BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019C03

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFH68055.1|  seven transmembrane calmodulin binding protein          160   3e-44   Capsicum annuum
ref|XP_009782288.1|  PREDICTED: MLO-like protein 6 isoform X3           155   3e-43   Nicotiana sylvestris
ref|XP_009782286.1|  PREDICTED: MLO-like protein 6 isoform X1           157   3e-43   Nicotiana sylvestris
gb|AIT98397.1|  MLO1                                                    157   4e-43   Solanum melongena [aubergine]
ref|XP_009595994.1|  PREDICTED: MLO-like protein 6 isoform X2           154   9e-43   
ref|XP_009782287.1|  PREDICTED: MLO-like protein 2 isoform X2           154   1e-42   Nicotiana sylvestris
ref|XP_009595993.1|  PREDICTED: MLO-like protein 6 isoform X1           154   5e-42   Nicotiana tomentosiformis
gb|AIT98396.1|  MLO1                                                    149   5e-40   Nicotiana tabacum [American tobacco]
ref|XP_010534417.1|  PREDICTED: MLO-like protein 12                     145   8e-39   Tarenaya hassleriana [spider flower]
ref|XP_006356488.1|  PREDICTED: MLO-like protein 6-like                 144   3e-38   Solanum tuberosum [potatoes]
ref|XP_004515994.1|  PREDICTED: MLO-like protein 2-like                 144   4e-38   Cicer arietinum [garbanzo]
ref|XP_004235223.1|  PREDICTED: MLO-like protein 2 isoform X1           143   5e-38   Solanum lycopersicum
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     143   6e-38   Sesamum indicum [beniseed]
ref|XP_010505587.1|  PREDICTED: MLO-like protein 12 isoform X2          142   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006293900.1|  hypothetical protein CARUB_v10022893mg             142   2e-37   Capsella rubella
ref|XP_010505586.1|  PREDICTED: MLO-like protein 12 isoform X1          142   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009133342.1|  PREDICTED: MLO-like protein 12 isoform X1          140   5e-37   Brassica rapa
ref|XP_006340147.1|  PREDICTED: MLO-like protein 6-like                 140   6e-37   Solanum tuberosum [potatoes]
ref|XP_006343449.1|  PREDICTED: MLO-like protein 6-like                 140   8e-37   Solanum tuberosum [potatoes]
ref|XP_010558749.1|  PREDICTED: MLO-like protein 6                      139   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_010509062.1|  PREDICTED: MLO-like protein 12                     139   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008233336.1|  PREDICTED: MLO-like protein 6                      139   2e-36   Prunus mume [ume]
ref|XP_004240581.1|  PREDICTED: MLO-like protein 6                      139   2e-36   Solanum lycopersicum
gb|AGV68801.1|  MLO4                                                    139   2e-36   Prunus armeniaca
ref|XP_010412940.1|  PREDICTED: MLO-like protein 12                     139   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006411145.1|  hypothetical protein EUTSA_v10016436mg             139   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_011040971.1|  PREDICTED: MLO-like protein 6                      139   3e-36   Populus euphratica
gb|EYU41618.1|  hypothetical protein MIMGU_mgv1a0045331mg               130   3e-36   Erythranthe guttata [common monkey flower]
gb|ADV40949.1|  MLO1                                                    138   3e-36   Medicago truncatula
emb|CBI31482.3|  unnamed protein product                                137   7e-36   Vitis vinifera
emb|CDO99726.1|  unnamed protein product                                137   7e-36   Coffea canephora [robusta coffee]
ref|XP_009603532.1|  PREDICTED: MLO-like protein 6                      137   7e-36   Nicotiana tomentosiformis
gb|KFK36813.1|  hypothetical protein AALP_AA4G174800                    137   7e-36   Arabis alpina [alpine rockcress]
ref|XP_002315295.2|  hypothetical protein POPTR_0010s22730g             137   8e-36   
ref|XP_009596416.1|  PREDICTED: MLO-like protein 6                      137   1e-35   Nicotiana tomentosiformis
gb|KEH25655.1|  seven transmembrane MLO family protein                  135   1e-35   Medicago truncatula
gb|EPS57163.1|  hypothetical protein M569_17658                         132   2e-35   Genlisea aurea
ref|XP_002881634.1|  hypothetical protein ARALYDRAFT_903160             136   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009133345.1|  PREDICTED: MLO-like protein 12                     136   2e-35   Brassica rapa
ref|XP_009801961.1|  PREDICTED: MLO-like protein 6                      136   3e-35   Nicotiana sylvestris
ref|XP_010658319.1|  PREDICTED: MLO7 protein isoform X1                 134   3e-35   
ref|XP_010313404.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    135   3e-35   
ref|XP_009777573.1|  PREDICTED: MLO-like protein 6                      136   3e-35   Nicotiana sylvestris
ref|XP_010547373.1|  PREDICTED: MLO-like protein 6                      135   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_010319698.1|  PREDICTED: MLO1 protein isoform X2                 133   6e-35   
ref|XP_010319697.1|  PREDICTED: MLO1 protein isoform X1                 133   7e-35   Solanum lycopersicum
ref|XP_002312021.2|  MLO-like protein 12                                134   9e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009133347.1|  PREDICTED: MLO-like protein 12                     134   1e-34   Brassica rapa
ref|XP_011031756.1|  PREDICTED: MLO-like protein 6                      134   1e-34   Populus euphratica
gb|AAX31277.1|  MLO1                                                    134   1e-34   Capsicum annuum
ref|XP_010905121.1|  PREDICTED: MLO-like protein 6                      134   1e-34   Elaeis guineensis
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                134   1e-34   Erythranthe guttata [common monkey flower]
ref|NP_001268008.1|  MLO7 protein                                       134   1e-34   Vitis vinifera
emb|CDP07138.1|  unnamed protein product                                134   1e-34   Coffea canephora [robusta coffee]
ref|XP_010253610.1|  PREDICTED: MLO-like protein 6 isoform X1           134   1e-34   Nelumbo nucifera [Indian lotus]
emb|CDX97946.1|  BnaA06g06970D                                          134   1e-34   
ref|XP_009148458.1|  PREDICTED: MLO-like protein 2                      134   2e-34   Brassica rapa
ref|XP_009141792.1|  PREDICTED: MLO-like protein 12                     134   2e-34   Brassica rapa
emb|CDY19353.1|  BnaC05g08620D                                          133   2e-34   Brassica napus [oilseed rape]
ref|XP_010253612.1|  PREDICTED: MLO-like protein 6 isoform X2           131   2e-34   
ref|XP_007204981.1|  hypothetical protein PRUPE_ppa003207mg             133   2e-34   Prunus persica
gb|ACO07297.1|  MLO1                                                    133   3e-34   Pisum sativum [garden pea]
ref|XP_006417368.1|  hypothetical protein EUTSA_v10007208mg             133   3e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006606236.1|  PREDICTED: MLO-like protein 12-like isoform X2     131   3e-34   
ref|NP_565902.1|  protein MILDEW RESISTANCE LOCUS O 12                  133   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089887.1|  PREDICTED: MLO-like protein 6                      133   4e-34   Sesamum indicum [beniseed]
gb|KDO48444.1|  hypothetical protein CISIN_1g008391mg                   131   5e-34   Citrus sinensis [apfelsine]
ref|XP_006485875.1|  PREDICTED: MLO-like protein 12-like                131   5e-34   
gb|AIT98395.1|  MLO1                                                    131   9e-34   Solanum tuberosum [potatoes]
gb|EYU25264.1|  hypothetical protein MIMGU_mgv1a024934mg                125   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_008796805.1|  PREDICTED: MLO-like protein 6                      131   1e-33   
ref|XP_003555433.1|  PREDICTED: MLO-like protein 12-like isoform X1     131   2e-33   Glycine max [soybeans]
ref|XP_007151752.1|  hypothetical protein PHAVU_004G071700g             131   2e-33   Phaseolus vulgaris [French bean]
gb|KHN00832.1|  MLO-like protein 6                                      130   2e-33   Glycine soja [wild soybean]
gb|KDO48443.1|  hypothetical protein CISIN_1g008391mg                   130   2e-33   Citrus sinensis [apfelsine]
gb|AGV68799.1|  MLO1                                                    130   2e-33   Prunus armeniaca
ref|XP_008796803.1|  PREDICTED: MLO-like protein 6                      130   3e-33   
emb|CDP06724.1|  unnamed protein product                                130   4e-33   Coffea canephora [robusta coffee]
gb|KFK35674.1|  hypothetical protein AALP_AA4G022500                    130   5e-33   Arabis alpina [alpine rockcress]
ref|XP_006307103.1|  hypothetical protein CARUB_v10008691mg             130   5e-33   Capsella rubella
ref|XP_007027290.1|  Seven transmembrane MLO family protein             129   5e-33   
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      129   5e-33   Glycine max [soybeans]
ref|NP_001288934.1|  MLO-like protein 2                                 129   5e-33   Brassica rapa
gb|KHN05728.1|  MLO-like protein 6                                      129   6e-33   Glycine soja [wild soybean]
ref|NP_176350.1|  MLO-like protein 6                                    129   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225371.1|  PREDICTED: MLO-like protein 6                      129   6e-33   Prunus mume [ume]
ref|XP_010473362.1|  PREDICTED: MLO-like protein 6 isoform X1           129   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002886534.1|  hypothetical protein ARALYDRAFT_315221             129   8e-33   
ref|XP_010104115.1|  MLO-like protein 6                                 129   8e-33   Morus notabilis
ref|XP_010418123.1|  PREDICTED: MLO-like protein 6                      129   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006592218.1|  PREDICTED: MLO-like protein 6-like isoform X2      128   9e-33   
ref|XP_010492667.1|  PREDICTED: MLO-like protein 2                      129   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006302048.1|  hypothetical protein CARUB_v10020030mg             129   1e-32   Capsella rubella
ref|XP_010430162.1|  PREDICTED: MLO-like protein 6 isoform X1           129   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010430163.1|  PREDICTED: MLO-like protein 6 isoform X2           129   1e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001234814.1|  MLO1 protein                                       128   1e-32   Solanum lycopersicum
ref|XP_010458517.1|  PREDICTED: MLO-like protein 2                      128   2e-32   Camelina sativa [gold-of-pleasure]
gb|KJB09233.1|  hypothetical protein B456_001G130800                    128   2e-32   Gossypium raimondii
ref|XP_010473363.1|  PREDICTED: MLO-like protein 6 isoform X2           127   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004148785.1|  PREDICTED: MLO-like protein 6-like                 128   2e-32   Cucumis sativus [cucumbers]
ref|XP_010476039.1|  PREDICTED: MLO-like protein 2 isoform X1           127   3e-32   Camelina sativa [gold-of-pleasure]
gb|KDO73205.1|  hypothetical protein CISIN_1g023637mg                   122   4e-32   Citrus sinensis [apfelsine]
emb|CAN64133.1|  hypothetical protein VITISV_032771                     127   5e-32   Vitis vinifera
ref|XP_008463775.1|  PREDICTED: MLO-like protein 6                      127   5e-32   Cucumis melo [Oriental melon]
gb|EYU45068.1|  hypothetical protein MIMGU_mgv1a009898mg                124   5e-32   Erythranthe guttata [common monkey flower]
emb|CDY07075.1|  BnaA04g22400D                                          127   6e-32   
ref|XP_002862890.1|  predicted protein                                  121   6e-32   
ref|NP_001117268.1|  MLO-like protein 2                                 125   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172598.1|  MLO-like protein 2                                    126   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548912.1|  PREDICTED: MLO-like protein 12-like isoform X1     126   9e-32   Glycine max [soybeans]
gb|AAX77015.1|  MLO1                                                    126   9e-32   Lotus japonicus
gb|KDO73204.1|  hypothetical protein CISIN_1g023637mg                   122   1e-31   Citrus sinensis [apfelsine]
gb|KDO73203.1|  hypothetical protein CISIN_1g023637mg                   122   1e-31   Citrus sinensis [apfelsine]
ref|XP_007151753.1|  hypothetical protein PHAVU_004G071800g             125   1e-31   Phaseolus vulgaris [French bean]
gb|KJB09234.1|  hypothetical protein B456_001G130800                    125   1e-31   Gossypium raimondii
gb|KHN13369.1|  MLO-like protein 12                                     126   1e-31   Glycine soja [wild soybean]
ref|XP_006391995.1|  hypothetical protein EUTSA_v10023372mg             125   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_008361435.1|  PREDICTED: MLO-like protein 2                      121   2e-31   
gb|KDO73202.1|  hypothetical protein CISIN_1g023637mg                   122   2e-31   Citrus sinensis [apfelsine]
ref|XP_010043721.1|  PREDICTED: MLO-like protein 6 isoform X2           124   2e-31   
gb|KDO73201.1|  hypothetical protein CISIN_1g023637mg                   122   2e-31   Citrus sinensis [apfelsine]
ref|XP_002892636.1|  hypothetical protein ARALYDRAFT_471266             125   2e-31   
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          125   2e-31   Amborella trichopoda
gb|AFM35696.1|  Mlo                                                     125   2e-31   Vitis pseudoreticulata
emb|CBI31481.3|  unnamed protein product                                125   2e-31   Vitis vinifera
ref|XP_010043720.1|  PREDICTED: MLO-like protein 6 isoform X1           125   3e-31   Eucalyptus grandis [rose gum]
gb|AFW98801.1|  MLO protein 1                                           125   3e-31   Rosa multiflora [Japanese rose]
ref|XP_009104728.1|  PREDICTED: MLO-like protein 6                      125   3e-31   Brassica rapa
emb|CDY47582.1|  BnaA01g22680D                                          124   3e-31   Brassica napus [oilseed rape]
ref|XP_004309423.1|  PREDICTED: MLO-like protein 6                      124   4e-31   Fragaria vesca subsp. vesca
ref|XP_002533246.1|  Protein MLO, putative                              124   4e-31   Ricinus communis
ref|XP_006599405.1|  PREDICTED: MLO-like protein 12-like isoform X2     123   4e-31   
emb|CDY03836.1|  BnaC01g29530D                                          123   5e-31   
ref|NP_001268013.1|  MLO11 protein                                      124   6e-31   Vitis vinifera
ref|XP_010264736.1|  PREDICTED: MLO-like protein 6 isoform X2           122   7e-31   
ref|NP_001268005.1|  MLO6 protein                                       123   8e-31   Vitis vinifera
ref|XP_009110727.1|  PREDICTED: MLO-like protein 2                      123   8e-31   Brassica rapa
ref|XP_008366359.1|  PREDICTED: MLO-like protein 2                      119   9e-31   
ref|XP_010264735.1|  PREDICTED: MLO-like protein 6 isoform X1           123   1e-30   Nelumbo nucifera [Indian lotus]
emb|CDY20991.1|  BnaA08g25340D                                          123   1e-30   Brassica napus [oilseed rape]
ref|XP_006424615.1|  hypothetical protein CICLE_v10028092mg             123   1e-30   Citrus clementina [clementine]
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      123   1e-30   
ref|XP_007150220.1|  hypothetical protein PHAVU_005G136700g             122   1e-30   Phaseolus vulgaris [French bean]
ref|XP_006488133.1|  PREDICTED: MLO-like protein 6-like isoform X2      122   1e-30   
ref|XP_010476040.1|  PREDICTED: MLO-like protein 2 isoform X2           123   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_003539406.1|  PREDICTED: MLO-like protein 6-like                 122   2e-30   Glycine max [soybeans]
emb|CDY14402.1|  BnaC03g21930D                                          122   3e-30   Brassica napus [oilseed rape]
gb|KHN25050.1|  MLO-like protein 6                                      121   3e-30   Glycine soja [wild soybean]
ref|XP_007150219.1|  hypothetical protein PHAVU_005G136700g             122   3e-30   Phaseolus vulgaris [French bean]
ref|XP_008338448.1|  PREDICTED: MLO-like protein 6                      122   3e-30   
ref|XP_010099633.1|  MLO-like protein 12                                115   4e-30   
emb|CDY12904.1|  BnaA09g13700D                                          121   5e-30   Brassica napus [oilseed rape]
emb|CDY15021.1|  BnaCnng04240D                                          121   7e-30   Brassica napus [oilseed rape]
emb|CDY26348.1|  BnaA03g60240D                                          121   7e-30   Brassica napus [oilseed rape]
ref|XP_002526372.1|  Protein MLO, putative                              121   8e-30   Ricinus communis
ref|XP_009113127.1|  PREDICTED: MLO-like protein 6                      121   8e-30   Brassica rapa
ref|XP_003539407.1|  PREDICTED: MLO-like protein 6-like                 121   9e-30   Glycine max [soybeans]
gb|KHN25048.1|  MLO-like protein 6                                      121   9e-30   Glycine soja [wild soybean]
ref|XP_009124631.1|  PREDICTED: MLO-like protein 6                      121   9e-30   Brassica rapa
ref|XP_009335054.1|  PREDICTED: MLO-like protein 6                      120   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_007218951.1|  hypothetical protein PRUPE_ppa003466mg             120   2e-29   Prunus persica
ref|XP_009347038.1|  PREDICTED: MLO-like protein 6                      120   2e-29   Pyrus x bretschneideri [bai li]
emb|CDY57371.1|  BnaCnng31840D                                          119   2e-29   Brassica napus [oilseed rape]
ref|XP_002314276.1|  hypothetical protein POPTR_0009s01710g             120   2e-29   
ref|XP_004304413.1|  PREDICTED: MLO-like protein 6                      119   3e-29   Fragaria vesca subsp. vesca
ref|XP_011013684.1|  PREDICTED: MLO-like protein 12                     118   4e-29   Populus euphratica
ref|XP_010476041.1|  PREDICTED: MLO-like protein 2 isoform X3           119   5e-29   
ref|XP_002322867.1|  hypothetical protein POPTR_0016s08940g             117   6e-29   
ref|XP_002522497.1|  Protein MLO, putative                              117   8e-29   
ref|XP_007150221.1|  hypothetical protein PHAVU_005G136800g             118   9e-29   Phaseolus vulgaris [French bean]
ref|XP_009615189.1|  PREDICTED: MLO-like protein 1 isoform X2           117   9e-29   Nicotiana tomentosiformis
ref|XP_010476042.1|  PREDICTED: MLO-like protein 2 isoform X4           117   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    118   9e-29   
ref|XP_009615188.1|  PREDICTED: MLO-like protein 1 isoform X1           117   9e-29   Nicotiana tomentosiformis
gb|KDP25722.1|  hypothetical protein JCGZ_23943                         117   1e-28   Jatropha curcas
ref|XP_007009792.1|  Seven transmembrane MLO family protein             117   2e-28   
gb|KFK40693.1|  hypothetical protein AALP_AA2G029100                    117   2e-28   Arabis alpina [alpine rockcress]
ref|XP_010032207.1|  PREDICTED: MLO-like protein 2 isoform X1           117   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010032208.1|  PREDICTED: MLO-like protein 2 isoform X2           117   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010046751.1|  PREDICTED: MLO-like protein 6                      117   2e-28   Eucalyptus grandis [rose gum]
ref|XP_011044384.1|  PREDICTED: MLO-like protein 6 isoform X1           117   2e-28   Populus euphratica
ref|XP_008463924.1|  PREDICTED: MLO-like protein 6 isoform X1           117   2e-28   Cucumis melo [Oriental melon]
ref|XP_010492678.1|  PREDICTED: MLO-like protein 2                      117   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004149543.1|  PREDICTED: MLO-like protein 6-like                 115   3e-28   
ref|XP_004163384.1|  PREDICTED: MLO-like protein 6-like                 117   3e-28   
gb|KGN47314.1|  hypothetical protein Csa_6G292430                       117   3e-28   Cucumis sativus [cucumbers]
ref|XP_008463927.1|  PREDICTED: MLO-like protein 6 isoform X2           115   3e-28   
ref|XP_010032020.1|  PREDICTED: MLO-like protein 6                      117   3e-28   Eucalyptus grandis [rose gum]
ref|XP_007211843.1|  hypothetical protein PRUPE_ppa004687mg             115   3e-28   Prunus persica
ref|XP_011044385.1|  PREDICTED: MLO-like protein 6 isoform X2           117   4e-28   Populus euphratica
gb|KCW88826.1|  hypothetical protein EUGRSUZ_A01164                     116   4e-28   Eucalyptus grandis [rose gum]
ref|XP_008467033.1|  PREDICTED: MLO-like protein 1                      111   5e-28   
ref|XP_008225160.1|  PREDICTED: MLO-like protein 12                     115   5e-28   Prunus mume [ume]
ref|XP_007216411.1|  hypothetical protein PRUPE_ppa022716mg             111   6e-28   
gb|KJB73619.1|  hypothetical protein B456_011G240700                    115   7e-28   Gossypium raimondii
emb|CAN60901.1|  hypothetical protein VITISV_029546                     114   7e-28   Vitis vinifera
gb|KDO49757.1|  hypothetical protein CISIN_1g0113631mg                  109   7e-28   Citrus sinensis [apfelsine]
ref|XP_009333712.1|  PREDICTED: MLO-like protein 6                      115   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      115   1e-27   Phoenix dactylifera
ref|XP_006377424.1|  hypothetical protein POPTR_0011s05790g             114   1e-27   
ref|XP_011004622.1|  PREDICTED: MLO-like protein 6                      114   1e-27   Populus euphratica
gb|KJB74724.1|  hypothetical protein B456_012G004100                    115   1e-27   Gossypium raimondii
gb|KCW44918.1|  hypothetical protein EUGRSUZ_L01503                     108   2e-27   Eucalyptus grandis [rose gum]
gb|EPS67078.1|  hypothetical protein M569_07698                         112   2e-27   Genlisea aurea
gb|EYU22368.1|  hypothetical protein MIMGU_mgv1a0228201mg               108   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_007018107.1|  Seven transmembrane MLO family protein             114   2e-27   
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      114   3e-27   Vitis vinifera
ref|XP_006307459.1|  hypothetical protein CARUB_v10009086mg             112   3e-27   
ref|XP_009342698.1|  PREDICTED: MLO-like protein 6 isoform X2           114   3e-27   Pyrus x bretschneideri [bai li]
emb|CBI16290.3|  unnamed protein product                                114   4e-27   Vitis vinifera
ref|XP_010033601.1|  PREDICTED: MLO-like protein 8                      113   4e-27   Eucalyptus grandis [rose gum]
ref|XP_009342695.1|  PREDICTED: MLO-like protein 6 isoform X1           113   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_009757992.1|  PREDICTED: MLO-like protein 1                      112   6e-27   Nicotiana sylvestris
ref|NP_001284458.1|  MLO-like protein 12                                113   6e-27   Cucumis melo [Oriental melon]
gb|KJB67707.1|  hypothetical protein B456_010G205000                    113   7e-27   Gossypium raimondii
ref|XP_002533335.1|  Protein MLO, putative                              112   7e-27   
ref|XP_008243901.1|  PREDICTED: MLO-like protein 6                      113   7e-27   Prunus mume [ume]
gb|AGV68800.1|  MLO3                                                    113   7e-27   Prunus armeniaca
gb|KHN17123.1|  MLO-like protein 6                                      112   8e-27   Glycine soja [wild soybean]
ref|XP_008798739.1|  PREDICTED: MLO-like protein 13                     112   8e-27   Phoenix dactylifera
ref|XP_009378090.1|  PREDICTED: MLO-like protein 6                      112   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_004142393.1|  PREDICTED: MLO-like protein 6-like                 112   1e-26   Cucumis sativus [cucumbers]
gb|KCW56485.1|  hypothetical protein EUGRSUZ_I02212                     112   1e-26   Eucalyptus grandis [rose gum]
ref|XP_010029568.1|  PREDICTED: MLO-like protein 10                     112   1e-26   Eucalyptus grandis [rose gum]
ref|XP_007208289.1|  hypothetical protein PRUPE_ppa003437mg             112   1e-26   Prunus persica
ref|XP_008387612.1|  PREDICTED: MLO-like protein 6 isoform X2           110   1e-26   
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      112   1e-26   
ref|XP_010111165.1|  MLO-like protein 6                                 112   1e-26   
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 112   1e-26   Cucumis sativus [cucumbers]
ref|XP_008369779.1|  PREDICTED: MLO-like protein 6 isoform X2           112   1e-26   Malus domestica [apple tree]
ref|XP_006375949.1|  hypothetical protein POPTR_0013s06670g             107   1e-26   
ref|XP_008369778.1|  PREDICTED: MLO-like protein 6 isoform X1           112   2e-26   Malus domestica [apple tree]
ref|XP_003548913.1|  PREDICTED: MLO-like protein 12-like                112   2e-26   Glycine max [soybeans]
gb|KHN13370.1|  MLO-like protein 12                                     112   2e-26   Glycine soja [wild soybean]
ref|XP_002310696.2|  hypothetical protein POPTR_0007s08570g             111   2e-26   
ref|XP_010917470.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    112   2e-26   
ref|XP_011027760.1|  PREDICTED: MLO-like protein 12                     110   2e-26   Populus euphratica
gb|EMT06541.1|  MLO protein-1-like protein                              112   2e-26   
ref|XP_008385934.1|  PREDICTED: MLO-like protein 3                      105   2e-26   
ref|XP_008448445.1|  PREDICTED: MLO-like protein 10 isoform X1          111   2e-26   Cucumis melo [Oriental melon]
ref|XP_006351085.1|  PREDICTED: MLO-like protein 1-like                 110   2e-26   Solanum tuberosum [potatoes]
tpg|DAA43122.1|  TPA: hypothetical protein ZEAMMB73_618430              108   3e-26   
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 111   3e-26   Glycine max [soybeans]
gb|KJB34883.1|  hypothetical protein B456_006G088500                    110   3e-26   Gossypium raimondii
gb|AFW98803.1|  MLO protein 3                                           111   3e-26   Rosa multiflora [Japanese rose]
gb|KJB34882.1|  hypothetical protein B456_006G088500                    110   3e-26   Gossypium raimondii
gb|KHN08481.1|  MLO-like protein 6                                      110   3e-26   Glycine soja [wild soybean]
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      111   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287195.1|  PREDICTED: MLO-like protein 15                     110   3e-26   Fragaria vesca subsp. vesca
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      111   3e-26   Nicotiana sylvestris
ref|XP_009358149.1|  PREDICTED: MLO-like protein 6                      111   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_010905123.1|  PREDICTED: MLO-like protein 6                      111   4e-26   Elaeis guineensis
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                110   5e-26   Erythranthe guttata [common monkey flower]
gb|ACU17362.1|  unknown                                                 104   6e-26   Glycine max [soybeans]
ref|XP_007046462.1|  Seven transmembrane MLO family protein             110   6e-26   Theobroma cacao [chocolate]
ref|NP_001105660.1|  barley mlo defense gene homolog1                   110   7e-26   Zea mays [maize]
gb|KJB55486.1|  hypothetical protein B456_009G078600                    110   7e-26   Gossypium raimondii
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     110   7e-26   Nicotiana sylvestris
ref|XP_011048573.1|  PREDICTED: MLO-like protein 3 isoform X2           108   7e-26   Populus euphratica
ref|XP_006381474.1|  hypothetical protein POPTR_0006s13170g             110   7e-26   Populus trichocarpa [western balsam poplar]
emb|CDP06355.1|  unnamed protein product                                110   8e-26   Coffea canephora [robusta coffee]
ref|XP_010040939.1|  PREDICTED: MLO-like protein 1                      108   8e-26   Eucalyptus grandis [rose gum]
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              110   8e-26   
ref|XP_007025524.1|  Seven transmembrane MLO family protein             109   8e-26   
ref|XP_011048572.1|  PREDICTED: MLO-like protein 3 isoform X1           108   8e-26   Populus euphratica
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              110   9e-26   Prunus mume [ume]
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      110   9e-26   
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             110   9e-26   Prunus persica
ref|XP_002305106.2|  hypothetical protein POPTR_0004s04960g             108   1e-25   
gb|KHN20094.1|  MLO protein like 1                                      109   1e-25   Glycine soja [wild soybean]
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              109   1e-25   Glycine max [soybeans]
ref|XP_011469670.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    109   1e-25   Fragaria vesca subsp. vesca
ref|XP_006364311.1|  PREDICTED: MLO-like protein 12-like                108   1e-25   Solanum tuberosum [potatoes]
gb|EYU36622.1|  hypothetical protein MIMGU_mgv1a005184mg                108   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_010253607.1|  PREDICTED: MLO-like protein 3                      109   1e-25   
ref|XP_004157520.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    109   1e-25   
ref|XP_010277858.1|  PREDICTED: MLO-like protein 1                      108   1e-25   Nelumbo nucifera [Indian lotus]
gb|EYU22992.1|  hypothetical protein MIMGU_mgv1a0064621mg               103   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_003519926.1|  PREDICTED: MLO-like protein 12-like                109   1e-25   Glycine max [soybeans]
ref|XP_011001234.1|  PREDICTED: MLO-like protein 12                     108   2e-25   
gb|KHN00604.1|  MLO-like protein 12                                     109   2e-25   
ref|XP_009347227.1|  PREDICTED: MLO-like protein 8                      105   2e-25   
ref|XP_010057357.1|  PREDICTED: MLO-like protein 6                      108   2e-25   
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      108   2e-25   
ref|XP_008786739.1|  PREDICTED: MLO protein homolog 1                   108   2e-25   
gb|KGN46257.1|  hypothetical protein Csa_6G078520                       108   2e-25   
ref|NP_001284374.1|  MLO-like protein 1                                 108   2e-25   
gb|EYU29404.1|  hypothetical protein MIMGU_mgv1a004805mg                108   2e-25   
ref|XP_004145008.1|  PREDICTED: MLO-like protein 1-like                 108   2e-25   
ref|XP_010107563.1|  MLO-like protein 3                                 108   2e-25   
gb|KHG22053.1|  MLO-like protein 8                                      108   2e-25   
ref|XP_008460095.1|  PREDICTED: MLO-like protein 1                      108   2e-25   
gb|ABY77906.1|  mildew resistance locus o 15                            108   2e-25   
ref|XP_010264740.1|  PREDICTED: MLO-like protein 3                      108   2e-25   
ref|XP_010052699.1|  PREDICTED: MLO-like protein 1                      108   2e-25   
ref|XP_009601752.1|  PREDICTED: MLO-like protein 8                      108   2e-25   
ref|XP_009385958.1|  PREDICTED: MLO-like protein 6                      108   3e-25   
ref|XP_010693799.1|  PREDICTED: uncharacterized protein LOC104906705    109   3e-25   
ref|XP_006437325.1|  hypothetical protein CICLE_v10031281mg             106   3e-25   
ref|XP_010672534.1|  PREDICTED: MLO-like protein 15                     108   3e-25   
ref|XP_011087587.1|  PREDICTED: MLO-like protein 13                     107   3e-25   
ref|XP_006579025.1|  PREDICTED: MLO protein homolog 1-like              106   4e-25   
ref|XP_006478537.1|  PREDICTED: MLO-like protein 1-like                 107   4e-25   
ref|XP_010065098.1|  PREDICTED: MLO-like protein 1                      107   4e-25   
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      107   4e-25   
ref|XP_004512433.1|  PREDICTED: MLO-like protein 10-like                108   4e-25   
ref|XP_010040798.1|  PREDICTED: MLO-like protein 1                      107   4e-25   
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      107   5e-25   
ref|XP_003558907.1|  PREDICTED: protein MLO-like                        107   5e-25   
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      107   6e-25   
ref|XP_006425252.1|  hypothetical protein CICLE_v10025242mg             107   7e-25   
ref|XP_008383677.1|  PREDICTED: MLO-like protein 12                     107   7e-25   
ref|NP_001267997.1|  mildew resistance locus o 15                       107   7e-25   
gb|KDO49431.1|  hypothetical protein CISIN_1g0104501mg                  105   8e-25   
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      107   8e-25   
gb|KHN33781.1|  MLO protein like 1                                      107   8e-25   
ref|XP_006467107.1|  PREDICTED: MLO-like protein 10-like                107   9e-25   
gb|EPS58576.1|  hypothetical protein M569_16238                         100   1e-24   
ref|XP_004985865.1|  PREDICTED: MLO protein homolog 1-like              107   1e-24   
ref|XP_010930330.1|  PREDICTED: MLO-like protein 1                      106   1e-24   
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   107   1e-24   
ref|XP_011011036.1|  PREDICTED: MLO-like protein 1 isoform X1           106   1e-24   
ref|XP_004244787.1|  PREDICTED: MLO-like protein 1                      106   1e-24   
ref|XP_003537693.1|  PREDICTED: MLO-like protein 8-like                 107   1e-24   
gb|KDO49428.1|  hypothetical protein CISIN_1g0104501mg                  105   1e-24   
gb|KDO49430.1|  hypothetical protein CISIN_1g0104501mg                  105   1e-24   
ref|XP_011011038.1|  PREDICTED: MLO-like protein 1 isoform X2           106   1e-24   
ref|XP_006836488.1|  hypothetical protein AMTR_s00108p00111960          106   1e-24   
ref|XP_003612408.1|  Mlo family protein                                 106   1e-24   
ref|XP_002310695.2|  MLO-like protein 8                                 106   1e-24   
gb|KHG26183.1|  MLO-like protein 12                                     105   2e-24   
ref|XP_010906858.1|  PREDICTED: MLO-like protein 10                     105   2e-24   
ref|XP_011074078.1|  PREDICTED: MLO protein homolog 1-like              106   2e-24   
gb|AES95366.2|  seven transmembrane MLO family protein                  106   2e-24   
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      106   2e-24   
ref|XP_009390757.1|  PREDICTED: MLO-like protein 9 isoform X2           106   2e-24   
ref|XP_006377427.1|  hypothetical protein POPTR_0011s05820g             105   2e-24   
ref|XP_009352843.1|  PREDICTED: MLO-like protein 6                      105   2e-24   
ref|XP_002519555.1|  calmodulin binding protein, putative               105   2e-24   
ref|XP_006437326.1|  hypothetical protein CICLE_v10031281mg             105   2e-24   
ref|XP_007135967.1|  hypothetical protein PHAVU_009G006800g             105   2e-24   
ref|XP_008369123.1|  PREDICTED: MLO-like protein 1                      105   3e-24   
gb|KJB10416.1|  hypothetical protein B456_001G200000                    104   3e-24   
ref|XP_006358492.1|  PREDICTED: MLO-like protein 13-like                105   3e-24   
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              105   3e-24   
gb|EYU28022.1|  hypothetical protein MIMGU_mgv1a019894mg                105   3e-24   
gb|KCW44764.1|  hypothetical protein EUGRSUZ_L01672                     103   3e-24   
ref|XP_001752870.1|  predicted protein                                  104   3e-24   
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      105   3e-24   
gb|AAK60567.1|AF384145_1  MLo1 protein                                  105   4e-24   
ref|XP_008345263.1|  PREDICTED: MLO-like protein 1                      105   4e-24   
gb|ABK96389.1|  unknown                                                 105   5e-24   
ref|XP_007143692.1|  hypothetical protein PHAVU_007G093600g             105   5e-24   
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      105   5e-24   
ref|XP_010245561.1|  PREDICTED: MLO-like protein 12                     104   5e-24   
ref|XP_004171250.1|  PREDICTED: MLO-like protein 12-like              99.0    5e-24   
gb|KHN35943.1|  MLO-like protein 8                                      105   5e-24   
ref|XP_002275360.2|  PREDICTED: MLO-like protein 3                      104   6e-24   
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       105   6e-24   
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          105   6e-24   
emb|CDY50221.1|  BnaC08g14830D                                          101   6e-24   
gb|KJB10414.1|  hypothetical protein B456_001G200000                    105   7e-24   
gb|ACU13145.1|  unknown                                                 100   7e-24   
gb|EYU33241.1|  hypothetical protein MIMGU_mgv1a017858mg                103   8e-24   
ref|XP_008379649.1|  PREDICTED: MLO-like protein 8                      104   8e-24   
ref|XP_004293900.1|  PREDICTED: MLO-like protein 12 isoform X1          104   8e-24   
ref|XP_004304412.1|  PREDICTED: MLO-like protein 3                      104   9e-24   
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      104   9e-24   
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      104   9e-24   
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           104   9e-24   
sp|O49873.1|MLOH1_HORVU  RecName: Full=MLO protein homolog 1            104   9e-24   
ref|XP_010034715.1|  PREDICTED: MLO-like protein 8                      104   1e-23   
gb|AFW98804.1|  MLO protein 4                                           104   1e-23   
ref|XP_001781175.1|  predicted protein                                  102   1e-23   
gb|KDP36763.1|  hypothetical protein JCGZ_08054                         103   1e-23   
ref|XP_010528781.1|  PREDICTED: MLO-like protein 1                      103   1e-23   
ref|XP_003597192.1|  MLO-like protein                                   103   2e-23   
ref|XP_011085087.1|  PREDICTED: MLO-like protein 1 isoform X3           103   2e-23   
ref|XP_011085086.1|  PREDICTED: MLO-like protein 1 isoform X2           103   2e-23   
ref|XP_007020280.1|  Seven transmembrane MLO family protein             103   2e-23   
ref|XP_007158026.1|  hypothetical protein PHAVU_002G117900g             103   2e-23   
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      103   2e-23   
ref|XP_001763298.1|  predicted protein                                  102   2e-23   
emb|CAN71968.1|  hypothetical protein VITISV_007362                     101   2e-23   
ref|XP_011460878.1|  PREDICTED: MLO-like protein 1 isoform X2           102   2e-23   
gb|EYU39427.1|  hypothetical protein MIMGU_mgv1a007858mg                101   2e-23   
emb|CDP17759.1|  unnamed protein product                                101   2e-23   
ref|XP_002523965.1|  calmodulin binding protein, putative               102   2e-23   
gb|AHF52923.1|  Mlo protein                                             103   2e-23   
ref|XP_011085085.1|  PREDICTED: MLO-like protein 15 isoform X1          103   2e-23   
ref|XP_010097666.1|  MLO-like protein 1                                 102   2e-23   
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 103   3e-23   
gb|KHG27081.1|  MLO-like protein 3                                      102   3e-23   
ref|XP_004294225.1|  PREDICTED: MLO-like protein 15 isoform X1          102   3e-23   
ref|XP_004231310.1|  PREDICTED: MLO-like protein 13                     102   3e-23   
ref|XP_002309708.1|  hypothetical protein POPTR_0007s00240g             102   3e-23   
ref|XP_008243092.1|  PREDICTED: MLO-like protein 1                      102   3e-23   
gb|AHF52924.1|  Mlo protein                                             103   3e-23   
ref|XP_007203635.1|  hypothetical protein PRUPE_ppa004012mg             102   3e-23   
ref|XP_009137855.1|  PREDICTED: MLO-like protein 13                     102   3e-23   
ref|XP_006857534.1|  hypothetical protein AMTR_s00061p00034560          102   3e-23   
gb|KJB55487.1|  hypothetical protein B456_009G078700                    102   3e-23   
emb|CDY34270.1|  BnaA01g13730D                                          102   3e-23   
ref|XP_006858689.1|  hypothetical protein AMTR_s00066p00091160          102   4e-23   
gb|AEC12478.1|  membrane protein                                        102   4e-23   
ref|XP_009621845.1|  PREDICTED: MLO-like protein 1                      102   4e-23   
ref|XP_007199791.1|  hypothetical protein PRUPE_ppa004508mg             102   4e-23   
gb|AFW98802.1|  MLO protein 2                                           102   4e-23   
emb|CDP07140.1|  unnamed protein product                                102   4e-23   
ref|XP_010270523.1|  PREDICTED: MLO-like protein 10 isoform X2          100   4e-23   
gb|AAS93630.1|  Mlo protein                                             100   4e-23   
ref|XP_009381676.1|  PREDICTED: MLO-like protein 2                      102   5e-23   
ref|XP_002532472.1|  calmodulin binding protein, putative               101   5e-23   
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         102   5e-23   
ref|XP_010694044.1|  PREDICTED: MLO-like protein 15 isoform X2          101   5e-23   
ref|XP_008349735.1|  PREDICTED: MLO protein homolog 1-like              102   5e-23   
ref|XP_010260354.1|  PREDICTED: MLO-like protein 12 isoform X3          100   5e-23   
ref|XP_010260352.1|  PREDICTED: MLO-like protein 12 isoform X2          100   5e-23   
ref|XP_008235036.1|  PREDICTED: MLO-like protein 1                      102   5e-23   
ref|XP_002510710.1|  Protein MLO, putative                              101   5e-23   
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 102   6e-23   
gb|KHN12501.1|  MLO-like protein 8                                      102   6e-23   
emb|CDO99471.1|  unnamed protein product                                100   6e-23   
ref|XP_004301623.1|  PREDICTED: MLO-like protein 5                      100   6e-23   
gb|EMT06538.1|  Protein MLO                                             102   6e-23   
ref|XP_010694043.1|  PREDICTED: MLO-like protein 1 isoform X1           100   6e-23   
ref|XP_006424617.1|  hypothetical protein CICLE_v10028153mg             102   6e-23   
gb|ACV31921.1|  Mlo protein                                             102   7e-23   
ref|XP_006396473.1|  hypothetical protein EUTSA_v10028582mg             101   7e-23   
gb|ACV31920.1|  Mlo protein                                             102   7e-23   
ref|XP_004287711.1|  PREDICTED: MLO-like protein 10                     102   7e-23   
gb|AAK94904.1|AF361932_1  seven transmembrane-spanning protein          101   7e-23   
ref|XP_004245231.1|  PREDICTED: MLO-like protein 9                      101   7e-23   
ref|XP_010039224.1|  PREDICTED: MLO-like protein 3                      102   8e-23   
ref|XP_010930336.1|  PREDICTED: MLO-like protein 1 isoform X5         99.8    8e-23   
ref|XP_010930335.1|  PREDICTED: MLO-like protein 1 isoform X4         99.8    8e-23   
ref|XP_002459619.1|  hypothetical protein SORBIDRAFT_02g007600        97.4    9e-23   
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              101   9e-23   
ref|XP_004290766.1|  PREDICTED: MLO-like protein 1                      101   9e-23   
ref|XP_010930332.1|  PREDICTED: MLO-like protein 1 isoform X2           100   9e-23   
ref|XP_007015440.1|  MLO, putative                                      101   9e-23   
gb|ADV29809.1|  MLO1 protein                                            101   9e-23   
ref|XP_003604072.1|  MLO-like protein                                 99.4    9e-23   
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     101   9e-23   
ref|XP_010260351.1|  PREDICTED: MLO-like protein 12 isoform X1          101   1e-22   
ref|XP_006344359.1|  PREDICTED: MLO-like protein 1-like                 100   1e-22   
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           101   1e-22   
ref|XP_010256542.1|  PREDICTED: MLO-like protein 9                      101   1e-22   
gb|ABR16800.1|  unknown                                                 100   1e-22   
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      100   1e-22   
emb|CBI40748.3|  unnamed protein product                                100   1e-22   
gb|KJB44399.1|  hypothetical protein B456_007G250700                    100   1e-22   
ref|XP_007027289.1|  Seven transmembrane MLO family protein, puta...    100   1e-22   
ref|XP_006467720.1|  PREDICTED: MLO-like protein 12-like                100   1e-22   
ref|XP_004487134.1|  PREDICTED: MLO-like protein 6-like                 101   1e-22   
ref|XP_008345266.1|  PREDICTED: MLO-like protein 1                    96.7    1e-22   
gb|KDP39614.1|  hypothetical protein JCGZ_02634                         100   1e-22   
ref|XP_008365656.1|  PREDICTED: MLO-like protein 6                      101   2e-22   
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             101   2e-22   
emb|CDP17762.1|  unnamed protein product                                100   2e-22   
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     100   2e-22   
ref|XP_002865092.1|  hypothetical protein ARALYDRAFT_497027             100   2e-22   
ref|XP_009369784.1|  PREDICTED: MLO-like protein 8                      100   2e-22   
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      100   2e-22   
ref|XP_010429895.1|  PREDICTED: MLO-like protein 1                      100   2e-22   
ref|XP_009603524.1|  PREDICTED: MLO-like protein 13                     100   2e-22   
ref|XP_010930331.1|  PREDICTED: MLO-like protein 1 isoform X1           100   2e-22   
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          100   2e-22   
ref|XP_010439065.1|  PREDICTED: MLO-like protein 13                     100   2e-22   
ref|XP_009137434.1|  PREDICTED: MLO-like protein 13                     100   2e-22   
ref|XP_010422570.1|  PREDICTED: MLO-like protein 1                      100   2e-22   
emb|CDY03468.1|  BnaC01g16140D                                        99.8    3e-22   
ref|XP_011005242.1|  PREDICTED: MLO-like protein 1                    99.8    3e-22   
emb|CDP19084.1|  unnamed protein product                                100   3e-22   
ref|XP_006283629.1|  hypothetical protein CARUB_v10004686mg           99.8    3e-22   
dbj|BAJ24153.1|  seven trans-membrane protein                         99.8    3e-22   
ref|XP_009770323.1|  PREDICTED: MLO-like protein 1                    99.8    3e-22   
ref|XP_007204311.1|  hypothetical protein PRUPE_ppa003435mg             100   3e-22   
ref|XP_008802190.1|  PREDICTED: MLO-like protein 1                    97.1    3e-22   
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             100   3e-22   
ref|XP_002510708.1|  Protein MLO, putative                              100   4e-22   
ref|XP_004509461.1|  PREDICTED: MLO-like protein 10-like                100   4e-22   
emb|CDX92627.1|  BnaC07g38850D                                        99.4    4e-22   
ref|XP_010038680.1|  PREDICTED: MLO-like protein 2                      100   4e-22   
ref|XP_007027288.1|  Seven transmembrane MLO family protein, puta...    100   4e-22   
ref|XP_007029886.1|  Seven transmembrane MLO family protein           99.8    4e-22   
gb|AAK60566.1|AF384144_1  MLo protein                                 99.8    4e-22   
ref|XP_010097644.1|  MLO-like protein 8                                 100   4e-22   
ref|XP_010679042.1|  PREDICTED: MLO-like protein 1                    99.4    4e-22   
gb|EMS47417.1|  Protein MLO                                           99.8    4e-22   
ref|XP_009392167.1|  PREDICTED: MLO-like protein 13 isoform X2        98.6    4e-22   
dbj|BAK08220.1|  predicted protein                                    99.0    4e-22   
ref|XP_009358231.1|  PREDICTED: MLO-like protein 3                      100   4e-22   
ref|XP_010530986.1|  PREDICTED: MLO-like protein 8                    99.8    5e-22   
ref|XP_010680632.1|  PREDICTED: MLO-like protein 10 isoform X2        99.8    5e-22   
ref|XP_006449419.1|  hypothetical protein CICLE_v10015069mg           99.0    5e-22   
ref|NP_001046197.1|  Os02g0197200                                     97.8    5e-22   
gb|KCW47275.1|  hypothetical protein EUGRSUZ_K01067                   99.8    5e-22   
ref|XP_007013887.1|  Seven transmembrane MLO family protein, puta...  98.6    5e-22   
ref|XP_008802140.1|  PREDICTED: MLO-like protein 1                    99.0    5e-22   



>gb|AFH68055.1| seven transmembrane calmodulin binding protein [Capsicum annuum]
Length=528

 Score =   160 bits (406),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 72/91 (79%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+AVVCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAVVCFILLAISIFIEQIMHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ QDPVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVIQDPVSNLCVPKSVGYSWHPC  92



>ref|XP_009782288.1| PREDICTED: MLO-like protein 6 isoform X3 [Nicotiana sylvestris]
Length=378

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+AVVCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAVVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVVQTPVSNLCVPKSVGYSWHPC  92



>ref|XP_009782286.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=532

 Score =   157 bits (398),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+AVVCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAVVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVVQTPVSNLCVPKSVGYSWHPC  92



>gb|AIT98397.1| MLO1 [Solanum melongena]
Length=523

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+ME TPTWA+AVVCFIL+AISI IEQ+ HHLG WLL KHKK LHEAL+KIKAELML
Sbjct  2    AKERSMEGTPTWAVAVVCFILLAISIFIEQIIHHLGEWLLEKHKKPLHEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ QDPVSNIC+P++VG SWHPC
Sbjct  62   LGFISLLLTVVQDPVSNICVPKTVGYSWHPC  92



>ref|XP_009595994.1| PREDICTED: MLO-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=378

 Score =   154 bits (389),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+A VCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAAVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVVQSPVSNLCVPKSVGYSWHPC  92



>ref|XP_009782287.1| PREDICTED: MLO-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+AVVCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAVVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVVQTPVSNLCVPKSVGYSWHPC  92



>ref|XP_009595993.1| PREDICTED: MLO-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=525

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWA+A VCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAVAAVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  62   LGFISLLLTVVQSPVSNLCVPKSVGYSWHPC  92



>gb|AIT98396.1| MLO1 [Nicotiana tabacum]
Length=519

 Score =   149 bits (375),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  33   MEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFIS  212
            MEATPTWA+A VCFIL+AISI IEQ+ HHLG WLL+KHKK L+EAL+KIKAELML+GFIS
Sbjct  1    MEATPTWAVAAVCFILLAISIFIEQIIHHLGEWLLKKHKKPLYEALEKIKAELMLLGFIS  60

Query  213  LLLTIFQDPVSNICIPESVGNSWHPC  290
            LLLT+ Q PVSN+C+P+SVG SWHPC
Sbjct  61   LLLTVVQSPVSNLCVPKSVGYSWHPC  86



>ref|XP_010534417.1| PREDICTED: MLO-like protein 12 [Tarenaya hassleriana]
Length=581

 Score =   145 bits (367),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+LV ISI IE   H +G W  RKHK+AL+EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLVLISILIEYFLHFVGHWFKRKHKRALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            MLMGFISLLLT+ Q P+SNICIP  V  +WHPC+
Sbjct  61   MLMGFISLLLTVLQSPISNICIPGDVAATWHPCN  94



>ref|XP_006356488.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=517

 Score =   144 bits (362),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 63/90 (70%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER ++ TPTWA+A+VCF+LV IS+ IEQL HHLG WL +K K+ L+EAL+KIK+ELML+G
Sbjct  12   ERPLDETPTWAVAMVCFVLVIISLFIEQLIHHLGEWLWKKQKRPLYEALEKIKSELMLLG  71

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            FISL LT+ QDPVS ICIP SVG SWHPCD
Sbjct  72   FISLFLTVVQDPVSKICIPRSVGRSWHPCD  101



>ref|XP_004515994.1| PREDICTED: MLO-like protein 2-like [Cicer arietinum]
Length=559

 Score =   144 bits (362),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+AISI IE + H +G WL +KHK  L+EAL+K+KAELML+G
Sbjct  7    ERTLEETPTWAVAVVCFVLLAISILIEHIIHVIGKWLKKKHKNGLYEALEKVKAELMLLG  66

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FISLLLT+FQDP+S ICI + VGN+WHPC
Sbjct  67   FISLLLTVFQDPISKICISQKVGNTWHPC  95



>ref|XP_004235223.1| PREDICTED: MLO-like protein 2 isoform X1 [Solanum lycopersicum]
Length=517

 Score =   143 bits (360),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER ++ TPTWA+A+VCF+LV IS+ IEQL HHLG WL +K K+ L+EAL+KIK+ELML+G
Sbjct  12   ERPLDETPTWAVAMVCFVLVVISLFIEQLIHHLGEWLWKKQKRPLYEALEKIKSELMLLG  71

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            FISL LT+ QDP+S ICIP SVG SWHPCD
Sbjct  72   FISLFLTVVQDPMSKICIPRSVGRSWHPCD  101



>ref|XP_011077127.1| PREDICTED: MLO-like protein 12 [Sesamum indicum]
Length=490

 Score =   143 bits (360),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MAGKER + ATPTWA+AV+ FIL+AISI IEQL HH+G WL +K K +L EALDKIKAEL
Sbjct  1    MAGKERPLVATPTWAVAVLFFILIAISILIEQLIHHIGSWLKKKRKPSLFEALDKIKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLLT+ QD ++ IC+P SVG+SWHPC
Sbjct  61   MLLGFISLLLTVTQDYIAEICVPRSVGHSWHPC  93



>ref|XP_010505587.1| PREDICTED: MLO-like protein 12 isoform X2 [Camelina sativa]
Length=576

 Score =   142 bits (357),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWAIAVVCF+L+ ISI IE   H +  W  +KHKKALHEAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + QDPVS ICIP++V  +WHPC
Sbjct  61   MLLGFISLLLVVLQDPVSQICIPKTVAKTWHPC  93



>ref|XP_006293900.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
 gb|EOA26798.1| hypothetical protein CARUB_v10022893mg [Capsella rubella]
Length=577

 Score =   142 bits (357),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KERT+E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL+EAL+K+KAEL
Sbjct  1    MAIKERTLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + QDPVS ICIP  V ++WHPC
Sbjct  61   MLLGFISLLLVVLQDPVSQICIPRKVASTWHPC  93



>ref|XP_010505586.1| PREDICTED: MLO-like protein 12 isoform X1 [Camelina sativa]
Length=576

 Score =   142 bits (357),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWAIAVVCF+L+ ISI IE   H +  W  +KHKKALHEAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + QDPVS ICIP++V  +WHPC
Sbjct  61   MLLGFISLLLVVLQDPVSQICIPKTVAKTWHPC  93



>ref|XP_009133342.1| PREDICTED: MLO-like protein 12 isoform X1 [Brassica rapa]
Length=602

 Score =   140 bits (354),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL+EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + Q PVS ICIPE +  +WHPC
Sbjct  61   MLLGFISLLLVVLQTPVSQICIPEKIAATWHPC  93



>ref|XP_006340147.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=587

 Score =   140 bits (354),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF+LVAISI IE + H +G WL  KHK+AL+EAL+KIKAELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFVLVAISIVIEFIIHLIGKWLKSKHKRALYEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ QDP+SNIC+ E + ++WHPC K
Sbjct  64   LLGFISLLLTVGQDPISNICVSEKIASTWHPCSK  97



>ref|XP_006343449.1| PREDICTED: MLO-like protein 6-like [Solanum tuberosum]
Length=589

 Score =   140 bits (353),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF+LVAISI IE + H +G WL  K+K AL+E+L+KIKAELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYESLEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNIC+ E +GNSWHPC K
Sbjct  64   LLGFISLLLTVGQSPISNICVSEKIGNSWHPCSK  97



>ref|XP_010558749.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=573

 Score =   139 bits (351),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI IE L H +G W  +KHKKAL+EAL+K+KAELMLM
Sbjct  6    KERTLEETSTWAVAVVCFVLLLISIIIEHLIHKIGAWFKKKHKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLTI Q P+S ICI ESV ++WHPC +
Sbjct  66   GFISLLLTIGQGPISGICISESVASTWHPCSR  97



>ref|XP_010509062.1| PREDICTED: MLO-like protein 12 [Camelina sativa]
Length=576

 Score =   139 bits (351),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWAIAVVCF+L+ ISI IE   H +  W  +KHKKAL+EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALNEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + QDPVS ICIP++V  +WHPC
Sbjct  61   MLLGFISLLLVVLQDPVSQICIPKTVAKTWHPC  93



>ref|XP_008233336.1| PREDICTED: MLO-like protein 6 [Prunus mume]
 ref|XP_008233339.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=571

 Score =   139 bits (350),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KER++E TPTWA+AVVCF+L+A+SI IE + H +G WL  KHK+AL EAL+KIK+ELML+
Sbjct  6    KERSLEETPTWAVAVVCFVLLAVSIFIEHIIHLIGKWLTSKHKRALVEALEKIKSELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ QD +S+ICIP+S+G+SW PC K
Sbjct  66   GFISLLLTVLQDYISDICIPKSIGDSWLPCSK  97



>ref|XP_004240581.1| PREDICTED: MLO-like protein 6 [Solanum lycopersicum]
Length=591

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+LVAISI IE + H +G WL  K+K AL+EAL+KIKAELML+GF
Sbjct  9    RSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKNKSALYEALEKIKAELMLLGF  68

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ISLLLT+ Q P+SNIC+ E +GNSWHPC K
Sbjct  69   ISLLLTVGQSPISNICVSEKLGNSWHPCSK  98



>gb|AGV68801.1| MLO4 [Prunus armeniaca]
Length=571

 Score =   139 bits (350),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KER++E TPTWA+AVVCF+L+A+SI IE + H +G WL  KHK+AL EAL+KIK+ELML+
Sbjct  6    KERSLEETPTWAVAVVCFVLLAVSIFIEHIIHLIGKWLTSKHKRALVEALEKIKSELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ QD +S+ICIP+S+G+SW PC K
Sbjct  66   GFISLLLTVLQDYISDICIPKSIGDSWLPCSK  97



>ref|XP_010412940.1| PREDICTED: MLO-like protein 12, partial [Camelina sativa]
Length=509

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWAIAVVCF+L+ ISI IE   H +  W  +KHKKALHEAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAIAVVCFVLLFISILIEYFLHFISHWFKKKHKKALHEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ML+GFISLLL + QDPVS ICIP++V  +WHPC 
Sbjct  61   MLLGFISLLLVVLQDPVSQICIPKTVAKTWHPCS  94



>ref|XP_006411145.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
 gb|ESQ52598.1| hypothetical protein EUTSA_v10016436mg [Eutrema salsugineum]
Length=576

 Score =   139 bits (349),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL+EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLL + Q PVS ICIP+ V  +WHPC +
Sbjct  61   MLLGFISLLLVVLQTPVSEICIPKRVAATWHPCSR  95



>ref|XP_011040971.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=581

 Score =   139 bits (349),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
            GK +++E TPTWA+AVVCF+LVAISI IE L H +  WL +KHK AL EAL+K+KAELML
Sbjct  5    GKAQSLEQTPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKTALVEALEKVKAELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            MGFISLLLTI Q P+S+ICIPE +  +WHPC K
Sbjct  65   MGFISLLLTILQGPISDICIPEDIAATWHPCSK  97



>gb|EYU41618.1| hypothetical protein MIMGU_mgv1a0045331mg, partial [Erythranthe 
guttata]
Length=132

 Score =   130 bits (328),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+LVA+S+ IE   H LG WL++ +KK L+EAL+K+K+ELML+GF
Sbjct  7    RSLEETPTWAVAVVCFVLVAVSVIIEYTIHLLGKWLVKNNKKDLYEALEKVKSELMLLGF  66

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q P+S IC+ + VGNSWHPC
Sbjct  67   ISLLLTVGQGPISEICVSKKVGNSWHPC  94



>gb|ADV40949.1| MLO1 [Medicago truncatula]
 gb|KEH25654.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=574

 Score =   138 bits (348),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+AISI IE + H +G W  +K+K AL+EAL+K+K ELMLMG
Sbjct  8    ERTLEETPTWAVAVVCFVLLAISIVIEHIIHAIGKWFKKKNKNALYEALEKVKGELMLMG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FISLLLT+FQD +S ICI E VG++WHPC
Sbjct  68   FISLLLTVFQDYISKICISEKVGSTWHPC  96



>emb|CBI31482.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   137 bits (345),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            +ER++E TPTWA+AVVCF+L+A+SI IE +FH +G WL  +H++AL+E+L+KIKAELML+
Sbjct  6    EERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSWLKGRHRRALYESLEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            G ISLLLTI QD +S ICI ESVG++WHPC K
Sbjct  66   GVISLLLTILQDYISKICISESVGSTWHPCKK  97



>emb|CDO99726.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  KE T++ TPTWA+AV+CFILVAISI +E L H L  WL +K K+ALH+AL+KIKA
Sbjct  1    MAGESKELTLQETPTWAVAVICFILVAISIMVEFLIHLLASWLKKKRKQALHDALEKIKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ QDP+S ICIP+S G SWHPC
Sbjct  61   ELMLLGFISLLLTVVQDPISKICIPKSAGRSWHPC  95



>ref|XP_009603532.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   137 bits (346),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            +G  R++E TPTWA+A VCF+LVAISI IE + H +G W   K K+AL EAL+KIKAELM
Sbjct  4    SGGGRSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKKKRALFEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNIC+ E +GNSWHPC K
Sbjct  64   LLGFISLLLTVGQSPISNICVSEKIGNSWHPCSK  97



>gb|KFK36813.1| hypothetical protein AALP_AA4G174800 [Arabis alpina]
Length=572

 Score =   137 bits (346),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +K+KKAL+EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKNKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLL + Q PVS ICIP SV  +WHPC +
Sbjct  61   MLLGFISLLLVVLQTPVSEICIPNSVAATWHPCSR  95



>ref|XP_002315295.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
 gb|EEF01466.2| hypothetical protein POPTR_0010s22730g [Populus trichocarpa]
Length=577

 Score =   137 bits (345),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
            GK +++E TPTWA+AVVCF+LVAISI IE L H +  WL +KHK AL EAL+K+KAELML
Sbjct  5    GKAQSLEQTPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKPALVEALEKVKAELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            MGFISLLLTI Q P+S+ICIP ++  +WHPC K
Sbjct  65   MGFISLLLTILQGPISDICIPGNIAATWHPCSK  97



>ref|XP_009596416.1| PREDICTED: MLO-like protein 6 [Nicotiana tomentosiformis]
Length=597

 Score =   137 bits (345),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF LVAISI IE + H +G WL  KHK AL+EAL+KIK+ELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFALVAISIVIEFIIHLIGKWLKSKHKNALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ QDP+SNIC+ E + ++WHPC K
Sbjct  64   LLGFISLLLTVGQDPISNICVSEKIASTWHPCSK  97



>gb|KEH25655.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=411

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+AISI IE + H +G W  +K+K AL+EAL+K+K ELMLMG
Sbjct  8    ERTLEETPTWAVAVVCFVLLAISIVIEHIIHAIGKWFKKKNKNALYEALEKVKGELMLMG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FISLLLT+FQD +S ICI E VG++WHPC
Sbjct  68   FISLLLTVFQDYISKICISEKVGSTWHPC  96



>gb|EPS57163.1| hypothetical protein M569_17658, partial [Genlisea aurea]
Length=270

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            +ERT+EAT TWA+ +VCFILVAIS+AIE+L HHLG  L RK K +L+EAL+KIKAELMLM
Sbjct  1    EERTLEATATWAVVLVCFILVAISLAIEKLIHHLGSCLRRKKKASLYEALEKIKAELMLM  60

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT+ + P+S IC+P +VG+SW PC
Sbjct  61   GFISLLLTVGESPLSRICVPRNVGHSWFPC  90



>ref|XP_002881634.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57893.1| hypothetical protein ARALYDRAFT_903160 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   136 bits (342),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALSEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + Q PVS ICIP ++  +WHPC
Sbjct  61   MLLGFISLLLVVLQTPVSQICIPRNIAATWHPC  93



>ref|XP_009133345.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=584

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA K+R++E TPTWA+AVVCF+++ ISI IE   H +G W  RKHKKAL+EAL+K+KAEL
Sbjct  1    MAIKDRSLEETPTWALAVVCFVILFISIMIEYFLHFIGHWFKRKHKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLL + Q PVS ICIPE +  +WHPC +
Sbjct  61   MLLGFISLLLVVLQSPVSQICIPERIAATWHPCSR  95



>ref|XP_009801961.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=597

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LVAISI IE + H +G W   K+K+AL EAL+KIKAELM
Sbjct  4    GGGGRSLEQTPTWAVAAVCFVLVAISIVIEHIIHLIGKWFKSKNKRALFEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNIC+ E +GNSWHPC K
Sbjct  64   LLGFISLLLTVGQSPISNICVSEKIGNSWHPCSK  97



>ref|XP_010658319.1| PREDICTED: MLO7 protein isoform X1 [Vitis vinifera]
Length=377

 Score =   134 bits (337),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            +ER++E TPTWA+AVVCF+L+A+SI IE +FH +G WL  +H++AL+E+L+KIKAELML+
Sbjct  6    EERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSWLKGRHRRALYESLEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            G ISLLLTI QD +S ICI ESVG++WHPC K
Sbjct  66   GVISLLLTILQDYISKICISESVGSTWHPCKK  97



>ref|XP_010313404.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Solanum lycopersicum]
Length=561

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A+VCF LVAISI IE + H +G WL  KHK+AL+EAL+KIKAELM
Sbjct  4    GGGGRSLEQTPTWAVALVCFALVAISIVIELIIHLIGKWLKSKHKRALYEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ QDP+SNIC+ E + ++WHPC K
Sbjct  64   LLGFISLLLTVGQDPISNICVSEKIASTWHPCSK  97



>ref|XP_009777573.1| PREDICTED: MLO-like protein 6 [Nicotiana sylvestris]
Length=608

 Score =   136 bits (342),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF LVAISI IE + H +G WL  KHK AL+EAL+KIK+ELML+GF
Sbjct  12   RSLEQTPTWAVAVVCFALVAISIVIEFIIHLIGKWLKSKHKNALYEALEKIKSELMLLGF  71

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ISLLLT+ QDP+SNIC+ E + ++WHPC K
Sbjct  72   ISLLLTVGQDPISNICVSEKIASTWHPCSK  101



>ref|XP_010547373.1| PREDICTED: MLO-like protein 6 [Tarenaya hassleriana]
Length=553

 Score =   135 bits (340),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI IE L H +G W  +KHKKAL+EAL+K+KAELMLM
Sbjct  6    KERTLEETSTWAVAVVCFVLLLISIVIEHLIHKIGSWFKKKHKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +S+ICI +SV ++WHPC
Sbjct  66   GFISLLLTITQGIISDICISQSVASTWHPC  95



>ref|XP_010319698.1| PREDICTED: MLO1 protein isoform X2 [Solanum lycopersicum]
Length=378

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWAIAVVCFIL+AISI IEQ+ HH+G WLL K KK+L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKSLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GF+SLLLT+ QDPVSN+C+P+SVG SWHPC
Sbjct  62   LGFLSLLLTVLQDPVSNLCVPKSVGYSWHPC  92



>ref|XP_010319697.1| PREDICTED: MLO1 protein isoform X1 [Solanum lycopersicum]
Length=410

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWAIAVVCFIL+AISI IEQ+ HH+G WLL K KK+L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKSLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GF+SLLLT+ QDPVSN+C+P+SVG SWHPC
Sbjct  62   LGFLSLLLTVLQDPVSNLCVPKSVGYSWHPC  92



>ref|XP_002312021.2| MLO-like protein 12 [Populus trichocarpa]
 gb|EEE89388.2| MLO-like protein 12 [Populus trichocarpa]
Length=578

 Score =   134 bits (338),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K  ++E TPTWA+AVVCF+LVAISI IE L H +  WL +KHK AL EAL+K+KAELMLM
Sbjct  6    KAVSLEETPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKIALVEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GFISL LTI Q P+S+ICIP+SV  +WHPCD
Sbjct  66   GFISLFLTILQGPISDICIPKSVAATWHPCD  96



>ref|XP_009133347.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=575

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA K+R++E TPTWA+A VCF+++ ISI IE   H +G W  RK+KKAL+EAL+K+KAEL
Sbjct  1    MAIKDRSLEETPTWALAAVCFVILFISIMIECFLHFIGHWFKRKNKKALYEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLL + Q PVS ICIPE +  +WHPC
Sbjct  61   MLLGFISLLLVVLQSPVSQICIPERIAATWHPC  93



>ref|XP_011031756.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
 ref|XP_011031757.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=577

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K  ++E TPTWA+AVVCF+LVAISI IE L H +  WL +KHK AL EAL+K+KAELMLM
Sbjct  6    KAVSLEETPTWAVAVVCFVLVAISIVIEHLIHVVEKWLKKKHKIALVEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GFISL LTI Q P+S+ICIP+SV  +WHPCD
Sbjct  66   GFISLFLTILQGPISDICIPKSVAATWHPCD  96



>gb|AAX31277.1| MLO1 [Capsicum annuum]
Length=587

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF LVAIS+ IE + H +G WL  K K+AL+EAL+KIK+ELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFALVAISVVIEFIIHLIGKWLKSKQKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ QDP+SNIC+ E + ++WHPC K
Sbjct  64   LLGFISLLLTVGQDPISNICVSEKIASTWHPCTK  97



>ref|XP_010905121.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
 ref|XP_010905122.1| PREDICTED: MLO-like protein 6 [Elaeis guineensis]
Length=579

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+LV +SI IE   H +G WL ++HK+AL+EAL+KIK+ELML+GF
Sbjct  9    RSLEETPTWAVAVVCFVLVIVSIIIEHFIHLIGKWLTKRHKRALYEALEKIKSELMLLGF  68

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q  +S IC+P+SVG+SWHPC
Sbjct  69   ISLLLTVVQGLISKICVPKSVGDSWHPC  96



>gb|EYU18859.1| hypothetical protein MIMGU_mgv1a003503mg [Erythranthe guttata]
Length=581

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF+LV++SI IE + H +G WL  KHK+AL+EAL+K+K+ELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFVLVSVSIVIEYIIHLIGKWLKSKHKRALYEALEKVKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+S+ICI E VG +WHPC K
Sbjct  64   LLGFISLLLTVGQSPISDICISEEVGATWHPCSK  97



>ref|NP_001268008.1| MLO7 protein [Vitis vinifera]
 gb|ACF25914.1| MLO-like protein 17 [Vitis vinifera]
Length=539

 Score =   134 bits (336),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            +ER++E TPTWA+AVVCF+L+A+SI IE +FH +G  L  +H++AL+E+L+KIKAELML+
Sbjct  6    EERSLEETPTWAVAVVCFVLLAVSIFIEHIFHLIGSRLKGRHRRALYESLEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLTI QD +S ICI +SVG++WHPC K
Sbjct  66   GFISLLLTILQDYISKICISKSVGSTWHPCKK  97



>emb|CDP07138.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF+LVAISI IE + H +G WL  KHK++L+EAL+KIK+ELM
Sbjct  4    GGGGRSLEQTPTWAVAVVCFVLVAISILIEHILHLIGKWLKSKHKRSLYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P++ ICI + VG +WHPC+K
Sbjct  64   LLGFISLLLTVGQGPITKICISKEVGATWHPCNK  97



>ref|XP_010253610.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=581

 Score =   134 bits (337),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            AG  R++E TPTWA+AVVCF+LV IS+ IE + H +G WL  KHK+AL+EAL+KIK+ELM
Sbjct  4    AGGGRSLEETPTWAVAVVCFLLVLISVIIEHIIHLIGKWLTAKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  +S ICIPE VG +WHPC
Sbjct  64   LLGFISLLLTVGQGIISEICIPEKVGRTWHPC  95



>emb|CDX97946.1| BnaA06g06970D [Brassica napus]
Length=543

 Score =   134 bits (336),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL+EAL+KIKAELMLM
Sbjct  6    KERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKKKHKKALYEALEKIKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI +SV +S HPC
Sbjct  66   GFISLLLTIGQTPISNICISQSVASSMHPC  95



>ref|XP_009148458.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=572

 Score =   134 bits (336),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL+EAL+KIKAELMLM
Sbjct  6    KERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKKKHKKALYEALEKIKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI +SV +S HPC
Sbjct  66   GFISLLLTIGQTPISNICISQSVASSMHPC  95



>ref|XP_009141792.1| PREDICTED: MLO-like protein 12 [Brassica rapa]
Length=572

 Score =   134 bits (336),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+++ ISI IE   H +G W  +KHKKAL EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLL + Q PVS ICIP     +WHPC +
Sbjct  61   MLLGFISLLLVVLQTPVSEICIPNRAAATWHPCSR  95



>emb|CDY19353.1| BnaC05g08620D [Brassica napus]
Length=543

 Score =   133 bits (335),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL+EAL+KIKAELMLM
Sbjct  6    KERTLEQTSTWAVAVVCFVLLLISIVLEHSIHKIGAWFKQKHKKALYEALEKIKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI +SV +S HPC
Sbjct  66   GFISLLLTIGQTPISNICISQSVASSMHPC  95



>ref|XP_010253612.1| PREDICTED: MLO-like protein 6 isoform X2 [Nelumbo nucifera]
Length=328

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            AG  R++E TPTWA+AVVCF+LV IS+ IE + H +G WL  KHK+AL+EAL+KIK+ELM
Sbjct  4    AGGGRSLEETPTWAVAVVCFLLVLISVIIEHIIHLIGKWLTAKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  +S ICIPE VG +WHPC
Sbjct  64   LLGFISLLLTVGQGIISEICIPEKVGRTWHPC  95



>ref|XP_007204981.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
 gb|EMJ06180.1| hypothetical protein PRUPE_ppa003207mg [Prunus persica]
Length=593

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV ISI IE L   +  WL +KHK+ALHEAL+K+K+ELM
Sbjct  4    ATSGRSLEQTPTWAVAVVCFVLVLISIIIEHLIELVAKWLKKKHKRALHEALEKVKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNICI E +GN+WHPC K
Sbjct  64   LLGFISLLLTVGQGPISNICISEKLGNTWHPCGK  97



>gb|ACO07297.1| MLO1 [Pisum sativum]
 gb|AGJ01118.1| MLO1 protein [Pisum sativum subsp. sativum]
Length=574

 Score =   133 bits (335),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E TPTWA+AVVC +L+A+SI IE + H +G WL +++K AL+EAL+KIK ELML+
Sbjct  7    KERTLEETPTWAVAVVCLVLLAVSILIEHIIHVIGKWLKKRNKNALYEALEKIKGELMLL  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT+FQD +S IC+ + +G++WHPC
Sbjct  67   GFISLLLTVFQDNISKICVSQKIGSTWHPC  96



>ref|XP_006417368.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
 gb|ESQ35721.1| hypothetical protein EUTSA_v10007208mg [Eutrema salsugineum]
Length=573

 Score =   133 bits (334),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL+EAL+K+KAELML+
Sbjct  6    KERTLEQTSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKQKHKKALYEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI ESV +S HPC
Sbjct  66   GFISLLLTIAQTPISNICISESVASSMHPC  95



>ref|XP_006606236.1| PREDICTED: MLO-like protein 12-like isoform X2 [Glycine max]
Length=389

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A  +  +EAT TWA+AVVCF+++AISI IE +   LG WL +KH+KALHEAL+K+K ELM
Sbjct  6    ANLQAKLEATSTWAVAVVCFVMLAISILIEHILEELGKWLKKKHQKALHEALEKVKGELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLL +FQD +S ICIP+S+ ++WHPCD
Sbjct  66   LLGFISLLLVVFQDRISTICIPKSIASTWHPCD  98



>ref|NP_565902.1| protein MILDEW RESISTANCE LOCUS O 12 [Arabidopsis thaliana]
 sp|O80961.2|MLO12_ARATH RecName: Full=MLO-like protein 12; Short=AtMlo12; Short=AtMlo18 
[Arabidopsis thaliana]
 gb|AAK53805.1|AF369573_1 membrane protein Mlo12 [Arabidopsis thaliana]
 gb|AAC28997.2| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC09645.1| MLO-like protein [Arabidopsis thaliana]
Length=576

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL EAL+K+KAEL
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLL + Q PVS ICIP ++  +WHPC  
Sbjct  61   MLLGFISLLLVVLQTPVSEICIPRNIAATWHPCSN  95



>ref|XP_011089887.1| PREDICTED: MLO-like protein 6 [Sesamum indicum]
Length=587

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LVAISI IE + H +G WL  KHK+AL+EAL+K+K+
Sbjct  1    MAGASGGRSLEQTPTWAVAVVCFVLVAISIVIEHIIHLIGKWLKSKHKRALYEALEKLKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+S+ICI ++VG +WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPISDICISKAVGATWHPCSK  97



>gb|KDO48444.1| hypothetical protein CISIN_1g008391mg [Citrus sinensis]
Length=411

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+A V F+L+A+S+ IE L H +G WL  +HKKAL EA++K+KAELML+G
Sbjct  8    ERTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC-DKI  299
            FISLLLT+ Q+P+S IC+ +SV NSWHPC DK+
Sbjct  68   FISLLLTVLQEPISGICVSKSVANSWHPCTDKL  100



>ref|XP_006485875.1| PREDICTED: MLO-like protein 12-like [Citrus sinensis]
Length=411

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+A V F+L+A+S+ IE L H +G WL  +HKKAL EA++K+KAELML+G
Sbjct  8    ERTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC-DKI  299
            FISLLLT+ Q+P+S IC+ +SV NSWHPC DK+
Sbjct  68   FISLLLTVLQEPISGICVSKSVANSWHPCTDKL  100



>gb|AIT98395.1| MLO1 [Solanum tuberosum]
Length=518

 Score =   131 bits (330),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 68/91 (75%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER+MEATPTWAIAVVCFIL+AISI IEQ+ HH+G WLL K KK L+EAL+KIKAELML
Sbjct  2    AKERSMEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKPLYEALEKIKAELML  61

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GF+SLLLT+ Q+PVSN+C+P+S+G SWHPC
Sbjct  62   LGFLSLLLTVLQEPVSNLCVPKSIGYSWHPC  92



>gb|EYU25264.1| hypothetical protein MIMGU_mgv1a024934mg, partial [Erythranthe 
guttata]
Length=183

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LVA+SI IE + H +G W   KHK+AL+E+L+K+KA
Sbjct  1    MAGASGGRSLEQTPTWAVAVVCFVLVAVSILIEHIIHLIGKWFKSKHKRALYESLEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI E +G++WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQSPISNICISEKLGSTWHPCNK  97



>ref|XP_008796805.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
               +R++E T TWA+A VCF+LV ISI IE  FH +G WL ++HK+AL+EAL+KIK+ELM
Sbjct  6    GANDRSLEDTSTWAVAAVCFVLVIISIFIEHGFHLIGKWLKKRHKRALYEALEKIKSELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMGFISLLLT+ Q  +S IC+P+SVGNSWHPC
Sbjct  66   LMGFISLLLTVSQGLISKICVPKSVGNSWHPC  97



>ref|XP_003555433.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=559

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A  +  +EAT TWA+AVVCF+++AISI IE +   LG WL +KH+KALHEAL+K+K ELM
Sbjct  6    ANLQAKLEATSTWAVAVVCFVMLAISILIEHILEELGKWLKKKHQKALHEALEKVKGELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLL +FQD +S ICIP+S+ ++WHPCD
Sbjct  66   LLGFISLLLVVFQDRISTICIPKSIASTWHPCD  98



>ref|XP_007151752.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
 gb|ESW23746.1| hypothetical protein PHAVU_004G071700g [Phaseolus vulgaris]
Length=573

 Score =   131 bits (329),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+A+SIAIE L H +G W  +K K AL EAL+K+K ELM++G
Sbjct  7    ERTLEETPTWAVAVVCFLLLAVSIAIEHLIHGIGKWFKKKQKNALFEALEKVKGELMVLG  66

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FISLLL++ QD +S IC+ E V  SWHPC
Sbjct  67   FISLLLSVLQDQISKICVSEEVAASWHPC  95



>gb|KHN00832.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A  +  +EAT TWA+AVVCF+++AISI IE +   LG WL +KH+KALHEAL+K+K ELM
Sbjct  6    ANLQAKLEATSTWAVAVVCFVMLAISILIEHILEELGKWLKKKHQKALHEALEKVKGELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLL +FQD +S ICIP+S+ ++WHPCD
Sbjct  66   LLGFISLLLVVFQDRISTICIPKSIASTWHPCD  98



>gb|KDO48443.1| hypothetical protein CISIN_1g008391mg [Citrus sinensis]
Length=567

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+A V F+L+A+S+ IE L H +G WL  +HKKAL EA++K+KAELML+G
Sbjct  8    ERTLEETPTWAVAAVFFVLIAVSVVIEHLIHIIGKWLNNRHKKALFEAVEKVKAELMLLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC-DKI  299
            FISLLLT+ Q+P+S IC+ +SV NSWHPC DK+
Sbjct  68   FISLLLTVLQEPISGICVSKSVANSWHPCTDKL  100



>gb|AGV68799.1| MLO1 [Prunus armeniaca]
Length=591

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV +SI IE L   +  WL +KHK+AL+EAL+K+K+ELM
Sbjct  4    ATSGRSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEALEKVKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNICI E +GN+WHPC K
Sbjct  64   LLGFISLLLTVGQGPISNICISEKLGNTWHPCGK  97



>ref|XP_008796803.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=596

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
               +R++E TPTWA+A VCF+LV ISI IE   H +G WL ++H++AL+EAL+KIK+ELM
Sbjct  6    GANDRSLEETPTWAVAAVCFVLVIISIFIEHGIHLIGKWLKKRHQRALYEALEKIKSELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMGFISLLLT+ Q  +S IC+P+SVGNSWHPC
Sbjct  66   LMGFISLLLTVSQGLISKICVPKSVGNSWHPC  97



>emb|CDP06724.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   130 bits (326),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  9    LMAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAE  188
            + AG  R++E TPTWA+AVVCF+LVA+SI IE + H +  WL +++++AL EAL+KIK+E
Sbjct  1    MAAGGGRSLEETPTWAVAVVCFVLVALSIIIECVIHLIEKWLTKRNRRALCEALEKIKSE  60

Query  189  LMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            LML+GF+SLLLTI Q P+S ICI +S+GN+WHPC+K
Sbjct  61   LMLLGFMSLLLTIGQGPISEICISKSLGNTWHPCNK  96



>gb|KFK35674.1| hypothetical protein AALP_AA4G022500 [Arabis alpina]
Length=576

 Score =   130 bits (326),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E+  H +G W  +KHKKAL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKQKHKKALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V +S HPC
Sbjct  66   GFISLLLTIGQTPISNICISQKVASSMHPC  95



>ref|XP_006307103.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
 gb|EOA40001.1| hypothetical protein CARUB_v10008691mg [Capsella rubella]
Length=578

 Score =   130 bits (326),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFRKKHKKALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI E V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISEQVASTMHPC  95



>ref|XP_007027290.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY07792.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=564

 Score =   129 bits (325),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA KE  R++E TPTWA+A VCF+L+ ISI IE + H +GMWL ++HK+AL EAL+KIK+
Sbjct  1    MAAKEGSRSLEQTPTWAVAAVCFVLILISIIIEHVIHLIGMWLKKRHKRALCEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML GF+SLLLT+ Q  VS+ICI +++G +WHPC K
Sbjct  61   ELMLFGFMSLLLTVGQGVVSDICISKALGATWHPCSK  97



>ref|XP_003540745.1| PREDICTED: MLO-like protein 6-like isoform X1 [Glycine max]
Length=577

 Score =   129 bits (325),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R +E TPTWA++ VCF+L+ ISI IE + H +G WL +KH++AL+E+L+KIK+
Sbjct  1    MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ELML+GFISLLLT+ Q P+S ICI E V  +WHPCD
Sbjct  61   ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCD  96



>ref|NP_001288934.1| MLO-like protein 2 [Brassica rapa]
 gb|AAX77014.1| MLO1 [Brassica rapa]
Length=574

 Score =   129 bits (325),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHKKAL+EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGSWFKQKHKKALYEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI ++V +S HPC
Sbjct  66   GFISLLLTIGQTPISNICISQNVASSMHPC  95



>gb|KHN05728.1| MLO-like protein 6 [Glycine soja]
Length=504

 Score =   129 bits (323),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R +E TPTWA++ VCF+L+ ISI IE + H +G WL +KH++AL+E+L+KIK+
Sbjct  1    MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ELML+GFISLLLT+ Q P+S ICI E V  +WHPCD
Sbjct  61   ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCD  96



>ref|NP_176350.1| MLO-like protein 6 [Arabidopsis thaliana]
 sp|Q94KB7.2|MLO6_ARATH RecName: Full=MLO-like protein 6; Short=AtMlo6 [Arabidopsis thaliana]
 gb|AAD25552.1|AC005850_9 Highly Simlilar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53799.2|AF369567_1 membrane protein Mlo6 [Arabidopsis thaliana]
 gb|AEE33851.1| MLO-like protein 6 [Arabidopsis thaliana]
Length=583

 Score =   129 bits (325),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W  +K+KKAL+EAL+K+KAELMLM
Sbjct  6    KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKKKNKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  66   GFISLLLTIGQGYISNICIPKNIAASMHPC  95



>ref|XP_008225371.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=591

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV +SI IE L   +  WL +KHK+AL+EA++K+K+ELM
Sbjct  4    ATSGRSLEQTPTWAVAVVCFVLVLVSIIIEHLIELVAKWLKKKHKRALYEAVEKVKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNICI E +GN+WHPC K
Sbjct  64   LLGFISLLLTVGQGPISNICISEKLGNTWHPCGK  97



>ref|XP_010473362.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=596

 Score =   129 bits (325),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  7    KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLM  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  67   GFISLLLTIGQGYISNICIPKNIAASMHPC  96



>ref|XP_002886534.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62793.1| hypothetical protein ARALYDRAFT_315221 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score =   129 bits (324),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H LG W   K+KKAL+EAL+K+KAELMLM
Sbjct  6    KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKLGSWFKSKNKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  66   GFISLLLTIGQGYISNICIPKNIAASMHPC  95



>ref|XP_010104115.1| MLO-like protein 6 [Morus notabilis]
 gb|EXB98556.1| MLO-like protein 6 [Morus notabilis]
Length=585

 Score =   129 bits (324),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL E+L+K+K+
Sbjct  1    MAGASGGRSLEQTPTWAVAVVCFVLVFISIVIEHIIHLIGEWLKKKHKRALFESLEKVKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +SNICI E V  +WHPC K
Sbjct  61   ELMLLGFISLLLTVGQTLISNICISEKVAATWHPCSK  97



>ref|XP_010418123.1| PREDICTED: MLO-like protein 6 [Camelina sativa]
Length=597

 Score =   129 bits (324),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  7    KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLM  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  67   GFISLLLTIGQGYISNICIPKNIAASMHPC  96



>ref|XP_006592218.1| PREDICTED: MLO-like protein 6-like isoform X2 [Glycine max]
Length=434

 Score =   128 bits (321),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R +E TPTWA++ VCF+L+ ISI IE + H +G WL +KH++AL+E+L+KIK+
Sbjct  1    MAGGSGGRNLEETPTWAVSAVCFVLILISITIEHIIHLIGKWLKKKHRRALYESLEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ELML+GFISLLLT+ Q P+S ICI E V  +WHPCD
Sbjct  61   ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCD  96



>ref|XP_010492667.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=577

 Score =   129 bits (323),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E+  H +G W  +KHKKAL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKKKHKKALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI ++V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISKNVASTMHPC  95



>ref|XP_006302048.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
 gb|EOA34946.1| hypothetical protein CARUB_v10020030mg [Capsella rubella]
Length=592

 Score =   129 bits (324),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  6    KEKTLEETSTWAVAVVCFVLLLISIVIENLIHKIGSWFKNKNKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  66   GFISLLLTIGQGYISNICIPKNIAASMHPC  95



>ref|XP_010430162.1| PREDICTED: MLO-like protein 6 isoform X1 [Camelina sativa]
Length=633

 Score =   129 bits (325),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  42   KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLM  101

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  102  GFISLLLTIGQGYISNICIPKNIAASMHPC  131



>ref|XP_010430163.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=633

 Score =   129 bits (324),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  42   KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLM  101

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  102  GFISLLLTIGQGYISNICIPKNIAASMHPC  131



>ref|NP_001234814.1| MLO1 protein [Solanum lycopersicum]
 gb|AAX77013.1| MLO1 [Solanum lycopersicum]
Length=507

 Score =   128 bits (321),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  33   MEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFIS  212
            MEATPTWAIAVVCFIL+AISI IEQ+ HH+G WLL K KK+L+EAL+KIKAELML+GF+S
Sbjct  1    MEATPTWAIAVVCFILLAISIFIEQIIHHIGEWLLEKRKKSLYEALEKIKAELMLLGFLS  60

Query  213  LLLTIFQDPVSNICIPESVGNSWHPC  290
            LLLT+ QDPVSN+C+P+SVG SWHPC
Sbjct  61   LLLTVLQDPVSNLCVPKSVGYSWHPC  86



>ref|XP_010458517.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=575

 Score =   128 bits (322),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E+  H +G W  +KHKKAL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEKYIHKIGTWFKKKHKKALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISKHVASTMHPC  95



>gb|KJB09233.1| hypothetical protein B456_001G130800 [Gossypium raimondii]
Length=584

 Score =   128 bits (321),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    RT+E TPTWA+AVVCF LV ISI IE + H +G WL  KHK+AL+EAL+KIK+
Sbjct  1    MAGGSGGRTLEETPTWAVAVVCFALVLISIIIEHILHMIGKWLKNKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +S+ICI + +  +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQGLISDICISKEIAATWHPCNK  97



>ref|XP_010473363.1| PREDICTED: MLO-like protein 6 isoform X2 [Camelina sativa]
Length=492

 Score =   127 bits (319),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T+E T TWA+AVVCF+L+ ISI IE+L H +G W   K+KKAL+EAL+K+KAELMLM
Sbjct  7    KEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKNKNKKALYEALEKVKAELMLM  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q  +SNICIP+++  S HPC
Sbjct  67   GFISLLLTIGQGYISNICIPKNIAASMHPC  96



>ref|XP_004148785.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 ref|XP_004168500.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN64744.1| hypothetical protein Csa_1G085890 [Cucumis sativus]
Length=582

 Score =   128 bits (321),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    +++E TPTWA+AVVCF+L+ ISI IE   H +G WL ++HK+AL EAL+KIK+
Sbjct  1    MAGAAGGKSLEQTPTWAVAVVCFVLLVISIFIEYSLHLIGHWLKKRHKRALFEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P++ ICIP+ V  +WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPITEICIPQHVAATWHPCTK  97



>ref|XP_010476039.1| PREDICTED: MLO-like protein 2 isoform X1 [Camelina sativa]
Length=576

 Score =   127 bits (320),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E+  H +G W  +KHKKAL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEKSIHKIGTWFKKKHKKALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISKHVASTMHPC  95



>gb|KDO73205.1| hypothetical protein CISIN_1g023637mg [Citrus sinensis]
Length=209

 Score =   122 bits (306),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>emb|CAN64133.1| hypothetical protein VITISV_032771 [Vitis vinifera]
Length=569

 Score =   127 bits (318),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 55/92 (60%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K+R++E TPTWA+AVVCF+LV ISI IE + H +G WL +++K+AL+EAL+KIK+ELML+
Sbjct  6    KDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKSELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ Q  ++ ICI E +  +WHPC K
Sbjct  66   GFISLLLTVGQGTIAGICISEKIAATWHPCGK  97



>ref|XP_008463775.1| PREDICTED: MLO-like protein 6 [Cucumis melo]
Length=580

 Score =   127 bits (318),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    +++E TPTWA+AVVCF+L+ +SI IE   H +G WL ++HK+AL EAL+KIK+
Sbjct  1    MAGAAGGKSLEQTPTWAVAVVCFVLLVVSIFIEYSLHLIGHWLKKRHKRALFEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P++ ICIP+ V  +WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPITEICIPQHVAATWHPCTK  97



>gb|EYU45068.1| hypothetical protein MIMGU_mgv1a009898mg [Erythranthe guttata]
Length=328

 Score =   124 bits (312),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LVA+SI IE + H +G WL  KHK+AL+E+L+K+KA
Sbjct  1    MAGASGGRSLEQTPTWAVAVVCFVLVAVSILIEHIIHLIGKWLKSKHKRALYESLEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI + +G++WHPC K
Sbjct  61   ELMLLGFISLLLTVGQSPISNICISKKLGSTWHPCTK  97



>emb|CDY07075.1| BnaA04g22400D [Brassica napus]
Length=574

 Score =   127 bits (318),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA--  185
            MA KER++E TPTWA+AVVCF+++ ISI IE   H +G W  +KHKKAL EAL+K+KA  
Sbjct  1    MAIKERSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAGK  60

Query  186  -ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
             +LML+GFISLLL + Q PVS ICIP     +WHPC +
Sbjct  61   FKLMLLGFISLLLVVLQTPVSEICIPNRAAATWHPCSR  98



>ref|XP_002862890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=195

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA KER++E TPTWA+AVVCF+L+ ISI IE   H +G W  +KHKKAL EAL+K    L
Sbjct  1    MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALSEALEK----L  56

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ML+GFISLLL + Q PVS ICIP ++  +WHPC 
Sbjct  57   MLLGFISLLLVVLQTPVSQICIPRNIAATWHPCS  90



>ref|NP_001117268.1| MLO-like protein 2 [Arabidopsis thaliana]
 gb|AEE28716.1| MLO-like protein 2 [Arabidopsis thaliana]
Length=418

 Score =   125 bits (314),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHK+AL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISQKVASTMHPC  95



>ref|NP_172598.1| MLO-like protein 2 [Arabidopsis thaliana]
 sp|Q9SXB6.1|MLO2_ARATH RecName: Full=MLO-like protein 2; Short=AtMlo2 [Arabidopsis thaliana]
 gb|AAD49991.1|AC007259_4 Highly similar to Mlo proteins [Arabidopsis thaliana]
 gb|AAK53795.1|AF369563_1 membrane protein Mlo2 [Arabidopsis thaliana]
 gb|AAM63648.1| Mlo protein, putative [Arabidopsis thaliana]
 dbj|BAE98591.1| Mlo like protein [Arabidopsis thaliana]
 gb|AEE28715.1| MLO-like protein 2 [Arabidopsis thaliana]
Length=573

 Score =   126 bits (316),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHK+AL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V ++ HPC
Sbjct  66   GFISLLLTIGQTPISNICISQKVASTMHPC  95



>ref|XP_003548912.1| PREDICTED: MLO-like protein 12-like isoform X1 [Glycine max]
Length=571

 Score =   126 bits (316),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER++E TPTWA AVVCF+L+AISI IE +   +G W  +KHK AL+E+L+K+K ELM++G
Sbjct  8    ERSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FIS+LL +FQ P+S ICI ++V ++WHPC
Sbjct  68   FISMLLVVFQGPLSKICISQNVASTWHPC  96



>gb|AAX77015.1| MLO1 [Lotus japonicus]
Length=551

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ++ +E TPTWA+AVVCF+++AISI IE     +  WL ++HKKALHEA++KIK ELMLMG
Sbjct  6    QKKLEETPTWAVAVVCFVMLAISIIIEHGIEAIEKWLEKRHKKALHEAVEKIKGELMLMG  65

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FIS LLT+F+DP+SNICI + V ++WHPC
Sbjct  66   FISFLLTVFKDPISNICISKQVASTWHPC  94



>gb|KDO73204.1| hypothetical protein CISIN_1g023637mg [Citrus sinensis]
Length=254

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>gb|KDO73203.1| hypothetical protein CISIN_1g023637mg [Citrus sinensis]
Length=247

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>ref|XP_007151753.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
 gb|ESW23747.1| hypothetical protein PHAVU_004G071800g [Phaseolus vulgaris]
Length=539

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            +R++E TPTWA AVVCF+L+AISI IE + H +G WL +KHK  L+E+L+K+K ELM++G
Sbjct  8    KRSLEETPTWAFAVVCFMLLAISIIIELVIHAIGKWLRKKHKSGLYESLEKVKGELMMLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            F+S+LLT+FQDP+S ICI ++  ++WHPC  
Sbjct  68   FLSMLLTVFQDPLSKICISQNAASTWHPCSN  98



>gb|KJB09234.1| hypothetical protein B456_001G130800 [Gossypium raimondii]
Length=418

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    RT+E TPTWA+AVVCF LV ISI IE + H +G WL  KHK+AL+EAL+KIK+
Sbjct  1    MAGGSGGRTLEETPTWAVAVVCFALVLISIIIEHILHMIGKWLKNKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +S+ICI + +  +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQGLISDICISKEIAATWHPCNK  97



>gb|KHN13369.1| MLO-like protein 12 [Glycine soja]
Length=592

 Score =   126 bits (316),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER++E TPTWA AVVCF+L+AISI IE +   +G W  +KHK AL+E+L+K+K ELM++G
Sbjct  8    ERSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FIS+LL +FQ P+S ICI ++V ++WHPC
Sbjct  68   FISMLLVVFQGPLSKICISQNVASTWHPC  96



>ref|XP_006391995.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
 gb|ESQ29281.1| hypothetical protein EUTSA_v10023372mg [Eutrema salsugineum]
Length=585

 Score =   125 bits (315),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+ ++ T TWA+AVVCF+L+ ISI IE+L H +G W  RK+KKAL+EAL+K+KAELMLM
Sbjct  6    KEKDLQQTSTWAVAVVCFVLLLISIVIEKLIHKVGTWFKRKNKKALYEALEKVKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GF+SLLLTI Q+  SNICI +S+  S HPC K
Sbjct  66   GFLSLLLTIGQNFTSNICISKSIAASMHPCSK  97



>ref|XP_008361435.1| PREDICTED: MLO-like protein 2, partial [Malus domestica]
Length=235

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE +   +  WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI + +GN+WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGK  97



>gb|KDO73202.1| hypothetical protein CISIN_1g023637mg [Citrus sinensis]
Length=277

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>ref|XP_010043721.1| PREDICTED: MLO-like protein 6 isoform X2 [Eucalyptus grandis]
Length=409

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV +SI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    AAGGRSLEQTPTWAVAVVCFVLVLVSIIIEYIIHLIGQWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P++ ICIP+ VG +WHPC+K
Sbjct  64   LLGFISLLLTVGQGPITKICIPQKVGATWHPCNK  97



>gb|KDO73201.1| hypothetical protein CISIN_1g023637mg [Citrus sinensis]
Length=279

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>ref|XP_002892636.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68895.1| hypothetical protein ARALYDRAFT_471266 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score =   125 bits (314),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+AVVCF+L+ ISI +E   H +G W  +KHK AL EAL+K+KAELML+
Sbjct  6    KERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKHALFEALEKVKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT+ Q P+SNICI + V  + HPC
Sbjct  66   GFISLLLTVGQTPISNICISQKVAKTMHPC  95



>ref|XP_006850616.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
 gb|ERN12197.1| hypothetical protein AMTR_s00034p00158070 [Amborella trichopoda]
Length=600

 Score =   125 bits (315),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF++V +SI IE   H +G WL ++HK+AL+EAL+KIKAELM
Sbjct  4    ASGSRSLEETPTWAVAVVCFVMVLVSILIEHAIHLVGKWLTKRHKRALYEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLTI QD +S ICI +S+G+S  PC K
Sbjct  64   LLGFISLLLTIGQDTISRICISKSMGDSLLPCRK  97



>gb|AFM35696.1| Mlo [Vitis pseudoreticulata]
Length=545

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K+R++  TPTWA+AVVCF+L+A+SI IE + HH+G WL R++K+AL+EAL+KIKAELML+
Sbjct  6    KDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GF+SLLLT+ Q P+S ICI +SVG++W+PCD
Sbjct  66   GFMSLLLTVLQTPISKICISKSVGSTWYPCD  96



>emb|CBI31481.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K+R++  TPTWA+AVVCF+L+A+SI IE + HH+G WL R++K+AL+EAL+KIKAELML+
Sbjct  6    KDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GF+SLLLT+ Q P+S ICI +SVG++W+PCD
Sbjct  66   GFMSLLLTVLQTPISKICISKSVGSTWYPCD  96



>ref|XP_010043720.1| PREDICTED: MLO-like protein 6 isoform X1 [Eucalyptus grandis]
 gb|KCW85717.1| hypothetical protein EUGRSUZ_B02482 [Eucalyptus grandis]
Length=579

 Score =   125 bits (313),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV +SI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGAAGGRSLEQTPTWAVAVVCFVLVLVSIIIEYIIHLIGQWLKKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P++ ICIP+ VG +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQGPITKICIPQKVGATWHPCNK  97



>gb|AFW98801.1| MLO protein 1 [Rosa multiflora]
Length=592

 Score =   125 bits (313),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+LV +SI IE +   +  WL RKHK+AL EAL+KIK+ELML+GF
Sbjct  8    RSLEQTPTWAVAVVCFVLVLVSIIIEYIIELIAKWLKRKHKRALFEALEKIKSELMLLGF  67

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ISLLLT+ Q P+SNICI + VGN+WHPC K
Sbjct  68   ISLLLTVGQGPISNICISKKVGNTWHPCSK  97



>ref|XP_009104728.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=595

 Score =   125 bits (313),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT++ T TWA+AVVCF L+ ISI IE+L H LG W  RK+KKAL+EAL+K+KAELMLMG
Sbjct  15   ERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEKVKAELMLMG  74

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            FISLLLTI Q+ +S IC+ ESV  S  PC +
Sbjct  75   FISLLLTIGQNYISQICVSESVAASMRPCSR  105



>emb|CDY47582.1| BnaA01g22680D [Brassica napus]
Length=556

 Score =   124 bits (312),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT++ T TWA+AVVCF L+ ISI IE+L H LG W  RK+KKAL+EAL+K+KAELMLMG
Sbjct  15   ERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEKVKAELMLMG  74

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            FISLLLTI Q+ +S IC+ ESV  S  PC +
Sbjct  75   FISLLLTIGQNYISQICVSESVAASMRPCSR  105



>ref|XP_004309423.1| PREDICTED: MLO-like protein 6 [Fragaria vesca subsp. vesca]
Length=590

 Score =   124 bits (312),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+LV ISI IE +   +G WL  KHK+AL EAL+K+K+ELML+GF
Sbjct  8    RSLEQTPTWAVAVVCFVLVLISIIIEHILELIGKWLKNKHKRALFEALEKVKSELMLLGF  67

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q P+SNICI E VGN+WHPC
Sbjct  68   ISLLLTVGQGPISNICISEKVGNTWHPC  95



>ref|XP_002533246.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29131.1| Protein MLO, putative [Ricinus communis]
Length=583

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A KER++E TPTWA+A+VC +++ IS+ IE   H +  W  + HK AL EAL+KIKAELM
Sbjct  5    AAKERSLEETPTWAVAIVCLVMIVISVLIEHAIHMIEKWFKKIHKPALAEALEKIKAELM  64

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            LMGFISLLLT  Q P+S ICI ESV ++WHPC+K
Sbjct  65   LMGFISLLLTALQGPISEICISESVASTWHPCNK  98



>ref|XP_006599405.1| PREDICTED: MLO-like protein 12-like isoform X2 [Glycine max]
Length=411

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER++E TPTWA AVVCF+L+AISI IE +   +G W  +KHK AL+E+L+K+K ELM++G
Sbjct  8    ERSLEDTPTWAFAVVCFVLLAISIIIEHVIDAIGKWFKKKHKSALYESLEKVKGELMMLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FIS+LL +FQ P+S ICI ++V ++WHPC
Sbjct  68   FISMLLVVFQGPLSKICISQNVASTWHPC  96



>emb|CDY03836.1| BnaC01g29530D [Brassica napus]
Length=471

 Score =   123 bits (309),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  ERT++ T TWA+AVVCF L+ ISI IE+L H LG W  RK+KKAL+EAL+K+KA
Sbjct  1    MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGNWFKRKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S IC+ ES+  S  PC +
Sbjct  61   ELMLMGFISLLLTIGQNYISQICVSESIAASMRPCSR  97



>ref|NP_001268013.1| MLO11 protein [Vitis vinifera]
 gb|ACF25910.1| MLO-like protein 3 [Vitis vinifera]
 emb|CBI32709.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
              K+R++E TPTWA+AVVCF+LV ISI IE + H +G WL +++K+AL+EAL+KIK+ELM
Sbjct  4    GSKDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q  ++ ICI E +  +WHPC K
Sbjct  64   LLGFISLLLTVGQGTIAGICISEKIAATWHPCGK  97



>ref|XP_010264736.1| PREDICTED: MLO-like protein 6 isoform X2 [Nelumbo nucifera]
Length=413

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
            G  R++E TPTWA+A VCF+LVAISI IE + H +G WL ++HK+AL+E+L+KIK+ELML
Sbjct  5    GGGRSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKSELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            +GFISLLLT+ Q  +S ICIP+SVGNSWHPC+K
Sbjct  65   LGFISLLLTVGQGLISEICIPKSVGNSWHPCNK  97



>ref|NP_001268005.1| MLO6 protein [Vitis vinifera]
 gb|ACF25913.1| MLO-like protein 13 [Vitis vinifera]
Length=545

 Score =   123 bits (309),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            ++R++  TPTWA+AVVCF+L+A+SI IE + HH+G WL R++K+AL+EAL+KIKAELML+
Sbjct  6    EDRSLTETPTWAVAVVCFVLLAVSIFIEHIIHHIGSWLARRNKRALYEALEKIKAELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GF+SLLLT+ Q P+S ICI +SVG++W+PCD
Sbjct  66   GFMSLLLTVLQTPISKICISKSVGSTWYPCD  96



>ref|XP_009110727.1| PREDICTED: MLO-like protein 2 [Brassica rapa]
Length=553

 Score =   123 bits (309),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA KE  RT+E T TW +AVVCF+L+ IS+ IE L H +G WL +KHK  L+EAL+K+KA
Sbjct  1    MADKEYERTLEETSTWTVAVVCFVLILISLFIEHLIHKIGSWLKKKHKGNLYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q P+S++CIP+S+ +S  PC
Sbjct  61   ELMLLGFISLLLTVAQTPISSLCIPKSIASSMRPC  95



>ref|XP_008366359.1| PREDICTED: MLO-like protein 2 [Malus domestica]
Length=248

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV ISI IE +   +  WL +KHK AL+EAL+KIK+ELM
Sbjct  4    AXSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKSALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNICI + +GN+WHPC K
Sbjct  64   LLGFISLLLTVGQGPISNICISQKIGNTWHPCGK  97



>ref|XP_010264735.1| PREDICTED: MLO-like protein 6 isoform X1 [Nelumbo nucifera]
Length=578

 Score =   123 bits (309),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
            G  R++E TPTWA+A VCF+LVAISI IE + H +G WL ++HK+AL+E+L+KIK+ELML
Sbjct  5    GGGRSLEETPTWAVATVCFVLVAISIIIEHIIHLIGKWLTKRHKRALYESLEKIKSELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            +GFISLLLT+ Q  +S ICIP+SVGNSWHPC+K
Sbjct  65   LGFISLLLTVGQGLISEICIPKSVGNSWHPCNK  97



>emb|CDY20991.1| BnaA08g25340D [Brassica napus]
Length=553

 Score =   123 bits (308),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA KE  RT+E T TW +AVVCF+L+ IS+ IE L H +G WL +KHK  L+EAL+K+KA
Sbjct  1    MADKEYERTLEETSTWTVAVVCFVLILISLLIEHLIHKIGSWLKKKHKGNLYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q P+S+ CIP+S+ +S  PC
Sbjct  61   ELMLLGFISLLLTVAQTPISSFCIPKSIASSMRPC  95



>ref|XP_006424615.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006424616.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 ref|XP_006488132.1| PREDICTED: MLO-like protein 6-like isoform X1 [Citrus sinensis]
 gb|ESR37855.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
 gb|ESR37856.1| hypothetical protein CICLE_v10028092mg [Citrus clementina]
Length=576

 Score =   123 bits (309),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>ref|XP_009395303.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=584

 Score =   123 bits (309),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            RT+E T TWA+A VCF LV IS+AIE   H +  WL + HK+AL EAL+KIK+ELML+GF
Sbjct  9    RTLEQTSTWAVATVCFALVIISVAIEHGIHLITKWLEKHHKRALQEALEKIKSELMLLGF  68

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +SLLLT+ Q  +S IC+P SVG+SWHPC
Sbjct  69   VSLLLTVGQSAISEICVPTSVGDSWHPC  96



>ref|XP_007150220.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
 gb|ESW22214.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
Length=420

 Score =   122 bits (306),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+L+ ISI I+ +FH +G WL +KHK+AL+E+L+KIK+ELML+GF
Sbjct  4    RSLEETPTWAVAVVCFVLLTISIVIDHIFHLIGKWLKKKHKRALYESLEKIKSELMLLGF  63

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  64   ISLLLTVGQSVISRICISEKVAGTFHPC  91



>ref|XP_006488133.1| PREDICTED: MLO-like protein 6-like isoform X2 [Citrus sinensis]
Length=418

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGASGGRSLEETPTWAVAVVCFVLVTISIIIEHIIHLIGKWLTKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+    +S ICIPESV N+WHPCDK
Sbjct  61   ELMLLGFISLLLTVAGSWISKICIPESVANTWHPCDK  97



>ref|XP_010476040.1| PREDICTED: MLO-like protein 2 isoform X2 [Camelina sativa]
Length=573

 Score =   123 bits (308),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T++ T TWA+AVVCF+L+ ISI IE+  H +G WL +K+KK L+EAL+K+KAELML+
Sbjct  3    KEQTLQFTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKNKKDLYEALEKVKAELMLL  62

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+SNICI + V ++ HPC
Sbjct  63   GFISLLLTIGQTPISNICISKHVASTMHPC  92



>ref|XP_003539406.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=575

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R ++ TPTWAIAVVCF+L++ISI IE +FH +G W  +KHK+AL+E+L+KIK+ELML+GF
Sbjct  7    RNLDETPTWAIAVVCFVLLSISITIEHIFHVIGKWFKQKHKRALYESLEKIKSELMLLGF  66

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  67   ISLLLTVGQGLISRICISEKVAGTFHPC  94



>emb|CDY14402.1| BnaC03g21930D [Brassica napus]
Length=560

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA--  185
            MA KER++E TPTWA+AVVCF+++ ISI IE   H +G W  +KHKKAL EAL+K+KA  
Sbjct  1    MAIKERSLEETPTWAVAVVCFVILFISILIEYFLHFIGHWFKKKHKKALCEALEKVKAGK  60

Query  186  -ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
             +LML+GFISLLL + Q PVS ICIP     +WHPC 
Sbjct  61   FKLMLLGFISLLLVVLQTPVSEICIPNRAAATWHPCS  97



>gb|KHN25050.1| MLO-like protein 6 [Glycine soja]
Length=472

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R ++ TPTWAIAVVCF+L++ISI IE +FH +G W  +KHK+AL+E+L+KIK+ELML+GF
Sbjct  7    RNLDETPTWAIAVVCFVLLSISITIEHIFHVIGKWFKQKHKRALYESLEKIKSELMLLGF  66

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ISLLLT+ Q  +S ICI E V  ++HPC 
Sbjct  67   ISLLLTVGQGLISRICISEKVAGTFHPCS  95



>ref|XP_007150219.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
 gb|ESW22213.1| hypothetical protein PHAVU_005G136700g [Phaseolus vulgaris]
Length=551

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVCF+L+ ISI I+ +FH +G WL +KHK+AL+E+L+KIK+ELML+GF
Sbjct  4    RSLEETPTWAVAVVCFVLLTISIVIDHIFHLIGKWLKKKHKRALYESLEKIKSELMLLGF  63

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  64   ISLLLTVGQSVISRICISEKVAGTFHPC  91



>ref|XP_008338448.1| PREDICTED: MLO-like protein 6 [Malus domestica]
Length=560

 Score =   122 bits (305),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE +   +  WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI + +GN+WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGK  97



>ref|XP_010099633.1| MLO-like protein 12 [Morus notabilis]
 gb|EXB80099.1| MLO-like protein 12 [Morus notabilis]
Length=142

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            M  +ERT+E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL+EAL+ IKAEL
Sbjct  1    MKIEERTLEETPTWAVAVVCFVLVVISIFIEHIIHLIGSWLQKKHKRALYEALEMIKAEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLLT+ QD +S ICI +SV  +WHPC+K
Sbjct  61   MLLGFISLLLTVGQDSISRICISKSVAETWHPCEK  95



>emb|CDY12904.1| BnaA09g13700D [Brassica napus]
Length=582

 Score =   121 bits (304),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  E+T++ T TWA+AVVCF L+  SI IE+L H LG W   K+KKAL+EAL+K+KA
Sbjct  1    MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S IC+ ES+  S HPC +
Sbjct  61   ELMLMGFISLLLTIGQNYISQICVSESIAASMHPCSE  97



>emb|CDY15021.1| BnaCnng04240D [Brassica napus]
Length=584

 Score =   121 bits (304),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  ERT++ T TWA+AVVCF L+ ISI IE+L H LG    RK+KKAL+EAL+K+KA
Sbjct  1    MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S ICI ES+  S  PC K
Sbjct  61   ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSK  97



>emb|CDY26348.1| BnaA03g60240D [Brassica napus]
Length=591

 Score =   121 bits (304),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  ERT++ T TWA+AVVCF L+ ISI IE+L H LG    RK+KKAL+EAL+K+KA
Sbjct  1    MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S ICI ES+  S  PC K
Sbjct  61   ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSK  97



>ref|XP_002526372.1| Protein MLO, putative [Ricinus communis]
 gb|EEF36043.1| Protein MLO, putative [Ricinus communis]
Length=594

 Score =   121 bits (303),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A+VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGGGRSLEETPTWAVAIVCFVLVLISIIIEYIIHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  +S ICIPESVG++WHPC
Sbjct  64   LLGFISLLLTVGQGVISKICIPESVGSTWHPC  95



>ref|XP_009113127.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=582

 Score =   121 bits (303),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  E+T++ T TWA+AVVCF L+  SI IE+L H LG W   K+KKAL+EAL+K+KA
Sbjct  1    MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S ICI ES+  S HPC +
Sbjct  61   ELMLMGFISLLLTIGQNYISQICISESIAASMHPCSE  97



>ref|XP_003539407.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=582

 Score =   121 bits (303),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            M GK  T++ TPTWA+AVVCF+L++ISI IE + H +G WL +KHK+AL EAL+KIK+EL
Sbjct  1    MGGK--TLQETPTWAVAVVCFVLLSISILIEHILHLIGKWLKKKHKRALCEALEKIKSEL  58

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  59   MLLGFISLLLTVGQGLISRICISEKVAGTFHPC  91



>gb|KHN25048.1| MLO-like protein 6 [Glycine soja]
Length=577

 Score =   121 bits (303),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            M GK  T++ TPTWA+AVVCF+L++ISI IE + H +G WL +KHK+AL EAL+KIK+EL
Sbjct  1    MGGK--TLQETPTWAVAVVCFVLLSISILIEHILHLIGKWLKKKHKRALCEALEKIKSEL  58

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ML+GFISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  59   MLLGFISLLLTVGQGLISRICISEKVAGTFHPC  91



>ref|XP_009124631.1| PREDICTED: MLO-like protein 6 [Brassica rapa]
Length=590

 Score =   121 bits (303),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  ERT++ T TWA+AVVCF L+ ISI IE+L H LG    RK+KKAL+EAL+K+KA
Sbjct  1    MADKVDERTLQQTSTWAVAVVCFFLLLISIVIEKLIHKLGTCFKRKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S ICI ES+  S  PC K
Sbjct  61   ELMLMGFISLLLTIGQNYISQICISESIAASMRPCSK  97



>ref|XP_009335054.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=597

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A   R++E TPTWA+AVVCF+LV ISI IE +   +  WL +KHK AL+EAL+KIK+ELM
Sbjct  4    ATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKSALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q P+SNICI + +GN+WHPC K
Sbjct  64   LLGFISLLLTVGQGPISNICISQKIGNTWHPCGK  97



>ref|XP_007218951.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
 gb|EMJ20150.1| hypothetical protein PRUPE_ppa003466mg [Prunus persica]
Length=572

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KER++E TPTWA+AVVCF+L+A+SI IE++ H +G WL  KHK+AL EAL+KIK+ELML+
Sbjct  6    KERSLEQTPTWAVAVVCFVLLAVSIFIERIIHLIGKWLTSKHKRALVEALEKIKSELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GF+SLLLT+ Q P+S+ICIP+S+G SWHPC K
Sbjct  66   GFLSLLLTVLQGPISDICIPKSIGASWHPCSK  97



>ref|XP_009347038.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=587

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE +   +  WL +KHK+AL+EAL+KIK+
Sbjct  1    MAGATSGRSLEQTPTWAVAVVCFVLVLISIIIEHIIELIAKWLKKKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI + +GN+WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGPISNICISQKIGNTWHPCGK  97



>emb|CDY57371.1| BnaCnng31840D [Brassica napus]
Length=446

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGK--ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MA K  E+T++ T TWA+AVVCF L+  SI IE+L H LG W   K+KKAL+EAL+K+KA
Sbjct  1    MADKVDEKTLQQTSTWAVAVVCFFLLLFSIVIEKLIHKLGTWFKIKNKKALYEALEKVKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGFISLLLTI Q+ +S IC+ ES+  S HPC +
Sbjct  61   ELMLMGFISLLLTIGQNYISQICVSESIAASMHPCSE  97



>ref|XP_002314276.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
 gb|EEE88231.1| hypothetical protein POPTR_0009s01710g [Populus trichocarpa]
Length=620

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV++SI IE + H +  WL +K KKAL+EAL+KIK+
Sbjct  1    MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKKALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q P+SNICI +  G +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQSPISNICISKKAGATWHPCNK  97



>ref|XP_004304413.1| PREDICTED: MLO-like protein 6 [Fragaria vesca subsp. vesca]
Length=573

 Score =   119 bits (299),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 64/94 (68%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            AGKER++E TPTWA+AVVCFILV +SI IE + H +G WL RK+K+AL+EAL+KIKAELM
Sbjct  4    AGKERSLEQTPTWAVAVVCFILVLVSIIIEYILHLIGKWLERKNKRALYEALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GF+SLLLT+ Q P+S+ICI +SVG +WHPC K
Sbjct  64   LLGFLSLLLTVGQGPISDICISKSVGATWHPCSK  97



>ref|XP_011013684.1| PREDICTED: MLO-like protein 12 [Populus euphratica]
Length=478

 Score =   118 bits (295),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A K R++E TPTWA+AVVCF++V ISI IE + H +G WL ++ K+AL+EAL+KIK+ELM
Sbjct  4    AVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLTKRRKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GF+SLLLTI Q P+S IC+P+SVG +WHPC K
Sbjct  64   LLGFMSLLLTIGQGPISEICVPKSVGATWHPCKK  97



>ref|XP_010476041.1| PREDICTED: MLO-like protein 2 isoform X3 [Camelina sativa]
Length=568

 Score =   119 bits (297),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T++ T TWA+AVVCF+L+ ISI IE+  H +G WL +K+KK L+EAL+K+KAELML+
Sbjct  3    KEQTLQFTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKNKKDLYEALEKVKAELMLL  62

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI Q P+S ICI + V ++ HPC
Sbjct  63   GFISLLLTIGQTPISKICISKHVVSTMHPC  92



>ref|XP_002322867.1| hypothetical protein POPTR_0016s08940g [Populus trichocarpa]
 gb|EEF04628.1| hypothetical protein POPTR_0016s08940g [Populus trichocarpa]
Length=488

 Score =   117 bits (294),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A K R++E TPTWA+AVVCF++V ISI IE + H +G WL ++ K+AL+EAL+KIK+ELM
Sbjct  4    AVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLKKRRKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GF+SLLLTI Q P+S IC+P+SVG +WHPC K
Sbjct  64   LLGFMSLLLTIGQGPISEICVPKSVGATWHPCKK  97



>ref|XP_002522497.1| Protein MLO, putative [Ricinus communis]
 gb|EEF39797.1| Protein MLO, putative [Ricinus communis]
Length=519

 Score =   117 bits (294),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            +ERT++ TPTWA+A VCFIL+ ISI IEQL H L  +  +K + +L +ALDKIK+ELML+
Sbjct  6    EERTLQTTPTWAVATVCFILIFISITIEQLLHLLAKYFNKKRRSSLIKALDKIKSELMLL  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT+ + P++NICIP + G ++ PC
Sbjct  66   GFISLLLTVSEKPIANICIPRTAGETFLPC  95



>ref|XP_007150221.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
 gb|ESW22215.1| hypothetical protein PHAVU_005G136800g [Phaseolus vulgaris]
Length=560

 Score =   118 bits (295),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R ++ TPTWA+AVVCF+L+++SI IE +F+ +G WL +KHK+AL+E+L+KIK+ELML+GF
Sbjct  7    RNLDETPTWAVAVVCFVLLSVSIIIEYIFNLIGKWLKQKHKRALYESLEKIKSELMLLGF  66

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ISLLLT+ Q  +S ICI E V  ++HPC
Sbjct  67   ISLLLTVGQGLISRICISEKVAGTFHPC  94



>ref|XP_009615189.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=504

 Score =   117 bits (293),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +3

Query  12   MAG----KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKI  179
            MAG    +E  +E TPTW +A+VC  +VAIS+ +E++ H+ G +LL+K++K L+EAL KI
Sbjct  1    MAGGGGDQETNLEFTPTWVVALVCTFIVAISLFVERIIHYAGKYLLKKNQKPLYEALQKI  60

Query  180  KAELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            K ELML+GFISLLLT+FQD +  ICIP+ + NSW PC K
Sbjct  61   KEELMLLGFISLLLTVFQDRMVKICIPKHLANSWLPCKK  99



>ref|XP_010476042.1| PREDICTED: MLO-like protein 2 isoform X4 [Camelina sativa]
Length=414

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+T++ T TWA+AVVCF+L+ ISI IE+  H +G WL +K+KK L+EAL+K+KAELML+
Sbjct  3    KEQTLQFTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKNKKDLYEALEKVKAELMLL  62

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GFISLLLTI Q P+S ICI + V ++ HPC 
Sbjct  63   GFISLLLTIGQTPISKICISKHVVSTMHPCS  93



>ref|XP_007015436.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
 gb|EOY33055.1| Seven transmembrane MLO family protein isoform 1 [Theobroma cacao]
Length=580

 Score =   118 bits (295),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+AVVCF+LV ISI IE + H +G WL +KHK+AL EAL+K+K+ELM
Sbjct  4    GGGGRSLEETPTWAVAVVCFVLVLISIIIEHIIHMIGKWLRKKHKRALFEALEKVKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+ Q  +S+ICI E VG++WHPC+K
Sbjct  64   LLGFISLLLTVGQGVISDICISEKVGSTWHPCNK  97



>ref|XP_009615188.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=508

 Score =   117 bits (293),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +3

Query  12   MAG----KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKI  179
            MAG    +E  +E TPTW +A+VC  +VAIS+ +E++ H+ G +LL+K++K L+EAL KI
Sbjct  1    MAGGGGDQETNLEFTPTWVVALVCTFIVAISLFVERIIHYAGKYLLKKNQKPLYEALQKI  60

Query  180  KAELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            K ELML+GFISLLLT+FQD +  ICIP+ + NSW PC K
Sbjct  61   KEELMLLGFISLLLTVFQDRMVKICIPKHLANSWLPCKK  99



>gb|KDP25722.1| hypothetical protein JCGZ_23943 [Jatropha curcas]
Length=548

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  9    LMAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAE  188
            +    ER +  TPTWA+AVVC +++A+SI IE +FH    W  + HK AL EAL+KIKAE
Sbjct  1    MATADERPLGDTPTWAVAVVCLVMIAVSIFIEHIFHLAEKWFKKMHKPALVEALEKIKAE  60

Query  189  LMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMLMG ISLLLT  Q+P+S ICI +SV +SWHPC
Sbjct  61   LMLMGLISLLLTALQEPISKICISKSVASSWHPC  94



>ref|XP_007009792.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY18602.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=574

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            + K R++E TPTWA+AVVCF+LV ISI IE   H +G WL +KHK AL+EAL+K+KAELM
Sbjct  5    SNKARSLEYTPTWAVAVVCFVLVVISIIIEHAIHMVGKWLKKKHKPALYEALEKVKAELM  64

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            LMGFISLLLT+ Q  +S  CIPES+ N+WHPC K
Sbjct  65   LMGFISLLLTVAQGTISGFCIPESIANTWHPCGK  98



>gb|KFK40693.1| hypothetical protein AALP_AA2G029100 [Arabis alpina]
Length=594

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            E T++ T TW +AVVCF L+ ISI IE+L H LG W   K+KKA++EAL+KIKAELMLMG
Sbjct  7    EATLQETSTWPVAVVCFFLLLISIVIEKLIHKLGTWFKNKNKKAMYEALEKIKAELMLMG  66

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            F+SLLLTI QD +S ICI + +  S HPC
Sbjct  67   FLSLLLTIGQDYISQICISKGIAASMHPC  95



>ref|XP_010032207.1| PREDICTED: MLO-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW51610.1| hypothetical protein EUGRSUZ_J01100 [Eucalyptus grandis]
Length=545

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+A+VCF+++AISI +E   H    +L RK + AL EAL+K+K+ELML+
Sbjct  7    KERTLEYTATWAVAIVCFVILAISILLEHAIHLFEKFLKRKRRVALVEALEKVKSELMLL  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ Q P+SNIC+P  + +SW PC +
Sbjct  67   GFISLLLTVLQGPISNICVPRRIASSWLPCKE  98



>ref|XP_010032208.1| PREDICTED: MLO-like protein 2 isoform X2 [Eucalyptus grandis]
Length=534

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KERT+E T TWA+A+VCF+++AISI +E   H    +L RK + AL EAL+K+K+ELML+
Sbjct  7    KERTLEYTATWAVAIVCFVILAISILLEHAIHLFEKFLKRKRRVALVEALEKVKSELMLL  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ Q P+SNIC+P  + +SW PC +
Sbjct  67   GFISLLLTVLQGPISNICVPRRIASSWLPCKE  98



>ref|XP_010046751.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
Length=569

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  30   TMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFI  209
            ++E TPTWA+AVVCF+LV ISI IE + H +G WL ++HKKAL+EAL+KIK+ELML+GFI
Sbjct  9    SLEQTPTWAVAVVCFVLVLISIIIEYIIHLIGKWLTKRHKKALYEALEKIKSELMLLGFI  68

Query  210  SLLLTIFQDPVSNICIPESVGNSWHPC  290
            SL+LT+ Q P+S ICI ES+G++WHPC
Sbjct  69   SLMLTVGQGPISGICISESLGSTWHPC  95



>ref|XP_011044384.1| PREDICTED: MLO-like protein 6 isoform X1 [Populus euphratica]
Length=560

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV++SI IE + H +  WL +K K+AL+EAL+KIK+
Sbjct  1    MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +SNICI +  G +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQSTISNICISKKAGATWHPCNK  97



>ref|XP_008463924.1| PREDICTED: MLO-like protein 6 isoform X1 [Cucumis melo]
Length=592

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  ++N+CIP  V  +WHPC
Sbjct  64   LLGFISLLLTVGQSLITNVCIPPDVAATWHPC  95



>ref|XP_010492678.1| PREDICTED: MLO-like protein 2 [Camelina sativa]
Length=568

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            KE+ ++ T TWA+AVVCF+L+ ISI IE+  H +G WL +KHKK L EAL+K+KAELML+
Sbjct  9    KEQNLQHTSTWAVAVVCFVLLFISIVIEKSIHRIGTWLKKKHKKDLFEALEKVKAELMLL  68

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GFISLLLTI Q P+S ICI + V ++ HPC 
Sbjct  69   GFISLLLTIGQTPISKICISKHVASTMHPCS  99



>ref|XP_004149543.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
Length=415

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLLT+ Q  ++N+CIP  V  +WHPC 
Sbjct  64   LLGFISLLLTVGQSLITNVCIPPDVAATWHPCS  96



>ref|XP_004163384.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
Length=593

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  ++N+CIP  V  +WHPC
Sbjct  64   LLGFISLLLTVGQSLITNVCIPPDVAATWHPC  95



>gb|KGN47314.1| hypothetical protein Csa_6G292430 [Cucumis sativus]
Length=593

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            L+GFISLLLT+ Q  ++N+CIP  V  +WHPC
Sbjct  64   LLGFISLLLTVGQSLITNVCIPPDVAATWHPC  95



>ref|XP_008463927.1| PREDICTED: MLO-like protein 6 isoform X2 [Cucumis melo]
Length=416

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R++E TPTWA+A VCF+LV ISI IE + H +G WL +KHK+AL+EAL+KIK+ELM
Sbjct  4    GGAGRSLEETPTWAVAAVCFVLVLISIIIEHILHLIGKWLKKKHKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLLT+ Q  ++N+CIP  V  +WHPC 
Sbjct  64   LLGFISLLLTVGQSLITNVCIPPDVAATWHPCS  96



>ref|XP_010032020.1| PREDICTED: MLO-like protein 6 [Eucalyptus grandis]
 gb|KCW51405.1| hypothetical protein EUGRSUZ_J00942 [Eucalyptus grandis]
Length=583

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 60/97 (62%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV +SI IE + H +G WL +KHK AL+EAL+KIK+
Sbjct  1    MAGDSGGRSLEQTPTWAVAVVCFVLVLVSIIIEHIIHLIGQWLKKKHKTALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +SNICI   V  +WHPC K
Sbjct  61   ELMLLGFISLLLTVGQGLISNICISSEVAATWHPCGK  97



>ref|XP_007211843.1| hypothetical protein PRUPE_ppa004687mg [Prunus persica]
 gb|EMJ13042.1| hypothetical protein PRUPE_ppa004687mg [Prunus persica]
Length=496

 Score =   115 bits (289),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 3/96 (3%)
 Frame = +3

Query  12   MAGKERT---MEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIK  182
            MAG E T   +EATPTWA+A V F+L+ ISI IE L H L  +  R  +K+L +ALDKIK
Sbjct  1    MAGDEETANTLEATPTWAVATVVFVLIVISIIIEYLLHLLHKYFHRLKRKSLIQALDKIK  60

Query  183  AELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +ELML+GFISLLLT+ Q P++NICIP+SVG S+ PC
Sbjct  61   SELMLLGFISLLLTVGQKPIANICIPKSVGESFLPC  96



>ref|XP_011044385.1| PREDICTED: MLO-like protein 6 isoform X2 [Populus euphratica]
Length=611

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV++SI IE + H +  WL +K K+AL+EAL+KIK+
Sbjct  1    MAGGSAGRSLEQTPTWAVAVVCFVLVSVSIIIEFIIHLIAKWLTKKRKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GFISLLLT+ Q  +SNICI +  G +WHPC+K
Sbjct  61   ELMLLGFISLLLTVGQSTISNICISKKAGATWHPCNK  97



>gb|KCW88826.1| hypothetical protein EUGRSUZ_A01164 [Eucalyptus grandis]
Length=590

 Score =   116 bits (291),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  30   TMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFI  209
            ++E TPTWA+AVVCF+LV ISI IE + H +G WL ++HKKAL+EAL+KIK+ELML+GFI
Sbjct  9    SLEQTPTWAVAVVCFVLVLISIIIEYIIHLIGKWLTKRHKKALYEALEKIKSELMLLGFI  68

Query  210  SLLLTIFQDPVSNICIPESVGNSWHPC  290
            SL+LT+ Q P+S ICI ES+G++WHPC
Sbjct  69   SLMLTVGQGPISGICISESLGSTWHPC  95



>ref|XP_008467033.1| PREDICTED: MLO-like protein 1 [Cucumis melo]
Length=185

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  30   TMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFI  209
            T+E TPTW +A VC ++VAIS+A+E+L H LG +L  K++K L+EAL K+K ELML+GFI
Sbjct  9    TLEFTPTWVVAAVCTVIVAISLALERLLHFLGRYLKSKNQKPLNEALQKVKEELMLLGFI  68

Query  210  SLLLTIFQDPVSNICIPESVGNSWHPCD  293
            SLLLT+FQ  +S +C+PES+     PCD
Sbjct  69   SLLLTVFQGTISKLCVPESLTEHLLPCD  96



>ref|XP_008225160.1| PREDICTED: MLO-like protein 12 [Prunus mume]
Length=496

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 3/96 (3%)
 Frame = +3

Query  12   MAGKERT---MEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIK  182
            MAG E T   +EATPTWA+A V F+L+ ISI IE L H L  +  R  +K+L +ALDKIK
Sbjct  1    MAGGEETANTLEATPTWAVATVVFVLIVISIIIEYLLHLLHKYFHRLKRKSLIQALDKIK  60

Query  183  AELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +ELML+GFISLLLT+ Q P++NICIP+SVG S+ PC
Sbjct  61   SELMLLGFISLLLTVGQKPIANICIPKSVGESFLPC  96



>ref|XP_007216411.1| hypothetical protein PRUPE_ppa022716mg [Prunus persica]
 gb|EMJ17610.1| hypothetical protein PRUPE_ppa022716mg [Prunus persica]
Length=201

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A  ER+++ TPTWA+A+ C + + ISI IEQ  H LG W  +++KKA+ EAL+KIKAELM
Sbjct  5    AAGERSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIKAELM  64

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            L+GFISLLLT+    +  ICIPE  GN+  PC+
Sbjct  65   LLGFISLLLTVGTRYLPKICIPEKYGNTMLPCE  97



>gb|KJB73619.1| hypothetical protein B456_011G240700 [Gossypium raimondii]
Length=576

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K R++E TPTWA+AVVCF+LV ISI IE   H +G W  ++HK +L+EAL+KIKAELMLM
Sbjct  6    KARSLEETPTWAVAVVCFVLVVISIFIEHAIHIVGKWFKKRHKTSLYEALEKIKAELMLM  65

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            GFISLLLT+FQ P+S ICIP  V N+WHPC+
Sbjct  66   GFISLLLTVFQGPISEICIPAHVANTWHPCN  96



>emb|CAN60901.1| hypothetical protein VITISV_029546 [Vitis vinifera]
Length=361

 Score =   114 bits (284),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H  G WL +KHK+AL+EAL+K+K+
Sbjct  1    MAGATGGRSLEQTPTWAVAVVCFVLVLISIIIEYIIHLTGKWLKKKHKRALYEALEKVKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q  +S ICI +SV  +WHPC
Sbjct  61   ELMLLGFISLLLTVGQGLISTICISKSVAATWHPC  95



>gb|KDO49757.1| hypothetical protein CISIN_1g0113631mg, partial [Citrus sinensis]
Length=139

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA    T+E TPTW +A+VC ++V IS+A+E+  H++G  L + ++K L EAL KIK EL
Sbjct  1    MAEGGTTLEYTPTWVVALVCSVIVIISLAVERFLHYIGKVLKKNNQKPLFEALQKIKEEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLLT+FQ  ++ ICI E + + W PCDK
Sbjct  61   MLLGFISLLLTVFQGMIAKICISEELASKWLPCDK  95



>ref|XP_009333712.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=559

 Score =   115 bits (288),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KERT+E TPTWA+AVVCF+L+A+SI IE   H +G WL RK K+AL EAL+KIK+ELML
Sbjct  5    AKERTLEETPTWAVAVVCFVLLAVSIFIEHTIHLIGKWLARKDKRALVEALEKIKSELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GF+SLLLT+ Q+P+S+ICI +S+G +WHPC
Sbjct  65   LGFLSLLLTVLQEPISDICISKSIGATWHPC  95



>ref|XP_008806842.1| PREDICTED: MLO-like protein 6 [Phoenix dactylifera]
Length=611

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R +E T TWA+A++C +LV ISIAIE   H    WL + HKKALHEAL+K+K+ELML+GF
Sbjct  8    RNLEETSTWAVAMICAVLVVISIAIEHGIHLASKWLKKHHKKALHEALEKVKSELMLLGF  67

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +SLLLT+ Q  ++++C+P+SV +SWHPC
Sbjct  68   VSLLLTVGQGTITDLCVPKSVAHSWHPC  95



>ref|XP_006377424.1| hypothetical protein POPTR_0011s05790g [Populus trichocarpa]
 gb|ERP55221.1| hypothetical protein POPTR_0011s05790g [Populus trichocarpa]
Length=516

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
            G+ +++E TPTWA+A VCF L+ ISI IEQL H L  +  +K +K L +AL KIK ELML
Sbjct  5    GEAKSLEETPTWAVATVCFFLILISIFIEQLLHLLAKYFNKKRRKYLIQALYKIKTELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GFISLLLT+ + PV+NICIP+S G ++ PC
Sbjct  65   LGFISLLLTVLEKPVANICIPKSAGETFLPC  95



>ref|XP_011004622.1| PREDICTED: MLO-like protein 6 [Populus euphratica]
Length=478

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 58/94 (62%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A K R++E TPTWA+AVVCF++V ISI IE + H +G WL ++ K+AL+EAL+KIK+ELM
Sbjct  4    AVKARSLEETPTWAVAVVCFVMVLISIIIEHIIHLIGKWLTKRRKRALYEALEKIKSELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GF+SLLLTI Q  +S IC+P+SVG +WHPC K
Sbjct  64   LLGFMSLLLTIGQGLISEICVPKSVGATWHPCKK  97



>gb|KJB74724.1| hypothetical protein B456_012G004100 [Gossypium raimondii]
Length=578

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            K R++E TPTWA+AVVC  LV ISI IE   H LG W  ++HK AL+EAL+K+KAELMLM
Sbjct  7    KTRSLEETPTWAVAVVCLALVVISIIIELAIHMLGKWFKKRHKTALYEALEKVKAELMLM  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT+ Q  +S+ICIP S+ N+WHPCD+
Sbjct  67   GFISLLLTVTQSLISDICIPRSIANTWHPCDQ  98



>gb|KCW44918.1| hypothetical protein EUGRSUZ_L01503, partial [Eucalyptus grandis]
Length=137

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  K  T+E TPTW +AVVC ++V IS+A+E+  H+ G +L ++++K L +AL KIK 
Sbjct  1    MAGGAKGPTLEFTPTWVLAVVCTVIVVISLAVERFLHYAGKYLKKRNQKPLFDALQKIKE  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLL +FQ+ + NICI E + + W PC
Sbjct  61   ELMLLGFISLLLAVFQERIDNICISEELADKWLPC  95



>gb|EPS67078.1| hypothetical protein M569_07698, partial [Genlisea aurea]
Length=296

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R +E T TWA+A VC I++ IS+A+E+  H LG W+  +HKKALHEALDKIK ELM++GF
Sbjct  1    RNLEQTSTWAVAGVCAIIILISLALEKGLHKLGEWMTERHKKALHEALDKIKDELMILGF  60

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ISL+L   Q  +++ICIPESVGN+  PC 
Sbjct  61   ISLILVFSQYYIASICIPESVGNTMLPCS  89



>gb|EYU22368.1| hypothetical protein MIMGU_mgv1a0228201mg, partial [Erythranthe 
guttata]
Length=162

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 3/97 (3%)
 Frame = +3

Query  12   MAGKER---TMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIK  182
            MAG        E TPTW +A+VC I+VAIS+ +E+  H+ G + ++K++ +L++AL KIK
Sbjct  1    MAGGSTEGAAFEYTPTWIVALVCTIIVAISLFVERFLHYAGKYFIKKNQASLYQALQKIK  60

Query  183  AELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
             ELML+GFISLLLT+ QD +S ICIP+ V N W PC+
Sbjct  61   EELMLLGFISLLLTVLQDSISKICIPKGVMNHWLPCN  97



>ref|XP_007018107.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY15332.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=557

 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  9    LMAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAE  188
            + A K R++E TPTWA+A VC I V ISI +E   H LG W   + KKA+ EAL+KIKAE
Sbjct  1    MAATKGRSLEETPTWAVAAVCAIFVIISILLEHGIHSLGKWFQGRQKKAMMEALEKIKAE  60

Query  189  LMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMLMGFISLLLT+    +  ICIPE +GNS  PC
Sbjct  61   LMLMGFISLLLTVGTYYIPEICIPEKIGNSMLPC  94



>ref|XP_002282216.1| PREDICTED: MLO-like protein 6 [Vitis vinifera]
Length=587

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H  G WL +KHK+AL+EAL+K+K+
Sbjct  1    MAGATGGRSLEQTPTWAVAVVCFVLVLISIIIEYIIHLTGKWLKKKHKRALYEALEKVKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q  +S ICI +SV  +WHPC
Sbjct  61   ELMLLGFISLLLTVGQGLISTICISKSVAATWHPC  95



>ref|XP_006307459.1| hypothetical protein CARUB_v10009086mg [Capsella rubella]
 gb|EOA40357.1| hypothetical protein CARUB_v10009086mg [Capsella rubella]
Length=458

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            + T+E T TW +AVVCF+L+ ISIA+E L H LG W  +KHK  L EAL+K+KAELML+G
Sbjct  3    DATLEETSTWTVAVVCFVLLLISIALEHLLHTLGTWFKKKHKSDLFEALEKVKAELMLLG  62

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            FISLLLTI Q P+S+ICI + + +   PC
Sbjct  63   FISLLLTIAQAPISHICISKKLASIMQPC  91



>ref|XP_009342698.1| PREDICTED: MLO-like protein 6 isoform X2 [Pyrus x bretschneideri]
Length=566

 Score =   114 bits (284),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  K R++E TPTWA+AVVCF+LV ISI IE   H +G WL R++K+AL+EAL+KIK+
Sbjct  1    MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKRRNKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+SNICI ++VG++WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISNICISKAVGSTWHPCSK  97



>emb|CBI16290.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   114 bits (286),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R++E TPTWA+AVVCF+LV ISI IE + H  G WL +KHK+AL+EAL+K+K+
Sbjct  1    MAGATGGRSLEQTPTWAVAVVCFVLVLISIIIEYIIHLTGKWLKKKHKRALYEALEKVKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q  +S ICI +SV  +WHPC
Sbjct  61   ELMLLGFISLLLTVGQGLISTICISKSVAATWHPC  95



>ref|XP_010033601.1| PREDICTED: MLO-like protein 8 [Eucalyptus grandis]
 gb|KCW53294.1| hypothetical protein EUGRSUZ_J02551 [Eucalyptus grandis]
Length=556

 Score =   113 bits (283),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            + R ++ TPTWA+A VC I++ ISIA+E+L H +G WL ++HK AL+EAL+KIK ELM++
Sbjct  9    QSRELDQTPTWAVAGVCAIIIMISIALEKLLHKVGTWLTQRHKNALYEALEKIKNELMIL  68

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT  Q  ++ ICIP SV  +  PC K
Sbjct  69   GFISLLLTFGQSYIAKICIPTSVAETMLPCTK  100



>ref|XP_009342695.1| PREDICTED: MLO-like protein 6 isoform X1 [Pyrus x bretschneideri]
Length=578

 Score =   113 bits (283),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  K R++E TPTWA+AVVCF+LV ISI IE   H +G WL R++K+AL+EAL+KIK+
Sbjct  1    MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKRRNKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+SNICI ++VG++WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISNICISKAVGSTWHPCSK  97



>ref|XP_009757992.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=505

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +3

Query  12   MAG----KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKI  179
            MAG    +E  +E TPTW +A+VC  +VAIS+ +E++ H+ G +LL+K++K L+EAL KI
Sbjct  1    MAGGGGDQETNLEFTPTWIVALVCTFIVAISLVVERIIHYAGKYLLKKNQKPLYEALQKI  60

Query  180  KAELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            K ELML+GFISLLLT+FQ+ +  ICIP+ + N+W PC K
Sbjct  61   KEELMLLGFISLLLTVFQERMLKICIPKHLSNTWLPCKK  99



>ref|NP_001284458.1| MLO-like protein 12 [Cucumis melo]
 gb|ACX55084.1| Mlo1 [Cucumis melo]
Length=570

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            ++RT+E T TWA+AVVCF LV ISI IE + H  G WL +KHK AL EAL+K+KAELML+
Sbjct  7    EQRTLEDTSTWAVAVVCFFLVVISIFIEHVIHLTGKWLEKKHKPALVEALEKVKAELMLL  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT+ QD V+ IC+ + +  +W PC
Sbjct  67   GFISLLLTVGQDAVTQICVSKELAATWLPC  96



>gb|KJB67707.1| hypothetical protein B456_010G205000 [Gossypium raimondii]
Length=568

 Score =   113 bits (282),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R++E TPTWA+AVVC ++V +SI IE   H LG WL +K+K AL+EALDK+K ELMLMGF
Sbjct  19   RSLEETPTWAVAVVCLVIVVVSIFIEHGIHMLGKWLKKKNKPALYEALDKVKIELMLMGF  78

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            IS LLT+F+D +++ICI +SV ++WHPCDK
Sbjct  79   ISFLLTVFKDSIADICISKSVADTWHPCDK  108



>ref|XP_002533335.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis]
Length=507

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA    T+E TPTW +A+VC ++V IS+A+E+L H+LG  L RK +K L EAL KIK EL
Sbjct  5    MAEGGTTLEYTPTWVVALVCSVIVVISLAVERLLHYLGKLLKRKQQKPLFEALQKIKEEL  64

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ML+GFISLLLT+FQ  +++ICIPE +   W PC +
Sbjct  65   MLLGFISLLLTVFQGRINSICIPEEMSKKWLPCKE  99



>ref|XP_008243901.1| PREDICTED: MLO-like protein 6 [Prunus mume]
Length=579

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  GKE R++E TPTWA+A+VCF+LV ISI IE + H +G WL RKHK+AL+EAL+KIK+
Sbjct  1    MAGGKEGRSLEETPTWAVAIVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+S+ICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSK  97



>gb|AGV68800.1| MLO3 [Prunus armeniaca]
Length=574

 Score =   113 bits (282),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  GKE R++E TPTWA+A+VCF+LV ISI IE + H +G WL RKHK+AL+EAL+KIK+
Sbjct  1    MAGGKEGRSLEETPTWAVALVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+S+ICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSK  97



>gb|KHN17123.1| MLO-like protein 6 [Glycine soja]
Length=563

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  33   MEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGFIS  212
            +EATPTWA+AVVCF+++AISI IE +   LG WL +KHKKALHEAL+K+K ELML+GFIS
Sbjct  9    LEATPTWAVAVVCFVMLAISILIEHILEELGKWLKKKHKKALHEALEKVKGELMLLGFIS  68

Query  213  LLLTIFQDPVSNICIPESVGNSWHPCD  293
            LLL +FQD +SNICIP+SV ++WHPCD
Sbjct  69   LLLVMFQDHISNICIPKSVASTWHPCD  95



>ref|XP_008798739.1| PREDICTED: MLO-like protein 13 [Phoenix dactylifera]
Length=529

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            A  E T+E TPTW +A VC +++ IS+A+E+L H+LG +L  K + AL EAL K+K ELM
Sbjct  18   ASPEGTLEYTPTWVLAAVCSVIIVISLAVERLLHYLGKFLKHKRQDALFEALQKVKEELM  77

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            L+GFISLLLT+FQ  +SNICIPESV     PC K
Sbjct  78   LLGFISLLLTVFQGSISNICIPESVSTHMLPCKK  111



>ref|XP_009378090.1| PREDICTED: MLO-like protein 6 [Pyrus x bretschneideri]
Length=569

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  18   GKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELML  197
             KER++E TPTWA+AVVCF+L+A+SI IE++ H +G WL RKHK+AL EAL+KIK+ELML
Sbjct  5    AKERSLEETPTWAVAVVCFVLLAVSIVIERMIHLIGKWLARKHKRALVEALEKIKSELML  64

Query  198  MGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +GF+SLLLT+ Q  +S+ICI +SVG +WHPC
Sbjct  65   LGFLSLLLTVLQGTISDICISQSVGATWHPC  95



>ref|XP_004142393.1| PREDICTED: MLO-like protein 6-like [Cucumis sativus]
 gb|KGN52283.1| hypothetical protein Csa_5G623470 [Cucumis sativus]
Length=574

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            ++RT+E T TWA+AVVCF LV ISI IE + H  G WL ++HK AL EAL+K+KAELML+
Sbjct  7    EQRTLEDTSTWAVAVVCFFLVVISIFIEHVIHLTGKWLEKRHKPALVEALEKVKAELMLL  66

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLTI QD V+ IC+ + +  +W PC
Sbjct  67   GFISLLLTIGQDAVTQICVSKELAATWLPC  96



>gb|KCW56485.1| hypothetical protein EUGRSUZ_I02212 [Eucalyptus grandis]
Length=569

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            + R +  TPTWA+A+VC   + IS+ +E+L H +G WL  +HK+AL+EALDK+K+ELM++
Sbjct  10   QTRELTQTPTWAVAIVCAAFIFISLVLEKLLHKIGTWLTERHKRALYEALDKVKSELMIL  69

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT  Q  VS+IC+P+ V ++  PC K
Sbjct  70   GFISLLLTFGQSYVSSICVPQKVADTMLPCRK  101



>ref|XP_010029568.1| PREDICTED: MLO-like protein 10 [Eucalyptus grandis]
Length=570

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            + R +  TPTWA+A+VC   + IS+ +E+L H +G WL  +HK+AL+EALDK+K+ELM++
Sbjct  10   QTRELTQTPTWAVAIVCAAFIFISLVLEKLLHKIGTWLTERHKRALYEALDKVKSELMIL  69

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            GFISLLLT  Q  VS+IC+P+ V ++  PC K
Sbjct  70   GFISLLLTFGQSYVSSICVPQKVADTMLPCRK  101



>ref|XP_007208289.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
 gb|EMJ09488.1| hypothetical protein PRUPE_ppa003437mg [Prunus persica]
Length=574

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  GKE R++E TPTWA+A+VCF+LV ISI IE + H +G WL RKHK+AL+EAL+KIK+
Sbjct  1    MAGGKEGRSLEETPTWAVALVCFVLVLISILIEYVIHLIGKWLTRKHKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+S+ICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISDICISKAVGATWHPCSK  97



>ref|XP_008387612.1| PREDICTED: MLO-like protein 6 isoform X2 [Malus domestica]
Length=415

 Score =   110 bits (276),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAG--KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  K R++E TPTWA+AVVCF+LV ISI IE   H +G WL +++K+AL+EAL+KIK+
Sbjct  1    MAGGKKGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIGKWLKKRNKRALYEALEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+SNICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSK  97



>ref|XP_009619517.1| PREDICTED: MLO-like protein 8 [Nicotiana tomentosiformis]
Length=555

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R ++ TPTWA+A VC +++ ISIA+E++ H LG WL  +HKKAL+EAL+K+KAELM
Sbjct  6    GGTSRQLDQTPTWAVAGVCAVIIIISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDKI  299
            ++GFISL L   Q  ++ ICIP SV ++  PC  I
Sbjct  66   ILGFISLTLVFSQYYIAGICIPSSVADTMLPCPAI  100



>ref|XP_010111165.1| MLO-like protein 6 [Morus notabilis]
 gb|EXC30556.1| MLO-like protein 6 [Morus notabilis]
Length=526

 Score =   112 bits (279),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 3/96 (3%)
 Frame = +3

Query  12   MAGK---ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIK  182
            MAG+   ERT+E T TWA+A VC IL+ +SI+IE L H L  +  +K +++L +ALDKIK
Sbjct  1    MAGENVLERTLETTSTWAVATVCLILILVSISIEHLLHLLAKYFKKKRRRSLIQALDKIK  60

Query  183  AELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            +EL+L+GFISLLLT+ +  ++NICIP+SVG ++ PC
Sbjct  61   SELILLGFISLLLTVSEKSIANICIPKSVGETFLPC  96



>ref|XP_004146181.1| PREDICTED: MLO-like protein 8-like [Cucumis sativus]
 gb|KGN55592.1| hypothetical protein Csa_3G000160 [Cucumis sativus]
Length=569

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
             R ++ TPTWA+A VCF  V ISI +E + H LG WL +KHK +L+EAL+K+KAELM++G
Sbjct  26   SRDLDNTPTWAVAAVCFFFVLISIVLENVIHKLGTWLTKKHKSSLYEALEKVKAELMILG  85

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            FISLLLT  Q  +  ICIP ++ NS  PC +
Sbjct  86   FISLLLTFAQAYIVQICIPPAIANSMLPCRR  116



>ref|XP_008369779.1| PREDICTED: MLO-like protein 6 isoform X2 [Malus domestica]
Length=579

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  GKE R++E TPTWA+AVVCF+LV ISI IE   H +  WL +++KKAL+EAL+KIKA
Sbjct  1    MAGGKEGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIAKWLTKRNKKALYEALEKIKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+SNICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSK  97



>ref|XP_006375949.1| hypothetical protein POPTR_0013s06670g, partial [Populus trichocarpa]
 gb|ERP53746.1| hypothetical protein POPTR_0013s06670g, partial [Populus trichocarpa]
Length=183

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  G E  T+E TPTW +A +C ++VA+S+A E+L H+ G++L RK++K L+EAL K+K 
Sbjct  1    MSGGSEGETLEYTPTWVVAALCTVIVALSLAAERLLHYCGIFLRRKNQKPLYEALQKVKE  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ Q+ ++  C+PE+V N   PC
Sbjct  61   ELMLLGFISLLLTVSQNSIAKTCVPENVVNDLLPC  95



>ref|XP_008369778.1| PREDICTED: MLO-like protein 6 isoform X1 [Malus domestica]
Length=587

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  9    LMAGKE-RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            +  GKE R++E TPTWA+AVVCF+LV ISI IE   H +  WL +++KKAL+EAL+KIKA
Sbjct  1    MAGGKEGRSLEQTPTWAVAVVCFVLVLISILIEYFIHLIAKWLTKRNKKALYEALEKIKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELML+GF+SLLLT+ Q P+SNICI ++VG +WHPC K
Sbjct  61   ELMLLGFLSLLLTVGQGPISNICISKAVGATWHPCSK  97



>ref|XP_003548913.1| PREDICTED: MLO-like protein 12-like [Glycine max]
Length=576

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/89 (61%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+++SI IE + H +G W  +KHK AL EAL+K+K ELML+G
Sbjct  9    ERTLEETPTWAVAVVCFVLLSVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELMLLG  68

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            F+SLLLT+ QDP+S IC+ ++V ++WHPC
Sbjct  69   FLSLLLTVLQDPISKICVSKNVASTWHPC  97



>gb|KHN13370.1| MLO-like protein 12 [Glycine soja]
Length=563

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/89 (61%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+++SI IE + H +G W  +KHK AL EAL+K+K ELML+G
Sbjct  9    ERTLEETPTWAVAVVCFVLLSVSIVIEHIIHGIGKWFKKKHKNALFEALEKVKGELMLLG  68

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPC  290
            F+SLLLT+ QDP+S IC+ ++V ++WHPC
Sbjct  69   FLSLLLTVLQDPISKICVSKNVASTWHPC  97



>ref|XP_002310696.2| hypothetical protein POPTR_0007s08570g [Populus trichocarpa]
 gb|EEE91146.2| hypothetical protein POPTR_0007s08570g [Populus trichocarpa]
Length=546

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/91 (55%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ER+++ TP+WA A+VC + V ISI IE+  H L  W  ++ KKA+ EAL+K+KAELML+G
Sbjct  8    ERSLKETPSWAAALVCAVFVVISIVIERGIHSLEKWFQKRQKKAMIEALEKLKAELMLLG  67

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            FISLL+T+   P+S ICIPE  GN+  PC K
Sbjct  68   FISLLITVGTKPISKICIPEKAGNTMLPCKK  98



>ref|XP_010917470.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 6 [Elaeis guineensis]
Length=614

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +3

Query  27   RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMGF  206
            R +E TPTWA+A +C +LV ISI IE   +    WL + HKKAL EA +K+K+ELML+GF
Sbjct  8    RNLEETPTWAVATICAVLVVISIIIEHGIYLSSKWLEKHHKKALREAFEKVKSELMLLGF  67

Query  207  ISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            +SLLLT+ Q  ++ IC+P+SV +SWHPC +
Sbjct  68   MSLLLTVGQGIITEICVPKSVADSWHPCKE  97



>ref|XP_011027760.1| PREDICTED: MLO-like protein 12 [Populus euphratica]
Length=456

 Score =   110 bits (275),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA + +T+E TPTWA+A VCF L+ ISI IE L H L  +  +K +K L +AL KIK EL
Sbjct  1    MAVEAKTLEETPTWAVATVCFFLILISIFIEYLLHLLAKYFNKKRRKYLIQALYKIKTEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDKI  299
            ML+GFISLL+T+ + PV+ ICIP+SVG ++ PC  +
Sbjct  61   MLLGFISLLMTVLEKPVAKICIPKSVGETFLPCGSV  96



>gb|EMT06541.1| MLO protein-1-like protein [Aegilops tauschii]
Length=713

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R +  TPTWA+A+VC +++ +S+A+E   H+LG W  ++HKKA+ EAL+K+KA
Sbjct  1    MAGPAGGRELPDTPTWAVALVCAVMILVSVAMEHALHNLGHWFHKRHKKAMAEALEKMKA  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            ELML+GFISLLLT+ QDP+S ICI    G+   PC
Sbjct  61   ELMLVGFISLLLTVAQDPISKICISVEAGSRMLPC  95



>ref|XP_008385934.1| PREDICTED: MLO-like protein 3 [Malus domestica]
Length=112

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  12   MAGKER--TMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG  +  ++E TPTWA+A VCFI +  S+AIE   H L  +L R+ K AL +A++K+K+
Sbjct  1    MAGDSKGASLEYTPTWALATVCFIFIFTSLAIEHSIHLLVNFLKRQRKTALTDAVEKLKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            ELMLMGF+SLLL I QD +S ICIP ++GN   PC +
Sbjct  61   ELMLMGFVSLLLAITQDSISKICIPANLGNIMLPCRR  97



>ref|XP_008448445.1| PREDICTED: MLO-like protein 10 isoform X1 [Cucumis melo]
Length=572

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +3

Query  21   KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLM  200
            + R ++ TPTWA+A VCF  V ISI +E + H LG WL  K K +L+EAL+K+KAELM++
Sbjct  25   QSRDLDNTPTWAVAAVCFFFVLISIVLENVLHKLGTWLTEKRKSSLYEALEKVKAELMIL  84

Query  201  GFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            GFISLLLT  Q  +  ICIP S+ NS  PC
Sbjct  85   GFISLLLTFAQAYIVQICIPPSIANSMLPC  114



>ref|XP_006351085.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=504

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/99 (53%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = +3

Query  12   MAG----KERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKI  179
            MAG    +E  +E TPTW +A+VC ++VAIS+ +E++ H+ G +LL+K++K L+EAL KI
Sbjct  1    MAGGGGDQETNLEFTPTWIVALVCTVIVAISLLVERIIHYGGKYLLKKNQKPLYEALQKI  60

Query  180  KAELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCDK  296
            K ELML+GFISLLLT+ Q+ +  ICIP+ + N W PC K
Sbjct  61   KEELMLLGFISLLLTVLQERILKICIPKHLTNQWLPCKK  99



>tpg|DAA43122.1| TPA: hypothetical protein ZEAMMB73_618430 [Zea mays]
Length=252

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R + +TPTWA+A+VC ++V +S+A+E   H LG W   + KKA+ EAL+KIKAELM
Sbjct  4    GGGGRDLPSTPTWAVALVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKIKAELM  63

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMGFISLLL + Q P+S ICIP   G+   PC
Sbjct  64   LMGFISLLLAVGQTPISKICIPAKAGSIMLPC  95



>ref|XP_003538050.1| PREDICTED: MLO-like protein 6-like [Glycine max]
Length=576

 Score =   111 bits (278),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  12   MAGKE--RTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKA  185
            MAG    R +E TPTWA++ VCF+L+ ISI IE + H +G WL +KHK AL+E+L+KIK+
Sbjct  1    MAGGSGGRNLEETPTWAVSAVCFVLILISIIIEHIIHLIGKWLKKKHKTALYESLEKIKS  60

Query  186  ELMLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ELML+GFISLLLT+ Q P+S ICI E V  +WHPCD
Sbjct  61   ELMLLGFISLLLTVGQGPISRICISEKVAGTWHPCD  96



>gb|KJB34883.1| hypothetical protein B456_006G088500 [Gossypium raimondii]
Length=437

 Score =   110 bits (274),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA    T+E+TPTWA+AVV F+L++ISI IE L H L  +  +  +K L +ALDKIK+EL
Sbjct  1    MASSVITLESTPTWAVAVVVFVLISISICIEHLLHLLAKYFNKSRRKYLIQALDKIKSEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            + +GFISLLLT+ + P++NICIP+S+G ++ PC
Sbjct  61   LQLGFISLLLTVGEKPIANICIPKSIGETFLPC  93



>gb|AFW98803.1| MLO protein 3 [Rosa multiflora]
Length=563

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/90 (61%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            ERT+E TPTWA+AVVCF+L+ ISI IE + + +G W   +HK+AL+EAL+K+K+ELML+G
Sbjct  6    ERTLEKTPTWAVAVVCFVLLVISIFIEHVINFIGKWFKSRHKRALYEALEKLKSELMLLG  65

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            F+SLLLT+ QDP++ ICIP+SV  +WHPC+
Sbjct  66   FLSLLLTVLQDPIAGICIPKSVAATWHPCN  95



>gb|KJB34882.1| hypothetical protein B456_006G088500 [Gossypium raimondii]
Length=436

 Score =   110 bits (274),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MA    T+E+TPTWA+AVV F+L++ISI IE L H L  +  +  +K L +ALDKIK+EL
Sbjct  1    MASSVITLESTPTWAVAVVVFVLISISICIEHLLHLLAKYFNKSRRKYLIQALDKIKSEL  60

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            + +GFISLLLT+ + P++NICIP+S+G ++ PC
Sbjct  61   LQLGFISLLLTVGEKPIANICIPKSIGETFLPC  93



>gb|KHN08481.1| MLO-like protein 6 [Glycine soja]
Length=508

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  24   ERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELMLMG  203
            E T+E TPTWA+A VCFI++ ISI IE L H L  +  RK +K+L EAL+KIK ELML+G
Sbjct  6    ETTLENTPTWAVATVCFIMIVISIFIEHLLHILARYFKRKRRKSLTEALEKIKTELMLLG  65

Query  204  FISLLLTIFQDPVSNICIPESVGNSWHPCDKI  299
            F SLLLT+ +  ++NICIP+ VG +  PC  I
Sbjct  66   FTSLLLTVSEKSIANICIPKGVGETLIPCASI  97



>ref|XP_009411538.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
 ref|XP_009411539.1| PREDICTED: MLO-like protein 6 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
            +   RT+E TPTWA+AVVC +LV ISI IE +   +G WL ++H+KAL+E+L+KIK+ELM
Sbjct  6    SSSSRTLEVTPTWAVAVVCLVLVLISIIIEHVIDLVGKWLKKRHRKALYESLEKIKSELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPC  290
            LMGFISLLLT+ Q  +S IC+P+SVG+SWHPC
Sbjct  66   LMGFISLLLTVGQSLISKICVPKSVGDSWHPC  97



>ref|XP_004287195.1| PREDICTED: MLO-like protein 15 [Fragaria vesca subsp. vesca]
Length=536

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  12   MAGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAEL  191
            MAG   T+E TPTW +A VC I+V IS+A+E+L H+ G +L RK++K L EAL KIK EL
Sbjct  1    MAGGT-TLEYTPTWVVAFVCSIIVFISLAVERLLHYTGKYLKRKNQKPLFEALQKIKEEL  59

Query  192  MLMGFISLLLTIFQDPVSNICIPESVGNSWHPCD  293
            ML+GFISLLLT+FQ P+  ICI + + + W PC+
Sbjct  60   MLLGFISLLLTVFQGPIEKICISKKLASHWLPCN  93



>ref|XP_009790030.1| PREDICTED: MLO-like protein 8 [Nicotiana sylvestris]
Length=554

 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  15   AGKERTMEATPTWAIAVVCFILVAISIAIEQLFHHLGMWLLRKHKKALHEALDKIKAELM  194
             G  R ++ TPTWA+A VC +++ ISIA+E++ H LG WL  +HKKAL+EAL+K+KAELM
Sbjct  6    GGTSRQLDQTPTWAVAGVCAVIIIISIALEKIIHKLGTWLTDRHKKALYEALEKVKAELM  65

Query  195  LMGFISLLLTIFQDPVSNICIPESVGNSWHPCDKI  299
            ++GFISL L   Q  ++ ICIP SV ++  PC  +
Sbjct  66   ILGFISLTLVFSQYYIAGICIPPSVADTMLPCPAV  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564737980045