BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019C04

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352682.1|  PREDICTED: galacturonosyltransferase 8-like      73.6    1e-12   Solanum tuberosum [potatoes]
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8           62.4    7e-09   Nicotiana sylvestris
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like      59.3    7e-08   Citrus sinensis [apfelsine]
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                 58.9    1e-07   Citrus sinensis [apfelsine]
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8           58.5    2e-07   Nicotiana tomentosiformis
gb|KDO65983.1|  hypothetical protein CISIN_1g008561mg                 57.8    2e-07   Citrus sinensis [apfelsine]
ref|XP_006443554.1|  hypothetical protein CICLE_v10020276mg           57.4    2e-07   
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like      55.1    2e-06   Solanum lycopersicum
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg           50.4    7e-05   Prunus persica
ref|XP_002532733.1|  Glycosyltransferase QUASIMODO1, putative         48.9    3e-04   Ricinus communis
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8           47.8    6e-04   Prunus mume [ume]



>ref|XP_006352682.1| PREDICTED: galacturonosyltransferase 8-like [Solanum tuberosum]
Length=557

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  143  RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALK  310
            R  F LF S LT+AVFL L LS  YTSS+DP+DL VGI  D  GVG +RRSVLALK
Sbjct  15   RLTFNLFVSFLTVAVFLLLALSSLYTSSADPSDLGVGITRDFRGVGSLRRSVLALK  70



>ref|XP_009775386.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana sylvestris]
Length=566

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 6/78 (8%)
 Frame = +2

Query  83   SYRSA-TDRTSGGLFGRSAAG-RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGI  256
            SYR+  +DR+       S  G R  FKLFAS LT++VFL L LS  +TSSSDP+DL+VG 
Sbjct  6    SYRTPFSDRS----IAVSGTGIRLTFKLFASFLTVSVFLLLALSFLFTSSSDPSDLSVGN  61

Query  257  LHDAYGVGPVRRSVLALK  310
             HD Y  G +RRSVLALK
Sbjct  62   SHDLYRGGSLRRSVLALK  79



>ref|XP_006479231.1| PREDICTED: galacturonosyltransferase 8-like [Citrus sinensis]
Length=561

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  95   ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  265
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTARA--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSHSHSRDLYSSGLNSG  59

Query  266  AYGVGPVRRSVLALK  310
             YG+G +RRSVLALK
Sbjct  60   TYGLGSMRRSVLALK  74



>gb|KDO65982.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=561

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  95   ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  265
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTART--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSRSHSRDLYSSGLNSG  59

Query  266  AYGVGPVRRSVLALK  310
             YG+G +RRSVLALK
Sbjct  60   TYGLGSMRRSVLALK  74



>ref|XP_009614844.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana tomentosiformis]
Length=564

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = +2

Query  83   SYRSA-TDRTSGGLFGRSAAG-RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGI  256
            SYR+  +DR+       S  G R  FKLFAS L++AVFL L LS  +TSSSDP+DL+VG 
Sbjct  6    SYRTPFSDRS----IAVSGTGIRLTFKLFASFLSVAVFLLLALSFLFTSSSDPSDLSVGN  61

Query  257  LHDAYGVGPVRRSVLALK  310
             HD Y  G +RRSVLALK
Sbjct  62   SHDLYR-GGLRRSVLALK  78



>gb|KDO65983.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=481

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  95   ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  265
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTART--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSRSHSRDLYSSGLNSG  59

Query  266  AYGVGPVRRSVLALK  310
             YG+G +RRSVLALK
Sbjct  60   TYGLGSMRRSVLALK  74



>ref|XP_006443554.1| hypothetical protein CICLE_v10020276mg [Citrus clementina]
 gb|ESR56794.1| hypothetical protein CICLE_v10020276mg [Citrus clementina]
Length=424

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = +2

Query  95   ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  265
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTARA--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSHSHSRDLYSSGLNSG  59

Query  266  AYGVGPVRRSVLALK  310
             YG+G +RRSVLALK
Sbjct  60   TYGLGSMRRSVLALK  74



>ref|XP_004242412.1| PREDICTED: galacturonosyltransferase 8-like [Solanum lycopersicum]
Length=557

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  143  RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALK  310
            RF FKLFAS +T+AV L L LS  YTSS+DP+DL VGI  D   VG +RRSVLALK
Sbjct  15   RFTFKLFASFITVAVLLSLALSSLYTSSADPSDLGVGISRDFRVVGSLRRSVLALK  70



>ref|XP_007201169.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
 gb|EMJ02368.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
Length=562

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  TSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAYGVGP  283
            + GG    S A    F++ A  + +AV  F++LS  +TS +D +DL ++G    +YG+G 
Sbjct  10   SRGGAMRSSTAS---FRVLAMTIAVAVVFFISLSFVFTSQTDTSDLTDLGFNSGSYGLGS  66

Query  284  VRRSVLALK  310
             RR+VLALK
Sbjct  67   TRRTVLALK  75



>ref|XP_002532733.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF29635.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=566

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = +2

Query  152  FKLFASVLTIAVFLFLTLSLRYTSSS-DPADL--NVGILHDAYGVGPVRRSVLALK  310
            F++  S +TIAV +F T++  +TS S  P+DL  N G+ +  YG G  RRSVLALK
Sbjct  24   FRVLGSAITIAVLVFFTVAFLFTSDSHSPSDLHRNFGLGNVPYGFGSGRRSVLALK  79



>ref|XP_008235436.1| PREDICTED: galacturonosyltransferase 8 [Prunus mume]
Length=562

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = +2

Query  107  TSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAYGVGP  283
            + GG    S A    F + A  + +AV  F++LS   TS +D +DL ++G    +YG+G 
Sbjct  10   SRGGAMRSSTAS---FSVLAMTIAVAVVFFISLSFVITSQTDTSDLTDLGFNSGSYGLGS  66

Query  284  VRRSVLALK  310
             RR+VLALK
Sbjct  67   TRRTVLALK  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558850726180