BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF019A07

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09782.1|  unnamed protein product                                102   2e-22   Coffea canephora [robusta coffee]
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528  91.7    1e-18   
ref|XP_007209689.1|  hypothetical protein PRUPE_ppa012392mg           85.9    4e-18   
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...  87.0    8e-17   Solanum lycopersicum
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...  87.0    8e-17   Solanum lycopersicum
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...  87.0    8e-17   Solanum lycopersicum
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...  85.1    2e-16   Sesamum indicum [beniseed]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...  85.1    4e-16   Solanum tuberosum [potatoes]
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...  85.1    4e-16   Solanum tuberosum [potatoes]
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...  85.1    4e-16   Solanum tuberosum [potatoes]
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188  82.8    1e-15   Cucumis sativus [cucumbers]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...  82.4    2e-15   Sesamum indicum [beniseed]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...  82.0    2e-15   Cucumis melo [Oriental melon]
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...  80.5    9e-15   Cucumis melo [Oriental melon]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...  80.1    9e-15   Cucumis melo [Oriental melon]
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                77.4    1e-14   Citrus sinensis [apfelsine]
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104  80.1    1e-14   
ref|XP_007040167.1|  Uncharacterized protein TCM_016211               80.1    1e-14   
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798  80.1    2e-14   
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...  79.0    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...  78.6    5e-14   
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...  78.6    7e-14   Nicotiana sylvestris
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...  78.6    7e-14   Nicotiana sylvestris
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...  78.6    7e-14   Nicotiana sylvestris
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...  77.4    2e-13   Nicotiana tomentosiformis
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...  77.4    2e-13   Nicotiana tomentosiformis
gb|KDP25474.1|  hypothetical protein JCGZ_20630                       77.0    2e-13   Jatropha curcas
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                73.2    5e-13   Citrus sinensis [apfelsine]
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...  75.1    8e-13   Fragaria vesca subsp. vesca
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...  75.1    9e-13   Fragaria vesca subsp. vesca
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513  74.3    2e-12   
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg           73.9    2e-12   Citrus clementina [clementine]
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg           73.6    2e-12   
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...  71.6    7e-12   Vitis vinifera
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266  72.4    7e-12   
gb|KJB39637.1|  hypothetical protein B456_007G022700                  68.6    1e-10   Gossypium raimondii
ref|XP_010089148.1|  Methyl-CpG-binding domain-containing protein 5   64.3    3e-10   
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  62.4    2e-08   
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  62.4    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  62.4    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010533702.1|  PREDICTED: uncharacterized protein LOC104809...  59.7    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        60.5    7e-08   Amborella trichopoda
ref|XP_010533701.1|  PREDICTED: uncharacterized protein LOC104809...  59.7    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_010533700.1|  PREDICTED: uncharacterized protein LOC104809...  59.7    1e-07   Tarenaya hassleriana [spider flower]
gb|KFK40519.1|  hypothetical protein AALP_AA2G006300                  56.2    2e-06   Arabis alpina [alpine rockcress]
gb|KFK40518.1|  hypothetical protein AALP_AA2G006300                  55.8    2e-06   Arabis alpina [alpine rockcress]
ref|XP_010685755.1|  PREDICTED: uncharacterized protein LOC104900109  52.8    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.1    1e-05   
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...  53.1    1e-05   
ref|XP_011076193.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.8    2e-05   
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  52.4    3e-05   
gb|EYU25079.1|  hypothetical protein MIMGU_mgv11b021680mg             51.2    4e-05   Erythranthe guttata [common monkey flower]
emb|CDP05220.1|  unnamed protein product                              51.2    6e-05   Coffea canephora [robusta coffee]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...  49.7    2e-04   Vitis vinifera
gb|KJB39638.1|  hypothetical protein B456_007G022700                  49.3    3e-04   Gossypium raimondii
ref|XP_009595657.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.5    4e-04   Nicotiana tomentosiformis
gb|EPS68132.1|  hypothetical protein M569_06642                       45.4    4e-04   Genlisea aurea
ref|XP_009760427.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.1    6e-04   Nicotiana sylvestris



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MV GKSP+ LP GW EHVKV NGRK+KYYT+   G KFYSKK VI +++ K   +G   +
Sbjct  1    MVHGKSPDELPPGWKEHVKVSNGRKIKYYTDDVTGLKFYSKKRVINFVQTKDACQGTPHS  60

Query  226  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            ++  + + S   T +  S+     + S EWLP GW +E + R SG + G
Sbjct  61   VSDHDLKSSCSKTEASPSQVVVEKNSSLEWLPQGWIIESRYRKSGATAG  109



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 5/110 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LPAGW+   +V K GRK+++YTN   GK F+SK DV+C++K+   + G   
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMCHIKMASTNGGN--  58

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
               Q  T H++ ++    S+   N  + PEWLP GW VE +TR +GV  G
Sbjct  59   --PQPTTLHNQHHSEEIPSQLVVNTTEYPEWLPKGWKVEVRTRKTGVHVG  106



>ref|XP_007209689.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
 gb|EMJ10888.1| hypothetical protein PRUPE_ppa012392mg [Prunus persica]
Length=171

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LPAGW+   +V K GRK+++YTN   GK F+SK DV+ ++K+   + G   
Sbjct  1    MVAKSSPDWLPAGWAVQFRVQKTGRKIEFYTNLETGKNFFSKDDVMRHIKMASTNGGN--  58

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
               Q  T H++ ++    S+   N  + PEWLP GW VE +TR +GV  G
Sbjct  59   --PQPTTLHNQHHSEKIPSQLVVNTTEYPEWLPKGWKVEVRTRKTGVHVG  106



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  226  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  327
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  226  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  327
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV  GRK+KYYTN   GKKFYSKK+V  Y+K K       +A
Sbjct  1    MAVEDSPDWPPPGWTEDVKVSKGRKIKYYTNGETGKKFYSKKEVARYLKTKDTCDDVTQA  60

Query  226  IAQRETRHSERNTNSQS--------------------------SKTAANPDKSPEWLPPG  327
            +  +    SE N +                             S+T   P+ S EWLPPG
Sbjct  61   MNIQGKSFSENNVSDMDNQDGSFAKDNGSQMDNQDNCCSENNVSQTVGKPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 66/112 (59%), Gaps = 9/112 (8%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MVAGKSP+ LP G++E VK KNGRK+KYY N   G K++SKK+V+        +  +N  
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSC------ATAENGL  54

Query  226  IAQRET---RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +   ET    +S  ++N +        + SP WLP GWT+EEKTR SG   G
Sbjct  55   LGTPETTKVNNSGLSSNKEVDTILDKTNDSPGWLPSGWTMEEKTRQSGSRKG  106



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  226  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  327
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  226  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  327
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            M    SP+  P GW+E VKV NGRK+KYYTN   GKKFYSKK+V  Y+  K       +A
Sbjct  1    MAVVDSPDWPPPGWTEDVKVSNGRKIKYYTNGQTGKKFYSKKEVARYLNTKDTCDDVTQA  60

Query  226  IAQRETRHSERN--------------------------TNSQSSKTAANPDKSPEWLPPG  327
            +  +    SE N                          + +  S+    P+ S EWLPPG
Sbjct  61   MTIQGKNCSENNVSHMDNQDESFSKDNVSQMDNLDKSCSENNVSEAVGRPNNSHEWLPPG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG   G
Sbjct  121  WIVELKTRKSGSHAG  135



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LP+GW+   KV K GRK+++YTN  NGK FY K DVI Y+K   + +    
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLENGKSFYYKDDVIGYIKSTQSQK----  56

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
              +Q  +R  +  + +   +     ++ PEWLP GW VE +TRMSG + G
Sbjct  57   --SQPTSRGVKTQSGNSPLQLTVKSNEHPEWLPAGWKVESRTRMSGSNVG  104



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 10/113 (9%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MVAGKSP+ LP G++E VK KNGRK+KYY N   G K++SKK+V+        +  +N  
Sbjct  1    MVAGKSPDWLPPGFTEKVKYKNGRKIKYYYNVATGAKYHSKKEVLSC------ATAENGL  54

Query  226  IAQRET---RHSERNTNSQ-SSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +   ET    +S  ++N +  ++     + SP WLP GWT+EEKTR SG   G
Sbjct  55   LGTPETTKVNNSGLSSNKEVDTQILDKTNDSPGWLPSGWTMEEKTRQSGSRKG  107



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 8/110 (7%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   +++ Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIK---STQSQKS  57

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                R  +    N+  Q+ K+    ++ PEWLP GW VE +TRMSG + G
Sbjct  58   QPTSRGIKTQSGNSPVQTVKS----NEHPEWLPAGWKVESRTRMSGSNVG  103



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 11/112 (10%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  216
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   + + Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  217  NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +R I         ++ NS   +T  + ++ PEWLP GW VE +TRMSG + G
Sbjct  61   SRGIKT-------QSGNSPVQQTVKS-NEHPEWLPAGWKVESRTRMSGSNVG  104



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 11/112 (10%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  216
            MVA  SP+ LP+GW+   KV K GRK+++YTN   GK FY K DV+ Y+K   + + Q  
Sbjct  1    MVAKGSPDWLPSGWTVQYKVQKTGRKIRFYTNLETGKSFYYKDDVLGYIKSTQSQKSQPT  60

Query  217  NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +R I         ++ NS   +T  + ++ PEWLP GW VE +TRMSG + G
Sbjct  61   SRGIKT-------QSGNSPVQQTVKS-NEHPEWLPAGWKVESRTRMSGSNVG  104



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 74/128 (58%), Gaps = 20/128 (16%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  198
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  199  GNSRGQ-------NRAIA---QRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKT  348
             +S G+       ++ +A   ++E   S+R++ ++S K   + +  P+WLP GW V+ KT
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVVDENNRPDWLPDGWVVDLKT  120

Query  349  RMSGVSHG  372
            R SG + G
Sbjct  121  RKSGSAVG  128



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  219
            MVA  SP+ LP GWS   +  K GRK+++YT+   GKKF+SK D + Y+K++ N+RG+  
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQ-NTRGEKP  59

Query  220  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +        HSE       S+   +P + PEWLP GW VE +TR SGV  G
Sbjct  60   QPTLVNIPDHSEE----VPSQLEVDPTECPEWLPNGWKVELRTRQSGVQVG  106



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M A  SP+ LPAGW+   KV K GR++ +Y N   G+KF++K D+I Y K  G+++  + 
Sbjct  1    MTAKTSPDWLPAGWTLQFKVQKTGRRITHYVNLATGQKFFTKDDLIRYTKT-GSTKCDDL  59

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                R+T+    N    S  TA N ++ PEWLP  W +E KTR SGV  G
Sbjct  60   QPTLRQTKMPPANG---SMDTAVNANERPEWLPKNWFMELKTRKSGVRIG  106



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  219
            MVA  SP+ LP GWS   +  K GRK+++YT+   GKKF+SK D + Y+K++ N+RG+  
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIEFYTHLETGKKFFSKDDAMRYIKMQ-NTRGEKP  59

Query  220  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +        HSE       S+   +P + PEWLP GW VE +TR SGV  G
Sbjct  60   QPTLVNIPDHSEE----VPSQLEVDPTECPEWLPNGWKVELRTRQSGVQVG  106



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LP GWS   +  K GRK+ +YT+   GKKF+SK D + Y+K++     + +
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                + + HSE       S+   +P + PEWLP GW VE +TR SGV  G
Sbjct  61   PTLVKISDHSEE----VPSQLEVDPMECPEWLPNGWKVELRTRQSGVQVG  106



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LP GWS   +  K GRK+ +YT+   GKKF+SK D + Y+K++     + +
Sbjct  1    MVARSSPDWLPPGWSVQSRSQKRGRKIVFYTHLETGKKFFSKDDAMRYIKMQNTHGERPQ  60

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                + + HSE       S+   +P + PEWLP GW VE +TR SGV  G
Sbjct  61   PTLVKISDHSEE----VPSQLEVDPMECPEWLPNGWKVELRTRQSGVQVG  106



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEP-LPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M  G SP    P GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  223  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  327
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG + G
Sbjct  121  WIVELKTRKSGSNAG  135



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEP-LPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M  G SP    P GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  223  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  327
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG + G
Sbjct  121  WIVELKTRKSGSNAG  135



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 64/135 (47%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEP-LPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M  G SP    P GW+E VK+ +GRK KYYT+   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTHVETGKKFYSKKEVTRYMNTKDTCHDVAQ  60

Query  223  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  327
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSTENNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE KTR SG + G
Sbjct  121  WIVELKTRKSGSNAG  135



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 62/135 (46%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M  G SP   P  GW+E VK+ +GRK KYYTN   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQ  60

Query  223  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  327
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE + R SG   G
Sbjct  121  WIVELRNRKSGSHAG  135



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 62/135 (46%), Gaps = 26/135 (19%)
 Frame = +1

Query  46   MVAGKSPEPLPA-GWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M  G SP   P  GW+E VK+ +GRK KYYTN   GKKFYSKK+V  YM  K       +
Sbjct  1    MTVGDSPADWPPPGWTEDVKITSGRKTKYYTNVETGKKFYSKKEVTRYMNTKDTCHDVTQ  60

Query  223  AIAQ--------------RETRHSERNTNSQS-----------SKTAANPDKSPEWLPPG  327
             + Q              ++   SE N +  +           S+      KSPEWLP G
Sbjct  61   VLNQDKSSSQNNVSQMNHQDKSFSENNVSQMNYQDRSCSENNVSQIVEETKKSPEWLPAG  120

Query  328  WTVEEKTRMSGVSHG  372
            W VE + R SG   G
Sbjct  121  WIVELRNRKSGSHAG  135



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M A  SPE LP GW+    V K GRK+KYY N+  G+K++S  D I Y       RGQ  
Sbjct  1    MTAEYSPEELPHGWTVQFNVLKTGRKIKYYLNSGTGQKYFSTDDFIRYF------RGQGT  54

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
             + Q     S     S+  +     ++ PEWLP GW VE KTR SG + G
Sbjct  55   QLDQHHPSKSLIGLPSKKKQLIEYANERPEWLPNGWVVELKTRKSGDASG  104



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 72/151 (48%), Gaps = 43/151 (28%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  198
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  199  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  279
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  280  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            K   + +  P+WLP GW V+ KTR SG + G
Sbjct  121  KPVVDENNRPDWLPDGWVVDLKTRKSGSAVG  151



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 60/114 (53%), Gaps = 15/114 (13%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LPAGWS   + +N GR+   Y     GKKF+SK DVI Y K   N   + +
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKTTNCGEEPK  60

Query  223  AIAQRETRHSERNTNSQSSKT----AANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                        NT + SSK+     AN  + PEWLP GW VE +TR SGV  G
Sbjct  61   PT----------NTKNPSSKSHLQVVANTVEYPEWLPDGWKVELRTRKSGVQVG  104



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 60/114 (53%), Gaps = 15/114 (13%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  SP+ LPAGWS   + +N GR+   Y     GKKF+SK DVI Y K   N   + +
Sbjct  1    MVAASSPDWLPAGWSVQFRAQNRGRRSVIYIELETGKKFFSKDDVIRYTKKTTNCGEEPK  60

Query  223  AIAQRETRHSERNTNSQSSKT----AANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                        NT + SSK+     AN  + PEWLP GW VE +TR SGV  G
Sbjct  61   PT----------NTKNPSSKSHLQVVANTVEYPEWLPDGWKVELRTRKSGVQVG  104



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVK-VKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQN-  219
            MVA  SP+ LP GWS   +  K GRK+++Y +   GKKF+SK D + ++K++ N+RG+  
Sbjct  1    MVAKSSPDWLPPGWSVQSRDQKRGRKIEFYIHLETGKKFFSKDDAVRFIKME-NTRGKKP  59

Query  220  RAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            +  + +   HSE       S+   +P + PEWLP GW VE + R SG   G
Sbjct  60   QPTSVQIPNHSEE----VPSQLEVDPTEYPEWLPNGWKVELRIRQSGAQVG  106



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (48%), Gaps = 43/151 (28%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  198
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  199  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  279
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  280  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            K   + +  P+WLP GW VE KTR SG + G
Sbjct  121  KPVVDENNRPDWLPDGWVVELKTRKSGSAVG  151



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 72/151 (48%), Gaps = 43/151 (28%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  198
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  199  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  279
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  280  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            K   + +  P+WLP GW VE KTR SG + G
Sbjct  121  KPVVDENNRPDWLPDGWVVELKTRKSGSAVG  151



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = +1

Query  61   SPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQR  237
            SP+ +P GW+  VK+ KNGR VKYY N+  G+KF+SK D+I Y+K        ++ I   
Sbjct  5    SPDWIPEGWTVQVKLAKNGRNVKYYFNSKTGQKFFSKNDIIRYVKRGSIHCDTSQPINML  64

Query  238  ETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
              R S+        KT     K P+WLP GW +E KT+ SG   G
Sbjct  65   NKRRSQNKIMPLGIKTK----KFPDWLPNGWILELKTQRSGSCVG  105



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 72/151 (48%), Gaps = 43/151 (28%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIK---------  198
            +A KS E LP  W+   KV KNGRK KYY N   G+KF+SK+D++ Y+K+K         
Sbjct  1    MAVKSEERLPTDWTAKFKVEKNGRKTKYYMNVRTGQKFFSKEDLLRYVKMKRTQLDEPSP  60

Query  199  GNSRG--------------QNRAIAQRETRHSE-------------------RNTNSQSS  279
             +S G              +N+    R  RHSE                   R++ + S+
Sbjct  61   TSSHGKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVAEENSHDNGHGKRHSENSST  120

Query  280  KTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            K   + +  P+WLP GW V+ KTR SG + G
Sbjct  121  KPVVDENNRPDWLPDGWVVDLKTRKSGSAVG  151



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 7/109 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQ--  216
            M    SP+ LPAGW++  +  K GR++ +Y N   G+KF++K D+I Y K +  +  +  
Sbjct  1    MTEETSPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQY  60

Query  217  -NRAIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
             +R +  ++   ++ +TNSQ +  A   ++ PEWLP  W VE KT  SG
Sbjct  61   DDRLLTLKQI--TKPSTNSQVN-AAVKENECPEWLPKNWFVEVKTHKSG  106



>ref|XP_010089148.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
 gb|EXB37395.1| Methyl-CpG-binding domain-containing protein 5 [Morus notabilis]
Length=171

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 56/114 (49%), Gaps = 13/114 (11%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            MVA  S + LP+GW+   KV K+GRKV  YTN   GK   SK +V   +    +   Q +
Sbjct  1    MVANDSSDWLPSGWTVQFKVLKSGRKVGIYTNTETGKIVLSKHEVFQLISAGSSCSTQPQ  60

Query  223  AIAQRETRHSERNTNSQSSKTAANP----DKSPEWLPPGWTVEEKTRMSGVSHG  372
                     S  + + Q+ +T   P    D  PEWLP GW VE +TR SG   G
Sbjct  61   T--------SNTHVSLQAERTPLQPVNEKDLLPEWLPKGWKVEVRTRKSGTLAG  106



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  226  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            + +   + S      Q    A N     EWLP GW +E + R SG   G
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVG  103



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  226  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            + +   + S      Q    A N     EWLP GW +E + R SG   G
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVG  103



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            MV+ K  +  PAGW+   K+KNGRK KYY N    +KFYSK  V+ ++K    S  + + 
Sbjct  1    MVSRKKSDWPPAGWTVEFKIKNGRKTKYYINTKTHQKFYSKPAVLRFIKDGCVSNKKFQP  60

Query  226  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            + +   + S      Q    A N     EWLP GW +E + R SG   G
Sbjct  61   VIEHAKKKSSEKI--QHLVEANN----SEWLPSGWVMETRFRKSGARVG  103



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 19/127 (15%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNS-----  207
            M A KSP+ LP GW   VKV K G+K KYY +   G+KF SK  V+ Y++  G S     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIET-GESHNCMP  59

Query  208  ----RGQNRAIAQRE---TRHSERNTNSQSSKTAANP-----DKSPEWLPPGWTVEEKTR  351
                R  N   + ++   T  S+++  +  S+    P     + SP+WLP GW VE KTR
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKDMPLEMPMEDSPDWLPAGWVVEIKTR  119

Query  352  MSGVSHG  372
              G   G
Sbjct  120  RGGSKVG  126



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 19/127 (15%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNS-----  207
            M A KSP+ LP GW   VKV K G+K KYY +   G+KF SK  V+ Y++  G S     
Sbjct  1    MAAEKSPDWLPDGWVMDVKVRKTGQKDKYYIHLKTGRKFRSKDGVLRYIET-GESHNCMP  59

Query  208  ----RGQNRAIAQRE---TRHSERNTNSQSSKTAANP-----DKSPEWLPPGWTVEEKTR  351
                R  N   + ++   T  S+++  +  S+    P     + SP+WLP GW VE KTR
Sbjct  60   LQIERQANTCSSDKDVPNTCSSDKDMPNTCSRDKDMPLEMPMEDSPDWLPAGWVVEIKTR  119

Query  352  MSGVSHG  372
              G   G
Sbjct  120  RGGSKVG  126



>ref|XP_010533702.1| PREDICTED: uncharacterized protein LOC104809412 isoform X3 [Tarenaya 
hassleriana]
Length=325

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 15/106 (14%)
 Frame = +1

Query  46   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
                RE R+SE         T  NP     WLP  W +EE+   SG
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKGSSG  100



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 15/111 (14%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAI  228
            PE LP GW+  +KV+      G + KYY +   G  F S+  ++ Y+K K  S       
Sbjct  572  PEWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSRVAILRYVKTKKPS-------  624

Query  229  AQRETRHSERNTNSQSSKTAANPD---KSPEWLPPGWTVEEKTRMSGVSHG  372
            A ++ +    +  S  +  A  PD   + PEWLPPGWT+E K R SG S G
Sbjct  625  ATKQKKPKTLSPKSSGNVMATTPDAKEQPPEWLPPGWTMEIKERKSGKSAG  675


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 53/119 (45%), Gaps = 19/119 (16%)
 Frame = +1

Query  73   LPAGWSEHVK-----VKNGRKVKYYTNAPNGKKFYSKKDVICYMK-------------IK  198
            LP GW    K        G   KY+  A  G+ F SK  V+ Y+K             + 
Sbjct  10   LPDGWIMEQKRRKSGATKGLADKYFIEAATGRFFRSKLQVLRYLKTEKYTGKLWPVKLVS  69

Query  199  GNSRGQNRAIAQRETRHSE-RNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
             N    N    ++ET  ++      Q + + +   +S +WLPPGWT+E KTR +GVS G
Sbjct  70   NNKELTNGESMEKETSSAKILQEKVQRTLSPSESGQSSDWLPPGWTIEIKTRKNGVSAG  128


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 63/148 (43%), Gaps = 39/148 (26%)
 Frame = +1

Query  46   MVAGK-SPEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYM------  189
            + AG+ +PE LP GW+  V V+      GR+ K+Y     G++F S+  V+ Y+      
Sbjct  446  VCAGELTPEWLPPGWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLENGNAS  505

Query  190  --KIKGNSRGQNRA--IAQRETRHSERNTNSQSSKTAANPDK------------------  303
              ++K    G ++   IA+      ++   S   KT    D                   
Sbjct  506  LERLKSQEHGASKIDFIAEESNSPFQKRKESTVIKTKEKKDPLPEICPTNSSGNATVVTS  565

Query  304  -----SPEWLPPGWTVEEKTRMSGVSHG  372
                  PEWLPPGWT++ K R SG + G
Sbjct  566  GAEELRPEWLPPGWTMQIKVRKSGKTAG  593



>ref|XP_010533701.1| PREDICTED: uncharacterized protein LOC104809412 isoform X2 [Tarenaya 
hassleriana]
Length=601

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 15/106 (14%)
 Frame = +1

Query  46   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
                RE R+SE         T  NP     WLP  W +EE+   SG
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKGSSG  100



>ref|XP_010533700.1| PREDICTED: uncharacterized protein LOC104809412 isoform X1 [Tarenaya 
hassleriana]
Length=630

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 15/106 (14%)
 Frame = +1

Query  46   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            + A KSP+ LPAGW ++   +K+GR+V+ YT+    ++F SK DV+ Y++++        
Sbjct  9    ITADKSPDWLPAGWIAQSTVLKSGREVRSYTHLNTCQRFSSKDDVLQYIEME--------  60

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
                RE R+SE         T  NP     WLP  W +EE+   SG
Sbjct  61   --KIREIRYSETEREKNCGMTIQNPG----WLPDHWVMEERKGSSG  100



>gb|KFK40519.1| hypothetical protein AALP_AA2G006300 [Arabis alpina]
Length=720

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            + A  +P+ LP+GW S+   +K GR+ K YTN    KK Y+K  V+ Y+K++   R +  
Sbjct  9    ITADTTPDWLPSGWISQSTSLKRGRQTKTYTNVITKKKLYTKDQVLEYIKME-KIREKRL  67

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVE  339
            +  +R   + +   +S  S TA    + P WLP GW +E
Sbjct  68   SAIERTKANVQAVEDSVDSSTAR---ERPSWLPDGWKME  103



>gb|KFK40518.1| hypothetical protein AALP_AA2G006300 [Arabis alpina]
Length=737

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 5/99 (5%)
 Frame = +1

Query  46   MVAGKSPEPLPAGW-SEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            + A  +P+ LP+GW S+   +K GR+ K YTN    KK Y+K  V+ Y+K++   R +  
Sbjct  9    ITADTTPDWLPSGWISQSTSLKRGRQTKTYTNVITKKKLYTKDQVLEYIKME-KIREKRL  67

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVE  339
            +  +R   + +   +S  S TA    + P WLP GW +E
Sbjct  68   SAIERTKANVQAVEDSVDSSTAR---ERPSWLPDGWKME  103



>ref|XP_010685755.1| PREDICTED: uncharacterized protein LOC104900109 [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 15/106 (14%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  243
            P+ LP  W  H  V +     YY+N P GKKF S+K+VI Y+      + Q R I +R  
Sbjct  24   PDWLPYDWCIHRNVHSSETQLYYSN-PRGKKFQSQKEVIQYLA----KQAQKRVIIRRTK  78

Query  244  RHSERNTNSQSSK----------TAANPDKSPEWLPPGWTVEEKTR  351
            R  +++ +   +K           A  P + PEWLP  W +E  ++
Sbjct  79   RKIKKSNDMVENKELLAEIAPQYVAYPPQEWPEWLPQDWIIERSSK  124



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 15/118 (13%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK--IKGNSRG-QN  219
            P+ LPAGW    K +      GR+ K Y +   G KFYSK +V+ Y+K  I  N R  + 
Sbjct  80   PDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIPRNPRAKRK  139

Query  220  RAIAQRETRHSERNTN-------SQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            R++  R T H+  +TN       S      +  + +P+ LP GW  E + R S  S G
Sbjct  140  RSVVTRITEHTRSSTNQRKGIKRSTRENLRSQIEYTPDGLPSGWIKEIRYRKSTSSCG  197


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 51/110 (46%), Gaps = 10/110 (9%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKVK-NGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M+A + PE LP GW   VK    G K   YT   +   F SK++++ Y+  K     +  
Sbjct  1    MLAAERPEWLPEGWKMVVKTSMTGEKDVCYTCPTSSCTFNSKEEMMRYLNCK-----RAD  55

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
                + T H   N +  + +    PD    WLP GW +E KTR SG + G
Sbjct  56   GYISKPTSHFGDNVHPLAEQIKDFPD----WLPAGWGLEFKTRKSGTNAG  101



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 15/118 (13%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKN-----GRKVKYYTNAPNGKKFYSKKDVICYMK--IKGNSRGQN-  219
            P+ LPAGW    K +      GR+ K Y +   G KFYSK +V+ Y+K  I  N R +  
Sbjct  54   PDWLPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDGIPRNPRAKRK  113

Query  220  RAIAQRETRHSERNTN-------SQSSKTAANPDKSPEWLPPGWTVEEKTRMSGVSHG  372
            R++  R T H+  +TN       S      +  + +P+ LP GW  E + R S  S G
Sbjct  114  RSVVTRITEHTRSSTNQRKGIKRSTRENLRSQIEYTPDGLPSGWIKEIRYRKSTSSCG  171



>ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Sesamum indicum]
 ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Sesamum indicum]
Length=654

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 50/100 (50%), Gaps = 18/100 (18%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRE  240
            P+ LP GW   VKV++ GRK KYY N  NG KF SK +V+ Y+K     R + RA+    
Sbjct  6    PDWLPVGWRVSVKVRSCGRKDKYYVNPSNGLKFNSKPEVLRYLKYSAKGR-KPRAL----  60

Query  241  TRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
                  N   +  KT A+       LPPGW  E +T   G
Sbjct  61   ------NNKVEIRKTVADK------LPPGWIKEIRTTKKG  88



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 50/99 (51%), Gaps = 10/99 (10%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNR  222
            M    S E LPAGW+  VKV KNGR+ KYY  + +G +F S+ +V  Y+     SR   +
Sbjct  169  MADQNSEEWLPAGWTVEVKVRKNGRRDKYYYESSSGHRFSSRAEVSRYLSTSKTSREDKQ  228

Query  223  AIAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVE  339
             I +   R S+   +    KT A      E LPPGW  E
Sbjct  229  KIEETLKRPSD---DVVVEKTVA------ERLPPGWIKE  258



>gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Erythranthe guttata]
Length=330

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 50/105 (48%), Gaps = 19/105 (18%)
 Frame = +1

Query  49   VAGKSPEPLPAGWSEHVKVKN-GRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRA  225
            + G+S + LP GW   VKV+N G+K KYY N  NG++F SK +V+ Y+K           
Sbjct  62   MGGESLDWLPVGWRVSVKVRNSGKKDKYYVNPSNGRRFNSKPEVLRYVK-----------  110

Query  226  IAQRETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
                    S +N N +            E LPPGW  E +T+  G
Sbjct  111  -------SSVKNPNPKEPSKIKIEKTVTENLPPGWIKEIRTKKKG  148



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 14/100 (14%)
 Frame = +1

Query  73   LPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRETRH  249
            LPAGW   V+V K G+K K Y +  N +KFYSK +V+ Y+K  G S          +  H
Sbjct  11   LPAGWKVEVRVRKTGKKDKCYVDPSNERKFYSKPEVLRYLKDVGVS----------QPVH  60

Query  250  SERNTNSQSSKTAAN---PDKSPEWLPPGWTVEEKTRMSG  360
             E    S SS+ A      +++ E LP GW  E +    G
Sbjct  61   EETQNKSISSRLAIKFVVKEEAAEGLPAGWIKETRVTQKG  100



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = +1

Query  61   SPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMK-IKGNSRGQNRAIAQ  234
            SP+ +P GW+  VK+ KNGR VK Y +   G +FYSK DV  Y+K IK NS         
Sbjct  5    SPDWIPEGWTVQVKLAKNGRNVKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCT-------  57

Query  235  RETRHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRM  354
              +R  +      S         + + LP GW  E K RM
Sbjct  58   --SRQKKVGPGMPSLGKVVIERSTADGLPAGWIKEIKIRM  95



>gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=880

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +1

Query  46   MVAGKSPEPLPAGWSEHVKV-KNGRKVKYYTNAPNGKKFYSKKDVICYMK  192
            M    SP+ LPAGW++  +  K GR++ +Y N   G+KF++K D+I Y K
Sbjct  1    MTEETSPDWLPAGWTQEFRFQKTGRRITHYVNLATGQKFFTKDDLIRYTK  50



>ref|XP_009595657.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nicotiana 
tomentosiformis]
Length=541

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  243
            P+ LPAGW   V+ + G+K K+Y++   G KF SK DV+ Y+   G++  ++ +  + E 
Sbjct  8    PDWLPAGW--KVEFRKGKKEKWYSDPSKGLKFCSKADVLHYLSSVGSNCFKSSSTKEIEK  65

Query  244  RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
            + + +    +++          E LPPGW  E + R  G
Sbjct  66   KDTGKVVTEKATS---------EGLPPGWIKEVRVRRKG  95



>gb|EPS68132.1| hypothetical protein M569_06642, partial [Genlisea aurea]
Length=89

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  61   SPEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVI  180
            SP+ LP G+ + VK K+GRK+KY+ N+  G KF SK +V+
Sbjct  18   SPDWLPPGFCQKVKYKDGRKIKYFLNSVTGAKFRSKNEVL  57



>ref|XP_009760427.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Nicotiana sylvestris]
Length=522

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +1

Query  64   PEPLPAGWSEHVKVKNGRKVKYYTNAPNGKKFYSKKDVICYMKIKGNSRGQNRAIAQRET  243
            P+ LPAGW   V+ + G+K K+Y++     KF SK DV+ Y+    +S G N + +    
Sbjct  8    PDWLPAGW--KVEFRKGKKEKWYSDPSKELKFNSKTDVLRYL----SSVGSNCSKSSNTK  61

Query  244  RHSERNTNSQSSKTAANPDKSPEWLPPGWTVEEKTRMSG  360
               +++T   S+  AA+     E LPPGW  E + R  G
Sbjct  62   EMEKKDTGKFSTGKAAS-----EGLPPGWIKEMRVRRKG  95



Lambda      K        H        a         alpha
   0.309    0.125    0.379    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005