA
Sbjct  98   ANFPA  102



>gb|KFO62141.1| putative ATP-dependent RNA helicase DDX5, partial [Corvus brachyrhynchos]
Length=593

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>dbj|BAO41526.1| ATP-dependent RNA helicase DBP2 [Kluyveromyces marxianus DMKU3-1042]
Length=544

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  QDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            ++  NL  FEKNFY E P V  M++ EVA +R   E+T+ G D+PKPIR F EA FP+Y
Sbjct  66   EELPNLPVFEKNFYQEHPDVTKMSDAEVAQFRKENEMTITGHDVPKPIRTFDEAGFPSY  124



>ref|XP_008635819.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Corvus brachyrhynchos]
Length=641

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  72   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  131

Query  526  ANFPA  540
            ANFPA
Sbjct  132  ANFPA  136



>emb|CDO96429.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=550

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  QDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            ++  NL  FEKNFY E P V  M+E EV  +R   E+T+ G D+PKPIR F EA FP+Y
Sbjct  65   EELPNLPVFEKNFYQEHPDVAQMSESEVVQFRKENEMTISGHDVPKPIRSFDEAGFPSY  123



>gb|KFV69016.1| putative ATP-dependent RNA helicase DDX5, partial [Picoides pubescens]
Length=593

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVKQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_005146198.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase 
DDX5 [Melopsittacus undulatus]
Length=607

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  39   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  98

Query  526  ANFPA  540
            ANFPA
Sbjct  99   ANFPA  103



>gb|KFQ45816.1| putative ATP-dependent RNA helicase DDX5, partial [Nestor notabilis]
Length=592

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>gb|KFP01441.1| putative ATP-dependent RNA helicase DDX5, partial [Calypte anna]
Length=591

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_010001089.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Chaetura 
pelagica]
Length=598

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  30   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  89

Query  526  ANFPA  540
            ANFPA
Sbjct  90   ANFPA  94



>gb|KFQ83777.1| putative ATP-dependent RNA helicase DDX5, partial [Phoenicopterus 
ruber ruber]
Length=592

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_010142923.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Buceros rhinoceros silvestris]
 gb|KFO83059.1| putative ATP-dependent RNA helicase DDX5, partial [Buceros rhinoceros 
silvestris]
 gb|KFZ57276.1| putative ATP-dependent RNA helicase DDX5, partial [Podiceps cristatus]
Length=592

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_010007531.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Nestor notabilis]
Length=597

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  29   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  88

Query  526  ANFPA  540
            ANFPA
Sbjct  89   ANFPA  93



>ref|XP_009067616.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Acanthisitta chloris]
 gb|KFP74863.1| putative ATP-dependent RNA helicase DDX5, partial [Acanthisitta 
chloris]
Length=593

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>gb|KFU93470.1| putative ATP-dependent RNA helicase DDX5, partial [Chaetura pelagica]
Length=592

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_008492881.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Calypte 
anna]
Length=644

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  77   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  136

Query  526  ANFPA  540
            ANFPA
Sbjct  137  ANFPA  141



>gb|EMP40180.1| Putative ATP-dependent RNA helicase DDX5 [Chelonia mydas]
Length=580

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV+G + PKP+  F+E
Sbjct  33   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVKGHNCPKPLINFYE  92

Query  526  ANFPA  540
            ANFPA
Sbjct  93   ANFPA  97



>ref|XP_001798683.1| hypothetical protein SNOG_08367 [Phaeosphaeria nodorum SN15]
 gb|EAT84643.2| hypothetical protein SNOG_08367 [Phaeosphaeria nodorum SN15]
Length=668

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D  ++ +FEK+FY E P+V A T  EV  YR   ++TV+GT+IPKP+  F EA FP+Y
Sbjct  315  DLDSMPKFEKSFYKEDPAVTARTPEEVDAYRKEHQMTVQGTNIPKPVTTFDEAGFPSY  372



>emb|CDQ93346.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=272

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  KQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            K D   L +FEKNFY+E P +  MT++++  +R R+E+TV GT  P+ I  FH+A FP Y
Sbjct  32   KWDLDELPKFEKNFYNEHPELQRMTQYDIDEFRRRKEITVRGTGCPRAITGFHQAQFPQY  91



>gb|KGL79977.1| putative ATP-dependent RNA helicase DDX5, partial [Tinamus guttatus]
Length=313

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YR+ +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRSSKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_007055161.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X2 
[Chelonia mydas]
Length=596

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV+G + PKP+  F+E
Sbjct  27   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVKGHNCPKPLINFYE  86

Query  526  ANFPA  540
            ANFPA
Sbjct  87   ANFPA  91



>ref|XP_009503052.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Phalacrocorax carbo]
 gb|KFW91041.1| putative ATP-dependent RNA helicase DDX5, partial [Phalacrocorax 
carbo]
Length=592

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V   T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVARRTAQEVEQYRASKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|XP_007055160.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X1 
[Chelonia mydas]
Length=602

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YRA +EVTV+G + PKP+  F+E
Sbjct  33   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRASKEVTVKGHNCPKPLINFYE  92

Query  526  ANFPA  540
            ANFPA
Sbjct  93   ANFPA  97



>gb|EDK39933.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=450

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            ++ P+ D  +L +FEKNFYSE P V A +E EV  +R   ++   GTDIPKPI  F EA 
Sbjct  72   LTTPEWDLDSLPKFEKNFYSEHPDVSARSESEVQSFRKEHDMKCVGTDIPKPITSFDEAG  131

Query  532  FPAY  543
            FP Y
Sbjct  132  FPDY  135



>ref|XP_010216886.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Tinamus 
guttatus]
Length=373

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YR+ +EVTV G + PKPI  F+E
Sbjct  84   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTVQEVEQYRSSKEVTVRGHNCPKPIINFYE  143

Query  526  ANFPA  540
            ANFPA
Sbjct  144  ANFPA  148



>ref|XP_001483302.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=450

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            ++ P+ D  +L +FEKNFYSE P V A +E EV  +R   ++   GTDIPKPI  F EA 
Sbjct  72   LTTPEWDLDSLPKFEKNFYSEHPDVSARSESEVQSFRKEHDMKCVGTDIPKPITSFDEAG  131

Query  532  FPAY  543
            FP Y
Sbjct  132  FPDY  135



>gb|KIW08158.1| ATP-dependent RNA helicase DBP2 [Verruconis gallopava]
Length=534

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L +FEK+FY E P+V A +E EVA +R   ++TV G D+PKP+  F EA FPAY
Sbjct  68   DLSQLPKFEKSFYKEDPAVAARSEEEVAKFRRENQITVSGRDVPKPVTTFDEAGFPAY  125



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  379  NLVRFEKNFYSESPSVMAMTEHEVALYRARREVTV-EGTDIPKPIRMFHEANFPAY  543
             L +FEKNFY E+P+V +MTE EV  YR ++ +TV +G ++PKPIR F EA FP Y
Sbjct  156  QLTKFEKNFYVEAPTVASMTEAEVEEYRKQQHITVLQGRNVPKPIRTFEEAQFPDY  211



>gb|EMD89203.1| hypothetical protein COCHEDRAFT_1141168 [Bipolaris maydis C5]
Length=539

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L +FEK+FY E P+V A +E EVA YR   ++TV+GT+IPKP+  F EA FP+Y
Sbjct  70   DLDALPKFEKSFYKEDPAVTARSEAEVAEYRKEHQMTVKGTNIPKPVTTFDEAGFPSY  127



>ref|XP_010124485.1| PREDICTED: probable ATP-dependent RNA helicase DDX5, partial 
[Chlamydotis macqueenii]
 gb|KFP44730.1| putative ATP-dependent RNA helicase DDX5, partial [Chlamydotis 
macqueenii]
Length=592

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YR+ +EVTV G + PKPI  F+E
Sbjct  24   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRSSKEVTVRGHNCPKPIINFYE  83

Query  526  ANFPA  540
            ANFPA
Sbjct  84   ANFPA  88



>ref|NP_990158.1| probable ATP-dependent RNA helicase DDX5 [Gallus gallus]
 gb|AAD40318.1|AF158370_1 DEAD-box RNA helicase [Gallus gallus]
Length=595

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YR+ +EVTV G + PKPI  F+E
Sbjct  27   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRSSKEVTVRGHNCPKPIINFYE  86

Query  526  ANFPA  540
            ANFPA
Sbjct  87   ANFPA  91



>ref|XP_456137.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|Q6CIV2.1|DBP2_KLULA RecName: Full=ATP-dependent RNA helicase DBP2 [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAG98845.1| KLLA0F23716p [Kluyveromyces lactis]
Length=554

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  QDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            ++  NL  FEKNFY E P V  M+E EV  +R   E+T+ G D+PKPIR F EA FP+Y
Sbjct  65   EELPNLPVFEKNFYQEHPDVAQMSESEVIEFRKENEMTISGHDVPKPIRSFDEAGFPSY  123



>sp|A5DL80.3|DBP2_PICGU RecName: Full=ATP-dependent RNA helicase DBP2 [Meyerozyma guilliermondii 
ATCC 6260]
Length=554

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            ++ P+ D  +L +FEKNFYSE P V A +E EV  +R   ++   GTDIPKPI  F EA 
Sbjct  72   LTTPEWDLDSLPKFEKNFYSEHPDVSARSESEVQSFRKEHDMKCVGTDIPKPITSFDEAG  131

Query  532  FPAY  543
            FP Y
Sbjct  132  FPDY  135



>ref|XP_003866103.1| Dbp2 protein [Candida orthopsilosis Co 90-125]
 emb|CCG20663.1| Dbp2 protein [Candida orthopsilosis Co 90-125]
Length=562

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  352  ISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEAN  531
            +S+P+ D   L +FEKNFY+E P+V A ++ ++  +R + E++V+G DIP PI  F EA 
Sbjct  72   LSVPQWDIEQLPKFEKNFYTEHPNVAARSDADIEAFRNKNEMSVQGHDIPHPITTFDEAG  131

Query  532  FPAY  543
            FP Y
Sbjct  132  FPDY  135



>ref|XP_010719980.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Meleagris 
gallopavo]
Length=628

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V+  T  EV  YR+ +EVTV G + PKPI  F+E
Sbjct  60   EKLTKKKWNLDELPKFEKNFYQEHPDVVRRTAQEVEQYRSSKEVTVRGHNCPKPIINFYE  119

Query  526  ANFPA  540
            ANFPA
Sbjct  120  ANFPA  124



>ref|XP_009562292.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Cuculus 
canorus]
Length=647

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHE  525
            + ++  K +   L +FEKNFY E P V   T  EV  YRA +EVTV G + PKPI  F+E
Sbjct  90   EKLTKKKWNLDELPKFEKNFYQEHPDVARRTVQEVEQYRASKEVTVRGHNCPKPIINFYE  149

Query  526  ANFPA  540
            ANFPA
Sbjct  150  ANFPA  154



>gb|KIW08159.1| ATP-dependent RNA helicase DBP2, variant [Verruconis gallopava]
Length=512

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  DFGNLVRFEKNFYSESPSVMAMTEHEVALYRARREVTVEGTDIPKPIRMFHEANFPAY  543
            D   L +FEK+FY E P+V A +E EVA +R   ++TV G D+PKP+  F EA FPAY
Sbjct  68   DLSQLPKFEKSFYKEDPAVAARSEEEVAKFRRENQITVSGRDVPKPVTTFDEAGFPAY  125



Lambda      K        H        a         alpha
   0.317    0.136    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490