BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019B14

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788433.1|  PREDICTED: SCY1-like protein 2                     168   2e-48   Nicotiana sylvestris
gb|EYU22712.1|  hypothetical protein MIMGU_mgv1a000991mg                160   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_009601552.1|  PREDICTED: SCY1-like protein 2                     160   6e-42   Nicotiana tomentosiformis
gb|KDO45470.1|  hypothetical protein CISIN_1g0453201mg                  150   7e-42   Citrus sinensis [apfelsine]
ref|XP_006362717.1|  PREDICTED: SCY1-like protein 2-like                156   1e-40   Solanum tuberosum [potatoes]
ref|XP_004250719.1|  PREDICTED: SCY1-like protein 2                     156   2e-40   Solanum lycopersicum
emb|CDP20126.1|  unnamed protein product                                155   4e-40   Coffea canephora [robusta coffee]
gb|EPS68984.1|  hypothetical protein M569_05783                         150   2e-39   Genlisea aurea
ref|XP_008358266.1|  PREDICTED: SCY1-like protein 2                     142   3e-39   
ref|XP_007019922.1|  Kinase family protein with ARM repeat domain...    151   1e-38   
ref|XP_007019921.1|  Kinase family protein with ARM repeat domain...    151   1e-38   
ref|XP_006478453.1|  PREDICTED: SCY1-like protein 2-like                149   5e-38   Citrus sinensis [apfelsine]
ref|XP_006441714.1|  hypothetical protein CICLE_v10018760mg             149   5e-38   Citrus clementina [clementine]
ref|XP_004290244.1|  PREDICTED: SCY1-like protein 2                     148   1e-37   Fragaria vesca subsp. vesca
emb|CDX72804.1|  BnaC06g32520D                                          147   2e-37   
ref|XP_010427973.1|  PREDICTED: SCY1-like protein 2                     147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002888835.1|  kinase family protein                              146   5e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009105810.1|  PREDICTED: SCY1-like protein 2                     146   6e-37   Brassica rapa
gb|KHG06707.1|  SCY1-like protein 2                                     146   6e-37   Gossypium arboreum [tree cotton]
emb|CDX96321.1|  BnaA07g29320D                                          145   8e-37   
ref|XP_010415850.1|  PREDICTED: SCY1-like protein 2                     145   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010471155.1|  PREDICTED: SCY1-like protein 2                     145   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006300351.1|  hypothetical protein CARUB_v10021914mg             145   2e-36   Capsella rubella
gb|KJB60121.1|  hypothetical protein B456_009G290500                    145   2e-36   Gossypium raimondii
ref|NP_177297.1|  putative protein kinase                               144   3e-36   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01849.1|  hypothetical protein                                   144   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237746.1|  PREDICTED: SCY1-like protein 2                     144   3e-36   Prunus mume [ume]
ref|XP_008361497.1|  PREDICTED: SCY1-like protein 2                     140   6e-36   
ref|XP_004164535.1|  PREDICTED: LOW QUALITY PROTEIN: SCY1-like pr...    143   7e-36   
emb|CDY03692.1|  BnaA02g15450D                                          143   8e-36   
ref|XP_006306722.1|  hypothetical protein CARUB_v10008248mg             143   9e-36   Capsella rubella
emb|CDY37942.1|  BnaC02g20690D                                          142   9e-36   Brassica napus [oilseed rape]
ref|XP_009366853.1|  PREDICTED: SCY1-like protein 2 isoform X1          142   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_006416147.1|  hypothetical protein EUTSA_v10006737mg             142   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_008459573.1|  PREDICTED: SCY1-like protein 2                     142   1e-35   Cucumis melo [Oriental melon]
ref|XP_004141537.1|  PREDICTED: SCY1-like protein 2-like                142   1e-35   Cucumis sativus [cucumbers]
gb|KFK41573.1|  hypothetical protein AALP_AA2G146900                    142   1e-35   Arabis alpina [alpine rockcress]
ref|XP_010521095.1|  PREDICTED: SCY1-like protein 2                     142   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_008348711.1|  PREDICTED: SCY1-like protein 2                     142   2e-35   
ref|XP_007201757.1|  hypothetical protein PRUPE_ppa001052mg             142   2e-35   Prunus persica
ref|XP_002273755.1|  PREDICTED: SCY1-like protein 2                     142   2e-35   Vitis vinifera
ref|XP_007133873.1|  hypothetical protein PHAVU_011G216200g             142   2e-35   Phaseolus vulgaris [French bean]
ref|NP_173700.2|  protein kinase family protein                         141   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127867.1|  PREDICTED: SCY1-like protein 2                     141   3e-35   Brassica rapa
ref|XP_002890539.1|  kinase family protein                              141   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010498773.1|  PREDICTED: SCY1-like protein 2 isoform X2          141   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010498772.1|  PREDICTED: SCY1-like protein 2 isoform X1          141   4e-35   
ref|XP_010460052.1|  PREDICTED: SCY1-like protein 2                     140   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010534134.1|  PREDICTED: SCY1-like protein 2 isoform X3          140   6e-35   Tarenaya hassleriana [spider flower]
gb|KFK44375.1|  hypothetical protein AALP_AA1G249300                    140   6e-35   Arabis alpina [alpine rockcress]
ref|XP_011095377.1|  PREDICTED: SCY1-like protein 2                     140   6e-35   Sesamum indicum [beniseed]
ref|XP_010477557.1|  PREDICTED: SCY1-like protein 2                     140   7e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006390775.1|  hypothetical protein EUTSA_v10018097mg             140   9e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009115591.1|  PREDICTED: SCY1-like protein 2                     140   1e-34   Brassica rapa
ref|XP_003534437.1|  PREDICTED: SCY1-like protein 2-like isoform X1     139   1e-34   Glycine max [soybeans]
ref|XP_010112043.1|  SCY1-like protein 2                                139   1e-34   Morus notabilis
emb|CDY04777.1|  BnaC05g18120D                                          139   1e-34   
ref|XP_010248020.1|  PREDICTED: SCY1-like protein 2                     138   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010279109.1|  PREDICTED: SCY1-like protein 2 isoform X1          139   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_003540550.1|  PREDICTED: SCY1-like protein 2-like                138   3e-34   Glycine max [soybeans]
ref|XP_010063716.1|  PREDICTED: SCY1-like protein 2                     138   4e-34   Eucalyptus grandis [rose gum]
emb|CDP07807.1|  unnamed protein product                                137   6e-34   Coffea canephora [robusta coffee]
ref|XP_003569359.1|  PREDICTED: SCY1-like protein 2                     137   9e-34   Brachypodium distachyon [annual false brome]
gb|KJB59598.1|  hypothetical protein B456_009G262900                    137   1e-33   Gossypium raimondii
ref|XP_002319896.2|  hypothetical protein POPTR_0013s10610g             136   2e-33   Populus trichocarpa [western balsam poplar]
gb|KDP45586.1|  hypothetical protein JCGZ_17193                         135   3e-33   Jatropha curcas
ref|XP_011004854.1|  PREDICTED: SCY1-like protein 2                     135   4e-33   Populus euphratica
ref|XP_002525488.1|  ATP binding protein, putative                      134   1e-32   
gb|KJB26955.1|  hypothetical protein B456_004G267700                    133   3e-32   Gossypium raimondii
emb|CDM83285.1|  unnamed protein product                                133   3e-32   Triticum aestivum [Canadian hard winter wheat]
gb|EMS46807.1|  SCY1-like protein 2                                     132   5e-32   Triticum urartu
gb|KHG01693.1|  SCY1-like protein 2                                     132   5e-32   Gossypium arboreum [tree cotton]
ref|XP_003605415.1|  SCY1-like protein                                  128   8e-32   
ref|XP_010913247.1|  PREDICTED: SCY1-like protein 2                     130   3e-31   Elaeis guineensis
ref|XP_006852429.1|  hypothetical protein AMTR_s00021p00078920          129   3e-31   Amborella trichopoda
ref|XP_009393077.1|  PREDICTED: SCY1-like protein 2                     128   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003605398.1|  SCY1-like protein                                  127   2e-30   
gb|AES87595.2|  ARM repeat kinase family protein                        127   3e-30   Medicago truncatula
ref|XP_010534132.1|  PREDICTED: SCY1-like protein 2 isoform X2          124   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010534131.1|  PREDICTED: SCY1-like protein 2 isoform X1          124   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010677079.1|  PREDICTED: SCY1-like protein 2                     123   6e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008675496.1|  PREDICTED: SCY1-like protein 2                     123   7e-29   Zea mays [maize]
ref|XP_002455952.1|  hypothetical protein SORBIDRAFT_03g027880          123   7e-29   Sorghum bicolor [broomcorn]
ref|XP_004969167.1|  PREDICTED: SCY1-like protein 2-like                123   8e-29   Setaria italica
ref|XP_008654448.1|  PREDICTED: uncharacterized protein LOC100194...    122   1e-28   
ref|XP_002980242.1|  hypothetical protein SELMODRAFT_178166             122   2e-28   Selaginella moellendorffii
ref|XP_002963091.1|  hypothetical protein SELMODRAFT_165698             122   2e-28   Selaginella moellendorffii
ref|XP_001777004.1|  predicted protein                                  121   2e-28   
gb|EAY74967.1|  hypothetical protein OsI_02864                          116   1e-26   Oryza sativa Indica Group [Indian rice]
gb|EAZ12691.1|  hypothetical protein OsJ_02609                          116   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008671504.1|  PREDICTED: uncharacterized protein LOC103648904    105   2e-24   
gb|KHN19409.1|  SCY1-like protein 2                                     109   5e-24   Glycine soja [wild soybean]
gb|KIY94415.1|  hypothetical protein MNEG_13548                       66.6    6e-11   Monoraphidium neglectum
gb|KDD72582.1|  hypothetical protein H632_c3167p0                     57.8    9e-08   Helicosporidium sp. ATCC 50920
emb|CDS22687.1|  scy1 protein 2                                       52.8    4e-05   Echinococcus granulosus
gb|EUB58096.1|  SCY1-like protein                                     52.8    4e-05   Echinococcus granulosus
emb|CDS35900.1|  scy1 protein 2                                       51.6    9e-05   Echinococcus multilocularis
ref|XP_006646100.1|  PREDICTED: SCY1-like protein 2-like              50.8    2e-04   Oryza brachyantha
gb|KHN80443.1|  SCY1-like protein 2                                   50.1    4e-04   Toxocara canis
ref|XP_009171219.1|  hypothetical protein T265_07437                  49.3    6e-04   Opisthorchis viverrini [Southeast Asian liver fluke]
gb|ERG82889.1|  scy1-like protein 2                                   48.5    0.001   



>ref|XP_009788433.1| PREDICTED: SCY1-like protein 2 [Nicotiana sylvestris]
Length=237

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 2/114 (2%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  357
            +S+NMK T T+A AKASAVIEKTVQTTVQEVTG PRALQD++L DQIGSAGPGL WKLYS
Sbjct  1    MSINMK-TLTQAFAKASAVIEKTVQTTVQEVTGLPRALQDYDLLDQIGSAGPGLAWKLYS  59

Query  358  AKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            AKARDGHAVYPNVCVW+LDKR LSEARQRAGLSKTA D+FFD+IRADAARLVRL
Sbjct  60   AKARDGHAVYPNVCVWLLDKRVLSEARQRAGLSKTAEDSFFDVIRADAARLVRL  113



>gb|EYU22712.1| hypothetical protein MIMGU_mgv1a000991mg [Erythranthe guttata]
Length=919

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  357
            +S+NMK T T+A AKASAVIEKTVQ TVQEVTG PRA+QD+ELFDQIGSAGPGL WKLYS
Sbjct  1    MSINMK-TLTQAFAKASAVIEKTVQNTVQEVTGLPRAMQDYELFDQIGSAGPGLAWKLYS  59

Query  358  AKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            AK+RDGH  AVYP VCVWVLDK+ALSE+RQRAGLSK A DAF D+IRADAARLVRL
Sbjct  60   AKSRDGHVPAVYPTVCVWVLDKKALSESRQRAGLSKAAEDAFLDVIRADAARLVRL  115



>ref|XP_009601552.1| PREDICTED: SCY1-like protein 2 [Nicotiana tomentosiformis]
Length=933

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  280  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  459
            PRALQD++L DQIGSAGPGLVWKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  460  TAXDAFFDMIRADAARLVRL  519
            TA D+FFD+IRADAARLVRL
Sbjct  98   TAEDSFFDVIRADAARLVRL  117



>gb|KDO45470.1| hypothetical protein CISIN_1g0453201mg, partial [Citrus sinensis]
Length=199

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARD---GHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K+A DAF D++RADA +LVRL
Sbjct  60   RARDVTRQQAQYPMVCVWVLDKRALSEARARAGLTKSAEDAFLDLVRADAGKLVRL  115



>ref|XP_006362717.1| PREDICTED: SCY1-like protein 2-like [Solanum tuberosum]
Length=935

 Score =   156 bits (395),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  280  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  459
            PRALQD++L DQIGSAGPGL WKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLAWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  460  TAXDAFFDMIRADAARLVRL  519
            TA D+FFD+IRADAARLVRL
Sbjct  98   TAEDSFFDIIRADAARLVRL  117



>ref|XP_004250719.1| PREDICTED: SCY1-like protein 2 [Solanum lycopersicum]
Length=934

 Score =   156 bits (394),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 71/80 (89%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +1

Query  280  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSK  459
            PRALQD++L DQIGSAGPGL WKLYSAKARDGHAVYPNVCVW+LDKRALSEARQRAGLSK
Sbjct  38   PRALQDYDLLDQIGSAGPGLAWKLYSAKARDGHAVYPNVCVWLLDKRALSEARQRAGLSK  97

Query  460  TAXDAFFDMIRADAARLVRL  519
            TA D+FFD+IRADA+RLVRL
Sbjct  98   TAEDSFFDIIRADASRLVRL  117



>emb|CDP20126.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  357
            +SLNMK T T+A AKASA IEKTVQTTVQEVTG P+ LQD++L DQIGSAGPGL WKLYS
Sbjct  1    MSLNMK-TLTQAFAKASAAIEKTVQTTVQEVTGLPKPLQDYDLLDQIGSAGPGLAWKLYS  59

Query  358  AKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            AK+RDG AVYPNVCVW+LDK+ALSEARQRAGLSK A DAF +++RADA+RLVRL
Sbjct  60   AKSRDGRAVYPNVCVWLLDKKALSEARQRAGLSKAAEDAFLEVLRADASRLVRL  113



>gb|EPS68984.1| hypothetical protein M569_05783, partial [Genlisea aurea]
Length=575

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYS  357
            +SLNMK T T+A AKASAVIEKTVQ TVQEVTG P+ +QD+++ DQ+GSAGPGL WKLYS
Sbjct  1    MSLNMK-TLTQAFAKASAVIEKTVQNTVQEVTGLPKPMQDYDILDQVGSAGPGLAWKLYS  59

Query  358  AKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            AK+RDGH  AVY  VCVWVLDK+ALSEARQRAGLSK A DAF D+IRADAARLVRL
Sbjct  60   AKSRDGHIPAVYSTVCVWVLDKKALSEARQRAGLSKAAEDAFLDLIRADAARLVRL  115



>ref|XP_008358266.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=169

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+A AK +A IEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAAIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA RD      YP VCVWVLDK+ALSEAR RAGL+K A D F ++IRADAARLVRL
Sbjct  60   KAARDSTRAHQYPTVCVWVLDKKALSEARLRAGLTKAAEDGFLEIIRADAARLVRL  115



>ref|XP_007019922.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY17147.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=934

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARDG     YP VCVWVLDK+ LSEAR RAGLSK A D+FFD+IRADA RLVRL
Sbjct  60   KARDGTRPQQYPTVCVWVLDKKVLSEARARAGLSKVAEDSFFDLIRADAGRLVRL  114



>ref|XP_007019921.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY17146.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=933

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARDG     YP VCVWVLDK+ LSEAR RAGLSK A D+FFD+IRADA RLVRL
Sbjct  60   KARDGTRPQQYPTVCVWVLDKKVLSEARARAGLSKVAEDSFFDLIRADAGRLVRL  114



>ref|XP_006478453.1| PREDICTED: SCY1-like protein 2-like [Citrus sinensis]
Length=915

 Score =   149 bits (376),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARDG---HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K A DAF D++RADA +LVRL
Sbjct  60   RARDATRQQAQYPMVCVWVLDKRALSEARARAGLTKVAEDAFLDLVRADAGKLVRL  115



>ref|XP_006441714.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 ref|XP_006441715.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54954.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
 gb|ESR54955.1| hypothetical protein CICLE_v10018760mg [Citrus clementina]
Length=913

 Score =   149 bits (376),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALAK +AVI KTV+TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIGKTVETTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARD---GHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD     A YP VCVWVLDKRALSEAR RAGL+K+A DAF D++RADA +LVRL
Sbjct  60   RARDVTRQQAQYPMVCVWVLDKRALSEARARAGLTKSAEDAFLDLVRADAGKLVRL  115



>ref|XP_004290244.1| PREDICTED: SCY1-like protein 2 [Fragaria vesca subsp. vesca]
Length=928

 Score =   148 bits (373),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 91/114 (80%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T  +ALAKA AVIEKTVQTTVQEV GPR LQD+ELFDQIGSAGP LVWKLY+A
Sbjct  1    MSLNMK-TLQQALAKAGAVIEKTVQTTVQEVAGPRPLQDYELFDQIGSAGPALVWKLYNA  59

Query  361  KA-RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R G   YP VCVWVLDK+ALSEAR RAGLSK A DAF D+IRADAARLVRL
Sbjct  60   KAARGGQHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLDIIRADAARLVRL  113



>emb|CDX72804.1| BnaC06g32520D [Brassica napus]
Length=881

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSLNMK-TFTQALARTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSE+R RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSESRVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010427973.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_002888835.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65094.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=899

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRAGLSKGAEDAFLDLIRADAGKLVRL  114



>ref|XP_009105810.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=877

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSLNMK-TFTQALARTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDTTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>gb|KHG06707.1| SCY1-like protein 2 [Gossypium arboreum]
Length=932

 Score =   146 bits (368),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARDGHA--VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARDG     YP VCVW+LDK+ LSEAR RAGLSK A D+F D+IRADAA+LVRL
Sbjct  60   KARDGTRPHQYPTVCVWLLDKKVLSEARARAGLSKVAEDSFLDLIRADAAKLVRL  114



>emb|CDX96321.1| BnaA07g29320D [Brassica napus]
Length=877

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010415850.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=910

 Score =   145 bits (367),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010471155.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=909

 Score =   145 bits (367),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_006300351.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
 gb|EOA33249.1| hypothetical protein CARUB_v10021914mg [Capsella rubella]
Length=914

 Score =   145 bits (365),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>gb|KJB60121.1| hypothetical protein B456_009G290500 [Gossypium raimondii]
Length=932

 Score =   145 bits (365),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD++L DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYQLLDQIGSAGPGLAWKLYSA  59

Query  361  KARDGHA--VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARDG     YP VCVW+LDK+ LSEAR RAGLSK A D+F D+IRADAA+LVRL
Sbjct  60   KARDGTRPHQYPTVCVWLLDKKVLSEARARAGLSKVAEDSFLDLIRADAAKLVRL  114



>ref|NP_177297.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAG51833.1|AC016163_22 hypothetical protein; 58558-63003 [Arabidopsis thaliana]
 dbj|BAD93866.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35198.1| putative protein kinase [Arabidopsis thaliana]
Length=909

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RA LSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRANLSKAAEDAFLDLIRADAGKLVRL  114



>dbj|BAF01849.1| hypothetical protein [Arabidopsis thaliana]
Length=909

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFT+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RA LSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWMLDKRALSEARVRANLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_008237746.1| PREDICTED: SCY1-like protein 2 [Prunus mume]
Length=929

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R+ +    YP VCVWVLDK+ALSEAR RAGLSK A DAF ++IRADA+RLVRL
Sbjct  60   KAARESNRAHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLEIIRADASRLVRL  115



>ref|XP_008361497.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=531

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDHELFDQIGSAGPGLVWKLYSA  59

Query  361  KA----RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA       H  YP VCVWVLDK+ALSEAR RAGL K A D F ++IRADAARLVRL
Sbjct  60   KAARESTRAHQ-YPTVCVWVLDKKALSEARMRAGLPKAAEDGFLEIIRADAARLVRL  115



>ref|XP_004164535.1| PREDICTED: LOW QUALITY PROTEIN: SCY1-like protein 2-like [Cucumis 
sativus]
Length=927

 Score =   143 bits (361),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGMAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKR LSE R RAGLSK+  D+F D+IRADA RLVRL
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRILSETRTRAGLSKSVEDSFLDLIRADAGRLVRL  114



>emb|CDY03692.1| BnaA02g15450D [Brassica napus]
Length=896

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL +QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELLNQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRAL+EAR RAGLSK A DAF D+IR DA +LVRL
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALTEARLRAGLSKAAEDAFLDLIRGDAGKLVRL  114



>ref|XP_006306722.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
 gb|EOA39620.1| hypothetical protein CARUB_v10008248mg [Capsella rubella]
Length=915

 Score =   143 bits (360),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSGGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKVAEDAFLDLIRADAGKLVRL  114



>emb|CDY37942.1| BnaC02g20690D [Brassica napus]
Length=900

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL  QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELLHQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IR DA +LVRL
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALSEARLRAGLSKAAEDAFLDLIRGDAGKLVRL  114



>ref|XP_009366853.1| PREDICTED: SCY1-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=924

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 6/117 (5%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  361  KA----RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA       H  YP VCVWVLDK+ALSEAR RAGL+K A D F ++IRADAARLVRL
Sbjct  60   KAARESTRAHQ-YPTVCVWVLDKKALSEARMRAGLAKAAEDGFLEIIRADAARLVRL  115



>ref|XP_006416147.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
 gb|ESQ34500.1| hypothetical protein EUTSA_v10006737mg [Eutrema salsugineum]
Length=913

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGS GPGL WKL+SA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSGGPGLAWKLFSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLS+ A D+F D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSRAAEDSFLDLIRADAGKLVRL  114



>ref|XP_008459573.1| PREDICTED: SCY1-like protein 2 [Cucumis melo]
Length=931

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKPLQDYELLDQIGSAGPGMAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKR LSEAR RAGLSK+  D+F D+IRADA RLVRL
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRVLSEARTRAGLSKSVEDSFLDLIRADAGRLVRL  114



>ref|XP_004141537.1| PREDICTED: SCY1-like protein 2-like [Cucumis sativus]
 gb|KGN52653.1| hypothetical protein Csa_5G648740 [Cucumis sativus]
Length=931

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPG+ WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGMAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKR LSE R RAGLSK+  D+F D+IRADA RLVRL
Sbjct  60   KARDSSRPQQYPTVCVWVLDKRILSETRTRAGLSKSVEDSFLDLIRADAGRLVRL  114



>gb|KFK41573.1| hypothetical protein AALP_AA2G146900 [Arabis alpina]
Length=905

 Score =   142 bits (358),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALA+ +AVIEKTV TTVQEVTGP+ALQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TLTQALARTAAVIEKTVHTTVQEVTGPKALQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRSQQYPTVCVWMLDKRALSEARVRAGLSKGAEDAFLDLIRADAGKLVRL  114



>ref|XP_010521095.1| PREDICTED: SCY1-like protein 2 [Tarenaya hassleriana]
Length=920

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGPR LQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPRPLQDYELLDQIGSAGPGLAWKLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA        YP VCVWVLDKR+LSEAR RAGLSK A DAF D+IRADAA++VRL
Sbjct  60   KAVGSTRSQQYPTVCVWVLDKRSLSEARVRAGLSKAAEDAFLDLIRADAAKMVRL  114



>ref|XP_008348711.1| PREDICTED: SCY1-like protein 2 [Malus domestica]
Length=928

 Score =   142 bits (357),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+A AK +A IEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAAIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA RD      YP VCVWVLDK+ALSEAR RAGL+K A D F ++IRADAARLVRL
Sbjct  60   KAARDSTRAHQYPTVCVWVLDKKALSEARLRAGLTKAAEDGFLEIIRADAARLVRL  115



>ref|XP_007201757.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
 gb|EMJ02956.1| hypothetical protein PRUPE_ppa001052mg [Prunus persica]
Length=923

 Score =   142 bits (357),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEV GP+ LQD+ELFDQIGSAGPGLVWKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVAGPKPLQDYELFDQIGSAGPGLVWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R+ +    YP VCVWVLDK+ALSEAR RAGLSK A DAF ++IRADA+RLVRL
Sbjct  60   KAARESNRAHQYPTVCVWVLDKKALSEARVRAGLSKAAEDAFLEIIRADASRLVRL  115



>ref|XP_002273755.1| PREDICTED: SCY1-like protein 2 [Vitis vinifera]
 emb|CBI17053.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   142 bits (357),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIG+AGPGL WKLYS 
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGTAGPGLAWKLYSG  59

Query  361  KARDGHAV---YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KAR G AV   YP VCVWVLDK+ALSEAR RAGLS+ A ++F D+IRADA RLVRL
Sbjct  60   KARGGSAVSQQYPTVCVWVLDKKALSEARTRAGLSRAAEESFLDVIRADAGRLVRL  115



>ref|XP_007133873.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
 gb|ESW05867.1| hypothetical protein PHAVU_011G216200g [Phaseolus vulgaris]
Length=928

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+A AK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGSAGPGL W+LYSA
Sbjct  1    MSLNMK-TLTQAFAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSAGPGLAWRLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD      YP VCVWVLDKRALSEAR RAGL+K A D+F D+IR DAA+LVRL
Sbjct  60   RARDPARQHQYPVVCVWVLDKRALSEARMRAGLTKAAEDSFLDLIRTDAAKLVRL  114



>ref|NP_173700.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE30298.1| protein kinase family protein [Arabidopsis thaliana]
Length=913

 Score =   141 bits (356),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLDQIGSGGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRAD+ +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDAFLDLIRADSGKLVRL  114



>ref|XP_009127867.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=896

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK TFTEALA+ +AVIEKTV TTVQEVTGP+ LQD+EL  QIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TFTEALARTAAVIEKTVHTTVQEVTGPKPLQDYELVHQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRAL+EAR RAGLSK A DAF D+IR DA +LVRL
Sbjct  60   KARDATRSQQYPTVCVWMLDKRALTEARLRAGLSKAAEDAFLDLIRGDAGKLVRL  114



>ref|XP_002890539.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66798.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=912

 Score =   141 bits (356),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L DQIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLDQIGSGGPGLAWKLYSA  59

Query  361  KARDGHA--VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPHQYPTVCVWVLDKRALSEARARAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010498773.1| PREDICTED: SCY1-like protein 2 isoform X2 [Camelina sativa]
Length=913

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010498772.1| PREDICTED: SCY1-like protein 2 isoform X1 [Camelina sativa]
Length=917

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010460052.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK  AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTVAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VC+WVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCLWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_010534134.1| PREDICTED: SCY1-like protein 2 isoform X3 [Tarenaya hassleriana]
Length=912

 Score =   140 bits (353),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALAK +AVIEKTVQTTVQEVTGP +LQD+EL D IGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQALAKTAAVIEKTVQTTVQEVTGPASLQDYELLDPIGSAGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP+VCVW+LDKR+LS+AR RAGLSK A DAF D+IRADAA+LVRL
Sbjct  60   KARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKAAEDAFLDLIRADAAKLVRL  114



>gb|KFK44375.1| hypothetical protein AALP_AA1G249300 [Arabis alpina]
Length=908

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL +QIGS+GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLNQIGSSGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR R GLSK A D+F D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARLGLSKAAEDSFLDLIRADAGKLVRL  114



>ref|XP_011095377.1| PREDICTED: SCY1-like protein 2 [Sesamum indicum]
Length=934

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +1

Query  280  PRALQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGL  453
            PRA+QD+EL DQI SAGPGL WKLYSAK+RD H  AVYP VCVWVLDK+ALSEARQRAGL
Sbjct  38   PRAMQDYELIDQIASAGPGLAWKLYSAKSRDTHVPAVYPIVCVWVLDKKALSEARQRAGL  97

Query  454  SKTAXDAFFDMIRADAARLVRL  519
            SK A DAF D+IRADAARLVRL
Sbjct  98   SKAAEDAFLDVIRADAARLVRL  119



>ref|XP_010477557.1| PREDICTED: SCY1-like protein 2 [Camelina sativa]
Length=913

 Score =   140 bits (353),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEK VQTTVQEVTGP+ LQD+EL +QIGS GPG  WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKRVQTTVQEVTGPKPLQDYELLNQIGSGGPGFAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARSRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_006390775.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
 gb|ESQ28061.1| hypothetical protein EUTSA_v10018097mg [Eutrema salsugineum]
Length=903

 Score =   140 bits (352),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+ALA+ +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPGL WKLY+A
Sbjct  1    MSINMK-TLTQALARTAAVIEKTVHTTVQEVTGPKPLQDYELLDQIGSAGPGLAWKLYAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDKRALSEAR RAGLSK A DAF D+IRADA +LVRL
Sbjct  60   KARDPTRSQQYPTVCVWMLDKRALSEARVRAGLSKAAEDAFLDLIRADAGKLVRL  114



>ref|XP_009115591.1| PREDICTED: SCY1-like protein 2 [Brassica rapa]
Length=910

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL  QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLYQIGSGGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A D+F D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDSFLDLIRADAGKLVRL  114



>ref|XP_003534437.1| PREDICTED: SCY1-like protein 2-like isoform X1 [Glycine max]
 gb|KHN40902.1| SCY1-like protein 2 [Glycine soja]
Length=930

 Score =   139 bits (351),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD      YP VCVWVLDKR+LSEAR RAGL+K A D+F D+IR DAA+LVRL
Sbjct  60   RARDPSRQHQYPVVCVWVLDKRSLSEARMRAGLTKAAEDSFLDLIRTDAAKLVRL  114



>ref|XP_010112043.1| SCY1-like protein 2 [Morus notabilis]
 gb|EXC32462.1| SCY1-like protein 2 [Morus notabilis]
Length=919

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK + T+ALAK +AVIEKTVQTTVQEV GPR LQD+EL DQIGSAGPGLVWKLYSA
Sbjct  1    MSLNMK-SITQALAKTAAVIEKTVQTTVQEVAGPRPLQDYELLDQIGSAGPGLVWKLYSA  59

Query  361  KA----RDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA       H  Y  VCVWVLDK+ LSEAR RAGLSK A DAF D++RADA RLVRL
Sbjct  60   KAARESTRAHNQYLTVCVWVLDKKTLSEARARAGLSKAAEDAFLDVVRADAGRLVRL  116



>emb|CDY04777.1| BnaC05g18120D [Brassica napus]
Length=893

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NM+ T T+ALAK +AVIEKTVQTTVQEVTGP+ LQD+EL  QIGS GPGL WKLYSA
Sbjct  1    MSINMR-TLTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYELLYQIGSGGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVWVLDKRALSEAR RAGLSK A D+F D+IRADA +LVRL
Sbjct  60   KARDSTRPQQYPTVCVWVLDKRALSEARARAGLSKAAEDSFLDLIRADAGKLVRL  114



>ref|XP_010248020.1| PREDICTED: SCY1-like protein 2 [Nelumbo nucifera]
Length=647

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK   T+ALAK +AVIE+ VQTTVQEVTGPR LQD+ L +QIGS GPGL WKLYSA
Sbjct  1    MALNMK-ILTQALAKTAAVIERKVQTTVQEVTGPRPLQDYNLIEQIGSGGPGLAWKLYSA  59

Query  361  KARDG-HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KAR    + YP VCVWVLDKRA SEAR RAGLSK A DAFFD+IR+DAARLVRL
Sbjct  60   KARGSIPSQYPIVCVWVLDKRAFSEARARAGLSKAAEDAFFDIIRSDAARLVRL  113



>ref|XP_010279109.1| PREDICTED: SCY1-like protein 2 isoform X1 [Nelumbo nucifera]
Length=944

 Score =   139 bits (349),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTV TTVQEVTGP+ LQD++L DQIGS G GL WKLYSA
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVHTTVQEVTGPKPLQDYDLLDQIGSGGHGLAWKLYSA  59

Query  361  KARDGH-AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KAR    A YP  CVWVLDKRA+SEAR RAGLSK A DAFFD+IRADAARLVRL
Sbjct  60   KARGSTPAQYPIFCVWVLDKRAISEARARAGLSKAAEDAFFDVIRADAARLVRL  113



>ref|XP_003540550.1| PREDICTED: SCY1-like protein 2-like [Glycine max]
Length=928

 Score =   138 bits (348),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +ARD      YP VCVWVLDKR LSEAR RAGL+K A D+F D+IR DA++LVRL
Sbjct  60   RARDPSRQHQYPVVCVWVLDKRTLSEARMRAGLTKAAEDSFLDLIRMDASKLVRL  114



>ref|XP_010063716.1| PREDICTED: SCY1-like protein 2 [Eucalyptus grandis]
 gb|KCW70965.1| hypothetical protein EUGRSUZ_F04075 [Eucalyptus grandis]
Length=916

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKA AVIEKTVQTTVQEVTGP+ LQD++L DQIGSAGP L WKLYSA
Sbjct  1    MALNMK-TLTQALAKAGAVIEKTVQTTVQEVTGPKPLQDYDLIDQIGSAGPALAWKLYSA  59

Query  361  KA-RD-GHA-VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            +A RD G A  YP VCVWVLDKR LSEAR RAGLSK A DAF D++RADAARLVRL
Sbjct  60   RASRDAGRAHQYPQVCVWVLDKRVLSEARARAGLSKAAEDAFLDIVRADAARLVRL  115



>emb|CDP07807.1| unnamed protein product [Coffea canephora]
Length=743

 Score =   137 bits (344),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +1

Query  202  TFTEALAKASAviektvqttvqevtG-PRALQDFELFDQIGSAGPGLVWKLYSAKARDGH  378
            + T+A AK SA IEKTVQTTVQEVTG P+ LQD++L DQIGSAGPGL  KLYSAK+RDGH
Sbjct  10   SLTQAFAKDSAAIEKTVQTTVQEVTGLPKPLQDYDLLDQIGSAGPGLARKLYSAKSRDGH  69

Query  379  AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            AVY NVCVW+LDK+  SEARQRAGLS  A DAF D++RADA+RLVRL
Sbjct  70   AVYLNVCVWLLDKKPQSEARQRAGLSNAAEDAFLDVLRADASRLVRL  116



>ref|XP_003569359.1| PREDICTED: SCY1-like protein 2 [Brachypodium distachyon]
Length=965

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDGHA--VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RDG A   YP V VWVLDKRALSEAR RAGLSK A DAF D+ RADAARLVRL
Sbjct  60   RPRDGAASTPYPIVSVWVLDKRALSEARARAGLSKAAEDAFLDLTRADAARLVRL  114



>gb|KJB59598.1| hypothetical protein B456_009G262900 [Gossypium raimondii]
Length=925

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+A AK +AVIEKTVQTTVQEV+GP+AL D+EL  QIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVQTTVQEVSGPKALLDYELLHQIGSAGPGLAWKLYSA  59

Query  361  KARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KARD      YP VCVW+LDK+ L+EAR RAG+SK   D+FFD+IRADAARLVRL
Sbjct  60   KARDATRPLQYPTVCVWLLDKKMLAEARARAGISKIVEDSFFDLIRADAARLVRL  114



>ref|XP_002319896.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
 gb|EEE95819.2| hypothetical protein POPTR_0013s10610g [Populus trichocarpa]
Length=930

 Score =   136 bits (343),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK TFT+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L  QIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TFTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLHQIGSAGPGLAWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R+      YP VCVWVLDK+ALSEAR RAGL+K A D F D+IRADAARLVR+
Sbjct  60   KAARESTRTHQYPTVCVWVLDKKALSEARARAGLTKVAEDTFLDVIRADAARLVRI  115



>gb|KDP45586.1| hypothetical protein JCGZ_17193 [Jatropha curcas]
Length=929

 Score =   135 bits (341),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNM+ T T+A+AK +AVIEKTVQTTVQEVTGP+ LQD++L DQIGSAGPGL WKLYS 
Sbjct  1    MSLNMR-TLTQAIAKTAAVIEKTVQTTVQEVTGPKPLQDYQLLDQIGSAGPGLAWKLYSG  59

Query  361  KA--RDGHA-VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA     HA  YP VCVWVLDK+ LSEAR RAGLSK A DAF D+IRADAA+LVRL
Sbjct  60   KAVRESTHAHQYPTVCVWVLDKKELSEARVRAGLSKVAEDAFLDVIRADAAKLVRL  115



>ref|XP_011004854.1| PREDICTED: SCY1-like protein 2 [Populus euphratica]
Length=928

 Score =   135 bits (340),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK +FT+ALAK +AVIEKTVQTTVQEVTGP+ LQD++L  QIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-SFTQALAKTAAVIEKTVQTTVQEVTGPKPLQDYDLLHQIGSAGPGLAWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R+      YP VCVWVLDK+ALSEAR RAGL+K A D F D+IRADAARLVR+
Sbjct  60   KAARESTRTHQYPTVCVWVLDKKALSEARARAGLTKVAEDTFLDVIRADAARLVRI  115



>ref|XP_002525488.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36846.1| ATP binding protein, putative [Ricinus communis]
Length=916

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD++L DQIGSAGPGL WKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYDLLDQIGSAGPGLAWKLYSA  59

Query  361  KA-RDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            KA R+      YP VCVWVLDK+AL+EAR + GLSK+A D+F D+IRADA +LVRL
Sbjct  60   KAARESTRAHQYPTVCVWVLDKKALTEARVKVGLSKSAEDSFLDVIRADAGQLVRL  115



>gb|KJB26955.1| hypothetical protein B456_004G267700 [Gossypium raimondii]
Length=1121

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 7/119 (6%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASA----viektvqttvqevtGPRALQDFELFDQIGSAGPGLVWK  348
            +S+NMK T T+A AK +A     +  TVQ+ VQEVTGP+ALQD+EL  QIGSAGPGL WK
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVHTTVQSAVQEVTGPKALQDYELLHQIGSAGPGLAWK  59

Query  349  LYSAKARDG-HA-VYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            LYSAKARDG H   YP VCVWVLDK+A+S+AR  AGLSK   D+FF++IRADA RLVRL
Sbjct  60   LYSAKARDGTHPHQYPTVCVWVLDKKAMSKARACAGLSKAVEDSFFNLIRADAVRLVRL  118



>emb|CDM83285.1| unnamed protein product [Triticum aestivum]
Length=949

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RD  A   YP V VWVLDKRALSEAR RAGLS+ A DAF D+ RADAARLVRL
Sbjct  60   RPRDAAASTPYPVVSVWVLDKRALSEARARAGLSRAAEDAFLDLARADAARLVRL  114



>gb|EMS46807.1| SCY1-like protein 2 [Triticum urartu]
Length=1160

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T  +ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MSLNMK-TLQQALAKASAVIEKTVTTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDGHAV--YPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RD  A   YP V VWVLDKRALSEAR RAGLS+ A DAF D+ RADAARLVRL
Sbjct  60   RPRDAAASTPYPVVSVWVLDKRALSEARARAGLSRAAEDAFLDLARADAARLVRL  114



>gb|KHG01693.1| SCY1-like protein 2 [Gossypium arboreum]
Length=1165

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 7/119 (6%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASA----viektvqttvqevtGPRALQDFELFDQIGSAGPGLVWK  348
            +S+NMK T T+A AK +A     +  TVQ+ VQEVTGPRALQD+EL  QIGSAGPGL WK
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVHTTVQSAVQEVTGPRALQDYELLHQIGSAGPGLAWK  59

Query  349  LYSAKARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            LYSAKAR+G     YP VCVWVLDK+A+S+AR  AGLSK   D+FF++IRADA RLVRL
Sbjct  60   LYSAKAREGTHRHQYPTVCVWVLDKKAMSKARACAGLSKAVEDSFFNLIRADAVRLVRL  118



>ref|XP_003605415.1| SCY1-like protein [Medicago truncatula]
Length=371

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K A DAF D+IR DA ++VRL
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRL  114



>ref|XP_010913247.1| PREDICTED: SCY1-like protein 2 [Elaeis guineensis]
Length=924

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAK +AVIEKTVQTTVQEVTGPR LQD++L D +GS GPGL W+L++ 
Sbjct  1    MALNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPRPLQDYDLLDPVGSGGPGLAWRLFAG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R       YP VCVWVLDKRALSEAR RAGLSK A DAF D++RADAARLVR+
Sbjct  60   RPRPSAPSTQYPLVCVWVLDKRALSEARARAGLSKAAEDAFLDLLRADAARLVRI  114



>ref|XP_006852429.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
 gb|ERN13896.1| hypothetical protein AMTR_s00021p00078920 [Amborella trichopoda]
Length=898

 Score =   129 bits (325),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQ+GS G G VWKLYSA
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQVGSGGHGHVWKLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R     + YP VC+W+LDK+A+SEAR RAGLSK A DAF ++++ADA+RLVRL
Sbjct  60   RPRTKTLQSQYPLVCIWLLDKKAVSEARIRAGLSKAAEDAFMELVKADASRLVRL  114



>ref|XP_009393077.1| PREDICTED: SCY1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=924

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAKA AVIEKTVQTTVQEVTGPR LQD++L DQ GS GPGL W+L++A
Sbjct  1    MSLNMK-TLTQALAKAGAVIEKTVQTTVQEVTGPRPLQDYDLLDQAGSGGPGLAWRLFAA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R       YP V VWVLDKRAL+EAR RAGLSK A DAF D++RADAARLVR+
Sbjct  60   RPRASAPSTHYPLVTVWVLDKRALAEARVRAGLSKAAEDAFLDLVRADAARLVRI  114



>ref|XP_003605398.1| SCY1-like protein [Medicago truncatula]
Length=989

 Score =   127 bits (320),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K A DAF D+IR DA ++VRL
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRL  114



>gb|AES87595.2| ARM repeat kinase family protein [Medicago truncatula]
Length=928

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+A AK + +IEKTV TTVQEVTGP+ LQD++L  QIGSAGP L WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTATLIEKTVSTTVQEVTGPKPLQDYDLLHQIGSAGPALAWKLYSA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            K+RD      YP VCVWVLDK+ALSEAR +AGL+K A DAF D+IR DA ++VRL
Sbjct  60   KSRDPSRQHQYPVVCVWVLDKKALSEARLKAGLTKAAEDAFLDLIRMDAGKMVRL  114



>ref|XP_010534132.1| PREDICTED: SCY1-like protein 2 isoform X2 [Tarenaya hassleriana]
Length=871

 Score =   124 bits (310),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 2/79 (3%)
 Frame = +1

Query  289  LQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKT  462
            LQD+EL D IGSAGPGL WKLYSAKARD      YP+VCVW+LDKR+LS+AR RAGLSK 
Sbjct  3    LQDYELLDPIGSAGPGLAWKLYSAKARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKA  62

Query  463  AXDAFFDMIRADAARLVRL  519
            A DAF D+IRADAA+LVRL
Sbjct  63   AEDAFLDLIRADAAKLVRL  81



>ref|XP_010534131.1| PREDICTED: SCY1-like protein 2 isoform X1 [Tarenaya hassleriana]
Length=879

 Score =   124 bits (310),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 2/79 (3%)
 Frame = +1

Query  289  LQDFELFDQIGSAGPGLVWKLYSAKARDGH--AVYPNVCVWVLDKRALSEARQRAGLSKT  462
            LQD+EL D IGSAGPGL WKLYSAKARD      YP+VCVW+LDKR+LS+AR RAGLSK 
Sbjct  3    LQDYELLDPIGSAGPGLAWKLYSAKARDSTRPQQYPSVCVWILDKRSLSDARIRAGLSKA  62

Query  463  AXDAFFDMIRADAARLVRL  519
            A DAF D+IRADAA+LVRL
Sbjct  63   AEDAFLDLIRADAAKLVRL  81



>ref|XP_010677079.1| PREDICTED: SCY1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=919

 Score =   123 bits (309),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 5/117 (4%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +S+NMK T T+A AK +AVIEKTV TTVQEVTGP+ LQD+EL DQIGSAGPGL WKLYSA
Sbjct  1    MSINMK-TLTQAFAKTAAVIEKTVTTTVQEVTGPKPLQDYELVDQIGSAGPGLAWKLYSA  59

Query  361  KARDGHAVYPN----VCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            K R G +   +    VCVW+LDKR+L+EAR RAGLSK   D+F +++R DAARLVR+
Sbjct  60   KPRGGSSSTSSQYSAVCVWLLDKRSLTEARTRAGLSKALEDSFLEVLRNDAARLVRI  116



>ref|XP_008675496.1| PREDICTED: SCY1-like protein 2 [Zea mays]
 tpg|DAA58977.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
 tpg|DAA58978.1| TPA: hypothetical protein ZEAMMB73_586293 [Zea mays]
Length=959

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK A DAF D++RADAARLVRL
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRL  114



>ref|XP_002455952.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
 gb|EES01072.1| hypothetical protein SORBIDRAFT_03g027880 [Sorghum bicolor]
Length=959

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK A DAF D++RADAARLVRL
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRL  114



>ref|XP_004969167.1| PREDICTED: SCY1-like protein 2-like [Setaria italica]
Length=960

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RDG   A YP V VWVLDKRAL+EAR RAGLSK A DAF D++RADAARLVRL
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGLSKAAEDAFLDLVRADAARLVRL  114



>ref|XP_008654448.1| PREDICTED: uncharacterized protein LOC100194347 isoform X1 [Zea 
mays]
Length=961

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQD+EL DQ GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVSTTVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + RDG   A YP V VWVLDKRAL+EAR RAG+SK A DAF D++RADAARLVRL
Sbjct  60   RPRDGAPSAPYPVVSVWVLDKRALAEARARAGMSKAAEDAFLDLVRADAARLVRL  114



>ref|XP_002980242.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
 gb|EFJ18502.1| hypothetical protein SELMODRAFT_178166 [Selaginella moellendorffii]
Length=866

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK + T+ALAK +AVIEK VQ+TVQEVTGP+ LQD+EL +QIGS GP L WKLYS 
Sbjct  1    MALNMK-SLTQALAKTAAVIEKHVQSTVQEVTGPKPLQDYELVEQIGSGGPALAWKLYSG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R+   HA  P VCVWVLDK+ LSE RQR G++K A DAF +++RADA ++++L
Sbjct  60   RPRNKAEHAHNPEVCVWVLDKKLLSETRQRIGITKAAEDAFLEVVRADAGQMLKL  114



>ref|XP_002963091.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
 gb|EFJ36554.1| hypothetical protein SELMODRAFT_165698 [Selaginella moellendorffii]
Length=866

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK + T+ALAK +AVIEK VQ+TVQEVTGP+ LQD+EL +QIGS GP L WKLYS 
Sbjct  1    MALNMK-SLTQALAKTAAVIEKHVQSTVQEVTGPKPLQDYELVEQIGSGGPALAWKLYSG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R+   HA  P VCVWVLDK+ LSE RQR G++K A DAF +++RADA ++++L
Sbjct  60   RPRNKAEHAHNPEVCVWVLDKKLLSETRQRIGITKAAEDAFLEVVRADAGQMLKL  114



>ref|XP_001777004.1| predicted protein [Physcomitrella patens]
 gb|EDQ58253.1| predicted protein [Physcomitrella patens]
Length=862

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK +FT+ALAKASAVIEKTV +TV EVTGP+A+QD+EL +Q+GS GP L+WKLY+ 
Sbjct  1    MSLNMK-SFTQALAKASAVIEKTVSSTVHEVTGPKAMQDYELLEQVGSGGPDLIWKLYAG  59

Query  361  KARD--GHAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R+       P VCVWVLDK+AL++ R R G+S+ A +AF D++R DAA+L+RL
Sbjct  60   RPRNKATQMHNPEVCVWVLDKKALTDLRLRVGISRAAEEAFLDLVRQDAAQLMRL  114



>gb|EAY74967.1| hypothetical protein OsI_02864 [Oryza sativa Indica Group]
Length=949

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQDFEL +Q GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVTTTVQEVTGPRPLQDFELLEQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R+G   A YP V VWVLDKRAL+EAR RAGL+K A DAF D+ RADAARLVRL
Sbjct  60   RPREGAPSAPYPVVSVWVLDKRALAEARARAGLTKAAEDAFLDLARADAARLVRL  114



>gb|EAZ12691.1| hypothetical protein OsJ_02609 [Oryza sativa Japonica Group]
Length=949

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            ++LNMK T T+ALAKASAVIEKTV TTVQEVTGPR LQDFEL +Q GS GPGL W++Y+A
Sbjct  1    MALNMK-TLTQALAKASAVIEKTVTTTVQEVTGPRPLQDFELLEQAGSGGPGLAWRIYTA  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            + R+G   A YP V VWVLDKRAL+EAR RAGL+K A DAF D+ RADAARLVRL
Sbjct  60   RPREGAPSAPYPVVSVWVLDKRALAEARARAGLTKAAEDAFLDLARADAARLVRL  114



>ref|XP_008671504.1| PREDICTED: uncharacterized protein LOC103648904 [Zea mays]
Length=208

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = +1

Query  199  KTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSAKARDG-  375
            KT T+ALAKASAVIEKTV T VQEVTGPR LQD+EL DQ GS GPGL W++Y+A+ RDG 
Sbjct  2    KTLTQALAKASAVIEKTVSTKVQEVTGPRPLQDYELLDQAGSGGPGLAWRIYTARPRDGA  61

Query  376  -HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRA  495
              A YP V VWVLDKRAL+EAR RAG+SK A DAF D++RA
Sbjct  62   PSAPYPVVSVWVLDKRALAEARARAGMSKVAEDAFLDLVRA  102



>gb|KHN19409.1| SCY1-like protein 2 [Glycine soja]
Length=915

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 16/115 (14%)
 Frame = +1

Query  181  VSLNMKKTFTEALAKASAviektvqttvqevtGPRALQDFELFDQIGSAGPGLVWKLYSA  360
            +SLNMK T T+ALAK +AVIEKTVQTTVQEVTGP+ALQD+EL DQIGSAGPGL W+LYS 
Sbjct  1    MSLNMK-TLTQALAKTAAVIEKTVQTTVQEVTGPKALQDYELLDQIGSAGPGLAWRLYSG  59

Query  361  KARDG--HAVYPNVCVWVLDKRALSEARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            ++RD      YP VCVWVLDK+A             A D+F D+IR DA++LVRL
Sbjct  60   RSRDPSRQHQYPVVCVWVLDKQA-------------AEDSFLDLIRMDASKLVRL  101



>gb|KIY94415.1| hypothetical protein MNEG_13548, partial [Monoraphidium neglectum]
Length=136

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query  283  RALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKT  462
            +AL+D+ L   + +AGP   W+++ A ++   AV+P VCVW+LDKR L +   RAG ++ 
Sbjct  41   KALKDYRLAGHVATAGPCGTWRIFLAISKKPGAVFPEVCVWILDKRTLMDQASRAGRAR-  99

Query  463  AXDAFFDMIRADAARLVRL  519
            A D FF+  R   A+++R+
Sbjct  100  AFDTFFEQQRRACAQMLRI  118



>gb|KDD72582.1| hypothetical protein H632_c3167p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=152

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +1

Query  283  RALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS--  456
            R LQ + +  Q+ +AGPG +W++Y+AKAR   A +P V VWVL KR  ++   + GLS  
Sbjct  42   RCLQSYSVEGQVCTAGPGGLWRVYAAKARKPDAPHPTVSVWVLTKRQAADLDSQQGLSSG  101

Query  457  ---KTAXDAFFDMIR  492
                T  +A+F   R
Sbjct  102  QQVSTRAEAYFANAR  116



>emb|CDS22687.1| scy1 protein 2 [Echinococcus granulosus]
Length=816

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +1

Query  277  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  456
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL         S
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKEA---ATVWIFEKKALER------FS  68

Query  457  KTAXDAFFDMIRADAARLVRL  519
            K   +   + ++   A L R 
Sbjct  69   KREREMILEKLKQGVAALTRF  89



>gb|EUB58096.1| SCY1-like protein [Echinococcus granulosus]
Length=829

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +1

Query  277  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  456
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL         S
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKEA---ATVWIFEKKALER------FS  68

Query  457  KTAXDAFFDMIRADAARLVRL  519
            K   +   + ++   A L R 
Sbjct  69   KREREMILEKLKQGVAALTRF  89



>emb|CDS35900.1| scy1 protein 2 [Echinococcus multilocularis]
Length=816

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  277  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQR  444
            G +  ++F+L +Q+GS+GPGL+WKLYSA  R          VW+ +K+AL    +R
Sbjct  18   GNQVSREFDLEEQVGSSGPGLLWKLYSATKRSSKE---EATVWIFEKKALERFPKR  70



>ref|XP_006646100.1| PREDICTED: SCY1-like protein 2-like [Oryza brachyantha]
Length=913

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  430  EARQRAGLSKTAXDAFFDMIRADAARLVRL  519
            EAR RAGLSK A DAF D+ RADAARLVRL
Sbjct  38   EARARAGLSKAAEDAFLDLTRADAARLVRL  67



>gb|KHN80443.1| SCY1-like protein 2 [Toxocara canis]
Length=1422

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +1

Query  277  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  456
            G    +++E+  QI SAGPGL WK+Y+ +    H+    V VW+ DK+ L          
Sbjct  54   GNPVTREYEILSQIASAGPGLSWKIYAGRK---HSTKQAVAVWLFDKKDLDR------WP  104

Query  457  KTAXDAFFDMIRADAARLVRL  519
            +   + F +++R   A+L RL
Sbjct  105  RHEKELFTEVLRRGVAQLTRL  125



>ref|XP_009171219.1| hypothetical protein T265_07437 [Opisthorchis viverrini]
 gb|KER25046.1| hypothetical protein T265_07437 [Opisthorchis viverrini]
Length=856

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 43/76 (57%), Gaps = 9/76 (12%)
 Frame = +1

Query  292  QDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLSKTAXD  471
            ++++L  QIGSAGPG++WKL++AK R   +      VW  DK+++          K+  +
Sbjct  23   REYDLGKQIGSAGPGMLWKLFAAKKR---STQQEATVWAFDKKSIDN------YPKSQKE  73

Query  472  AFFDMIRADAARLVRL  519
            +  ++++   A L R+
Sbjct  74   SMIEILKYGVATLTRI  89



>gb|ERG82889.1| scy1-like protein 2 [Ascaris suum]
Length=941

 Score = 48.5 bits (114),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 9/81 (11%)
 Frame = +1

Query  277  GPRALQDFELFDQIGSAGPGLVWKLYSAKARDGHAVYPNVCVWVLDKRALSEARQRAGLS  456
            G    +D+E+  QI SAGPGL WK+++      ++    V VW+ DK+ L          
Sbjct  24   GNPVTRDYEIHSQIASAGPGLSWKIHAGTK---YSTKQAVAVWLFDKKDLER------WP  74

Query  457  KTAXDAFFDMIRADAARLVRL  519
            K   D F D++R   ++L +L
Sbjct  75   KHERDLFMDVLRRGVSQLTKL  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000