BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018O08

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629701.1|  PREDICTED: uncharacterized protein LOC104119814    104   3e-22   Nicotiana tomentosiformis
ref|XP_004238179.1|  PREDICTED: uncharacterized protein LOC101261408    104   3e-22   Solanum lycopersicum
ref|XP_009761575.1|  PREDICTED: uncharacterized protein LOC104213728    103   3e-22   Nicotiana sylvestris
ref|XP_009618505.1|  PREDICTED: uncharacterized protein LOC104110...    103   3e-22   Nicotiana tomentosiformis
ref|XP_009765845.1|  PREDICTED: uncharacterized protein LOC104217...    103   7e-22   Nicotiana sylvestris
gb|EYU25397.1|  hypothetical protein MIMGU_mgv1a000678mg                102   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_006595961.1|  PREDICTED: uncharacterized protein LOC100820...    101   3e-21   
ref|XP_003544449.1|  PREDICTED: uncharacterized protein LOC100820...    100   5e-21   Glycine max [soybeans]
gb|KDO84273.1|  hypothetical protein CISIN_1g0017371mg                99.4    5e-21   Citrus sinensis [apfelsine]
ref|XP_006374985.1|  hypothetical protein POPTR_0014s03370g             100   7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011030451.1|  PREDICTED: uncharacterized protein LOC105129897    100   7e-21   Populus euphratica
ref|XP_006473361.1|  PREDICTED: uncharacterized protein LOC102621...  99.8    1e-20   Citrus sinensis [apfelsine]
gb|KHN12760.1|  hypothetical protein glysoja_008723                   99.4    1e-20   Glycine soja [wild soybean]
ref|XP_003550348.1|  PREDICTED: uncharacterized protein LOC100819...  99.4    1e-20   Glycine max [soybeans]
ref|XP_006601298.1|  PREDICTED: uncharacterized protein LOC100819...  99.4    1e-20   Glycine max [soybeans]
gb|KJB58439.1|  hypothetical protein B456_009G209900                  99.0    2e-20   Gossypium raimondii
ref|XP_004499083.1|  PREDICTED: uncharacterized protein LOC101514142  99.0    2e-20   Cicer arietinum [garbanzo]
gb|KJB58437.1|  hypothetical protein B456_009G209900                  99.0    2e-20   Gossypium raimondii
gb|KJB58438.1|  hypothetical protein B456_009G209900                  99.0    2e-20   Gossypium raimondii
gb|KJB58440.1|  hypothetical protein B456_009G209900                  98.6    2e-20   Gossypium raimondii
gb|KJB58436.1|  hypothetical protein B456_009G209900                  99.0    2e-20   Gossypium raimondii
ref|XP_011083822.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.4    6e-20   
gb|KEH40051.1|  calcineurin-like metallo-phosphoesterase superfam...  97.4    6e-20   Medicago truncatula
gb|KEH40052.1|  calcineurin-like metallo-phosphoesterase superfam...  97.4    6e-20   Medicago truncatula
ref|XP_010062120.1|  PREDICTED: uncharacterized protein LOC104449...  97.4    6e-20   
gb|KEH40050.1|  calcineurin-like metallo-phosphoesterase superfam...  97.4    6e-20   Medicago truncatula
ref|XP_010062117.1|  PREDICTED: uncharacterized protein LOC104449...  97.4    7e-20   
ref|XP_010529533.1|  PREDICTED: uncharacterized protein LOC104806367  97.4    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_010062116.1|  PREDICTED: uncharacterized protein LOC104449...  97.4    8e-20   
ref|XP_010062121.1|  PREDICTED: uncharacterized protein LOC104449...  97.1    8e-20   Eucalyptus grandis [rose gum]
emb|CDP01374.1|  unnamed protein product                              96.7    1e-19   Coffea canephora [robusta coffee]
ref|XP_007017323.1|  Calcineurin-like metallo-phosphoesterase sup...  96.3    1e-19   Theobroma cacao [chocolate]
ref|XP_007160825.1|  hypothetical protein PHAVU_001G019800g           96.3    2e-19   Phaseolus vulgaris [French bean]
emb|CDY13280.1|  BnaC09g23760D                                        95.9    2e-19   Brassica napus [oilseed rape]
ref|XP_006396852.1|  hypothetical protein EUTSA_v10028387mg           95.5    3e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009367394.1|  PREDICTED: uncharacterized protein LOC103957048  95.1    4e-19   
ref|XP_008393832.1|  PREDICTED: uncharacterized protein LOC103455...  95.1    4e-19   
ref|XP_008383912.1|  PREDICTED: uncharacterized protein LOC103446557  95.1    4e-19   
ref|XP_009370173.1|  PREDICTED: uncharacterized protein LOC103959542  94.7    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_009102715.1|  PREDICTED: uncharacterized protein LOC103828821  94.4    7e-19   Brassica rapa
ref|XP_011458950.1|  PREDICTED: uncharacterized protein LOC101313...  93.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_004291134.1|  PREDICTED: uncharacterized protein LOC101313...  93.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_011458951.1|  PREDICTED: uncharacterized protein LOC101313...  93.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_010538790.1|  PREDICTED: uncharacterized protein LOC104813013  93.2    2e-18   Tarenaya hassleriana [spider flower]
emb|CDX94143.1|  BnaC07g37770D                                        92.8    3e-18   
emb|CDY52938.1|  BnaCnng23820D                                        92.0    4e-18   Brassica napus [oilseed rape]
ref|XP_009128650.1|  PREDICTED: uncharacterized protein LOC103853501  92.0    4e-18   Brassica rapa
gb|KFK28866.1|  hypothetical protein AALP_AA7G058700                  91.7    6e-18   Arabis alpina [alpine rockcress]
gb|KGN62541.1|  hypothetical protein Csa_2G360580                     91.7    6e-18   
ref|XP_004152730.1|  PREDICTED: uncharacterized protein LOC101204257  91.7    6e-18   
ref|XP_010268877.1|  PREDICTED: uncharacterized protein LOC104605707  91.3    9e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010540555.1|  PREDICTED: uncharacterized protein LOC104814...  90.9    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_009393277.1|  PREDICTED: uncharacterized protein LOC103979011  90.9    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540547.1|  PREDICTED: uncharacterized protein LOC104814...  90.9    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010936846.1|  PREDICTED: uncharacterized protein LOC105056370  90.1    2e-17   Elaeis guineensis
ref|XP_006413590.1|  hypothetical protein EUTSA_v10024304mg           89.7    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008220172.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  89.7    3e-17   Prunus mume [ume]
ref|XP_007227027.1|  hypothetical protein PRUPE_ppa000724mg           89.7    3e-17   Prunus persica
ref|XP_008444644.1|  PREDICTED: uncharacterized protein LOC103487913  89.7    3e-17   Cucumis melo [Oriental melon]
ref|XP_010433955.1|  PREDICTED: uncharacterized protein LOC104718...  89.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010433954.1|  PREDICTED: uncharacterized protein LOC104718...  89.4    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002869795.1|  hypothetical protein ARALYDRAFT_914305           89.4    4e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_008799898.1|  PREDICTED: uncharacterized protein LOC103714...  89.0    5e-17   Phoenix dactylifera
ref|XP_008799897.1|  PREDICTED: uncharacterized protein LOC103714...  89.0    5e-17   Phoenix dactylifera
ref|NP_194031.5|  calcineurin-like metallo-phosphoesterase family...  89.0    5e-17   
emb|CAB45564.1|  hypothetical protein                                 88.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811243.1|  PREDICTED: uncharacterized protein LOC103722...  88.2    8e-17   Phoenix dactylifera
emb|CDX98782.1|  BnaA03g45670D                                        88.2    8e-17   
ref|XP_009137306.1|  PREDICTED: uncharacterized protein LOC103861350  88.2    9e-17   
ref|XP_010932753.1|  PREDICTED: uncharacterized protein LOC105053...  88.2    9e-17   
ref|XP_010044195.1|  PREDICTED: uncharacterized protein LOC104433...  88.2    1e-16   Eucalyptus grandis [rose gum]
ref|NP_001058702.1|  Os07g0106000                                     88.2    1e-16   
ref|XP_010044196.1|  PREDICTED: uncharacterized protein LOC104433...  87.8    1e-16   
gb|KJB63807.1|  hypothetical protein B456_010G017500                  87.8    1e-16   Gossypium raimondii
ref|XP_010932752.1|  PREDICTED: uncharacterized protein LOC105053...  87.8    1e-16   Elaeis guineensis
ref|XP_010448789.1|  PREDICTED: uncharacterized protein LOC104731...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010448786.1|  PREDICTED: uncharacterized protein LOC104731...  87.4    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010455595.1|  PREDICTED: uncharacterized protein LOC104737182  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010422134.1|  PREDICTED: uncharacterized protein LOC104707474  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010434128.1|  PREDICTED: uncharacterized protein LOC104718144  86.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008651923.1|  PREDICTED: uncharacterized protein LOC103631...  85.9    6e-16   
ref|XP_006285736.1|  hypothetical protein CARUB_v10007209mg           85.9    6e-16   Capsella rubella
ref|XP_008651921.1|  PREDICTED: uncharacterized protein LOC103631...  85.9    6e-16   
ref|XP_010684140.1|  PREDICTED: uncharacterized protein LOC104898734  85.1    9e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006286984.1|  hypothetical protein CARUB_v10000128mg           84.7    1e-15   Capsella rubella
ref|XP_002461307.1|  hypothetical protein SORBIDRAFT_02g000620        84.7    1e-15   Sorghum bicolor [broomcorn]
ref|XP_003557697.1|  PREDICTED: uncharacterized protein LOC100823404  84.0    3e-15   
ref|XP_004987257.1|  PREDICTED: uncharacterized protein LOC101786...  83.6    3e-15   Setaria italica
ref|XP_006342611.1|  PREDICTED: uncharacterized protein LOC102601564  83.2    4e-15   Solanum tuberosum [potatoes]
ref|XP_004252774.1|  PREDICTED: uncharacterized protein LOC101266203  83.2    4e-15   Solanum lycopersicum
ref|XP_009392959.1|  PREDICTED: uncharacterized protein LOC103978...  83.2    5e-15   
ref|XP_009392951.1|  PREDICTED: uncharacterized protein LOC103978...  83.2    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874725.1|  predicted protein                                82.8    7e-15   
gb|EPS68439.1|  hypothetical protein M569_06328                       81.6    1e-14   Genlisea aurea
ref|NP_192917.3|  calcineurin-like phosphoesterase domain-contain...  79.7    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006856661.1|  hypothetical protein AMTR_s00054p00046250        79.3    8e-14   
ref|XP_002510264.1|  hydrolase, putative                              77.8    3e-13   Ricinus communis
ref|XP_010664588.1|  PREDICTED: uncharacterized protein LOC100267...  77.0    5e-13   Vitis vinifera
emb|CBI19565.3|  unnamed protein product                              77.0    5e-13   Vitis vinifera
ref|XP_006434822.1|  hypothetical protein CICLE_v10000140mg           74.7    3e-12   
ref|XP_006434821.1|  hypothetical protein CICLE_v10000140mg           74.7    3e-12   
gb|KCW69186.1|  hypothetical protein EUGRSUZ_F02708                   73.9    5e-12   Eucalyptus grandis [rose gum]
ref|XP_006657430.1|  PREDICTED: uncharacterized protein LOC102702861  73.9    6e-12   Oryza brachyantha
ref|XP_011074457.1|  PREDICTED: uncharacterized protein LOC105159184  72.0    2e-11   Sesamum indicum [beniseed]
ref|XP_010275607.1|  PREDICTED: uncharacterized protein LOC104610601  72.0    3e-11   Nelumbo nucifera [Indian lotus]
emb|CAB44318.1|  putative protein                                     70.5    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47321.1|  hypothetical protein TRIUR3_13192                     69.3    2e-10   Triticum urartu
ref|XP_004956163.1|  PREDICTED: uncharacterized protein LOC101776542  69.3    2e-10   Setaria italica
ref|XP_008670049.1|  PREDICTED: uncharacterized protein LOC103647275  69.3    2e-10   Zea mays [maize]
ref|XP_010238512.1|  PREDICTED: uncharacterized protein LOC100842...  66.6    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_010238513.1|  PREDICTED: uncharacterized protein LOC100842...  66.6    2e-09   Brachypodium distachyon [annual false brome]
ref|XP_002963358.1|  hypothetical protein SELMODRAFT_80477            63.5    1e-08   
ref|XP_002974647.1|  hypothetical protein SELMODRAFT_102099           63.5    1e-08   
ref|XP_002461963.1|  hypothetical protein SORBIDRAFT_02g011280        62.4    4e-08   
ref|XP_001765009.1|  predicted protein                                58.2    8e-07   



>ref|XP_009629701.1| PREDICTED: uncharacterized protein LOC104119814 [Nicotiana tomentosiformis]
Length=1020

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMH  55



>ref|XP_004238179.1| PREDICTED: uncharacterized protein LOC101261408 [Solanum lycopersicum]
Length=1010

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMH  55



>ref|XP_009761575.1| PREDICTED: uncharacterized protein LOC104213728 [Nicotiana sylvestris]
Length=1019

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMH  55



>ref|XP_009618505.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618510.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
Length=1019

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS+GLLDTLNM+ VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSDKQSSGLLDTLNMETVRTILTHSYPYPHEHSRHFVIAVVVGCLFFISSDNLH  55



>ref|XP_009765845.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765846.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
Length=1019

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSD+QS+GLLDTLNM+ VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSDRQSSGLLDTLNMETVRTILTHSYPYPHEHSRHFVIAVVVGCLFFISSDNLH  55



>gb|EYU25397.1| hypothetical protein MIMGU_mgv1a000678mg [Erythranthe guttata]
Length=1021

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ  GLLDTLNM+KVRTI TH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKQPVGLLDTLNMEKVRTIFTHTYPYPHEHSRHAVIAVFIGCLFFISSDNMH  55



>ref|XP_006595961.1| PREDICTED: uncharacterized protein LOC100820584 isoform X3 [Glycine 
max]
Length=910

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSAG+LDTL MQ+VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSAGILDTLKMQRVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>ref|XP_003544449.1| PREDICTED: uncharacterized protein LOC100820584 isoform X1 [Glycine 
max]
 ref|XP_006595960.1| PREDICTED: uncharacterized protein LOC100820584 isoform X2 [Glycine 
max]
 gb|KHN46303.1| hypothetical protein glysoja_045314 [Glycine soja]
Length=1021

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSAG+LDTL MQ+VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSAGILDTLKMQRVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>gb|KDO84273.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84274.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84275.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84276.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84277.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84278.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84279.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
Length=561

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLLDTL M++VRTILTH +PYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLDTLRMERVRTILTHTHPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_006374985.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 ref|XP_006374986.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52782.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52783.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
Length=1021

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ+ GLL+TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQTTGLLETLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_011030451.1| PREDICTED: uncharacterized protein LOC105129897 [Populus euphratica]
Length=1021

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ+ GLL+TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQTTGLLETLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_006473361.1| PREDICTED: uncharacterized protein LOC102621653 isoform X1 [Citrus 
sinensis]
 ref|XP_006473362.1| PREDICTED: uncharacterized protein LOC102621653 isoform X2 [Citrus 
sinensis]
Length=1019

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLLDTL M++VRTILTH +PYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLDTLRMERVRTILTHTHPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>gb|KHN12760.1| hypothetical protein glysoja_008723 [Glycine soja]
Length=1021

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>ref|XP_003550348.1| PREDICTED: uncharacterized protein LOC100819940 isoform X1 [Glycine 
max]
 ref|XP_006601296.1| PREDICTED: uncharacterized protein LOC100819940 isoform X2 [Glycine 
max]
 ref|XP_006601297.1| PREDICTED: uncharacterized protein LOC100819940 isoform X3 [Glycine 
max]
Length=1021

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>ref|XP_006601298.1| PREDICTED: uncharacterized protein LOC100819940 isoform X4 [Glycine 
max]
Length=987

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>gb|KJB58439.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=975

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_004499083.1| PREDICTED: uncharacterized protein LOC101514142 [Cicer arietinum]
Length=1017

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ AGLLD L M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSDKQPAGLLDNLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>gb|KJB58437.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=824

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>gb|KJB58438.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=957

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>gb|KJB58440.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=859

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>gb|KJB58436.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=1021

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_011083822.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105166233 
[Sesamum indicum]
Length=1005

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK   GLLDTLNM+ VRTI TH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHPVGLLDTLNMETVRTIFTHTYPYPHEHSRHAVIAVFIGCLFFISSDNMH  55



>gb|KEH40051.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1020

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>gb|KEH40052.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1067

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  48   MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  102



>ref|XP_010062120.1| PREDICTED: uncharacterized protein LOC104449600 isoform X3 [Eucalyptus 
grandis]
Length=1044

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMH  55



>gb|KEH40050.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=954

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>ref|XP_010062117.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010062119.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
Length=1058

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMH  55



>ref|XP_010529533.1| PREDICTED: uncharacterized protein LOC104806367 [Tarenaya hassleriana]
Length=1014

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK   GLLDTL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHPVGLLDTLKMERVRTILTHTYPYPHEHSRHAIIAVILGCLFFISSDNMH  55



>ref|XP_010062116.1| PREDICTED: uncharacterized protein LOC104449600 isoform X1 [Eucalyptus 
grandis]
Length=1109

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMH  55



>ref|XP_010062121.1| PREDICTED: uncharacterized protein LOC104449600 isoform X4 [Eucalyptus 
grandis]
Length=1011

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMH  55



>emb|CDP01374.1| unnamed protein product [Coffea canephora]
Length=1010

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS++QS G LDTLNM+ VRTILTH  PYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSNRQSVGFLDTLNMETVRTILTHTSPYPHEHSRHAVIAVVVGCLFFISSDNMH  55



>ref|XP_007017323.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY14548.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
Length=1019

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SAGLL TL M +VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSDKHSAGLLPTLGMDRVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNIH  55



>ref|XP_007160825.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
 gb|ESW32819.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
Length=1010

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS KQSA +LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+H
Sbjct  1    MGSSKQSARILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIH  55



>emb|CDY13280.1| BnaC09g23760D [Brassica napus]
Length=1014

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMH  55



>ref|XP_006396852.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
 gb|ESQ38305.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
Length=1013

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA LL+TL M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MGSDKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMH  55



>ref|XP_009367394.1| PREDICTED: uncharacterized protein LOC103957048 [Pyrus x bretschneideri]
Length=1020

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGSDVQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_008393832.1| PREDICTED: uncharacterized protein LOC103455994 isoform X1 [Malus 
domestica]
Length=1021

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGSDVQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_008383912.1| PREDICTED: uncharacterized protein LOC103446557 [Malus domestica]
Length=1020

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGSDMQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_009370173.1| PREDICTED: uncharacterized protein LOC103959542 [Pyrus x bretschneideri]
Length=1020

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNM  501
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN+
Sbjct  1    MGSDMQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNI  54



>ref|XP_009102715.1| PREDICTED: uncharacterized protein LOC103828821 [Brassica rapa]
Length=1014

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS+K SA LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSEKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMH  55



>ref|XP_011458950.1| PREDICTED: uncharacterized protein LOC101313275 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1027

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_004291134.1| PREDICTED: uncharacterized protein LOC101313275 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1022

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_011458951.1| PREDICTED: uncharacterized protein LOC101313275 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1024

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_010538790.1| PREDICTED: uncharacterized protein LOC104813013 [Tarenaya hassleriana]
Length=1007

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS K   GLLDTL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSVKNHVGLLDTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMH  55



>emb|CDX94143.1| BnaC07g37770D [Brassica napus]
Length=1007

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  LD L M++VRT+LTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHSARFLDKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMH  55



>emb|CDY52938.1| BnaCnng23820D [Brassica napus]
Length=1013

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG DK S  LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGPDKHSTRLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMH  55



>ref|XP_009128650.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
 ref|XP_009128652.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
Length=1013

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG DK S  LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGPDKHSTRLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMH  55



>gb|KFK28866.1| hypothetical protein AALP_AA7G058700 [Arabis alpina]
Length=1015

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK +A LL+ L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MGSDKHAARLLNNLKMERVRTILTHTYPYPHEHSRHAMIAVISGCLFFISSDNMH  55



>gb|KGN62541.1| hypothetical protein Csa_2G360580 [Cucumis sativus]
Length=1025

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M S+  SAGLLDT  M++VRTI TH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MVSENISAGLLDTFKMKRVRTIFTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_004152730.1| PREDICTED: uncharacterized protein LOC101204257 [Cucumis sativus]
 ref|XP_004160010.1| PREDICTED: uncharacterized LOC101204257 [Cucumis sativus]
Length=1025

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M S+  SAGLLDT  M++VRTI TH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MVSENISAGLLDTFKMKRVRTIFTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_010268877.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
 ref|XP_010268883.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
Length=1012

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS+KQS GLLD L M++VR ILT  YPYPHEHSRH  IAV VGCLFFISSD+MH
Sbjct  1    MGSNKQSLGLLDNLKMERVRMILTPAYPYPHEHSRHAIIAVVVGCLFFISSDSMH  55



>ref|XP_010540555.1| PREDICTED: uncharacterized protein LOC104814278 isoform X2 [Tarenaya 
hassleriana]
Length=991

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK    LLDT  M++VR ILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHPVSLLDTFKMERVRIILTHTYPYPHEHSRHAVIAVILGCLFFISSDNMH  55



>ref|XP_009393277.1| PREDICTED: uncharacterized protein LOC103979011 [Musa acuminata 
subsp. malaccensis]
Length=1017

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG +KQS G L DTL M++VRTILTH YPYPHEHSRH   AV VGCLFFISSDNMH
Sbjct  1    MGKNKQSIGPLFDTLRMERVRTILTHTYPYPHEHSRHAMTAVMVGCLFFISSDNMH  56



>ref|XP_010540547.1| PREDICTED: uncharacterized protein LOC104814278 isoform X1 [Tarenaya 
hassleriana]
Length=1012

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK    LLDT  M++VR ILTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MGSDKHPVSLLDTFKMERVRIILTHTYPYPHEHSRHAVIAVILGCLFFISSDNMH  55



>ref|XP_010936846.1| PREDICTED: uncharacterized protein LOC105056370 [Elaeis guineensis]
Length=1032

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +1

Query  328  RAAKMGSDKQSA-GLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            +   MG+D+QS+  LLDTL M++V TILTH YPYPHEHSRH+  AV VGCLFFISSDN+H
Sbjct  11   KGCSMGTDRQSSIPLLDTLKMERVTTILTHTYPYPHEHSRHIMTAVVVGCLFFISSDNIH  70



>ref|XP_006413590.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
 gb|ESQ55043.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
Length=1005

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA LL+ L M++VRTILT  YPYPHEHSRH  IAV  GC+FFISSDNMH
Sbjct  1    MGSDKHSARLLNNLKMERVRTILTQTYPYPHEHSRHAMIAVVFGCIFFISSDNMH  55



>ref|XP_008220172.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320287 
[Prunus mume]
Length=1020

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS   S G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGSTTPSVGFLDTLRMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_007227027.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
 gb|EMJ28226.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
Length=1021

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS   S G LDTL M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDN++
Sbjct  1    MGSTTPSVGFLDTLRMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIN  55



>ref|XP_008444644.1| PREDICTED: uncharacterized protein LOC103487913 [Cucumis melo]
Length=1025

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD  S GLLD   M++VRTI TH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MVSDNISVGLLDNFKMKRVRTIFTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  55



>ref|XP_010433955.1| PREDICTED: uncharacterized protein LOC104718003 isoform X2 [Camelina 
sativa]
Length=902

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMH  55



>ref|XP_010433954.1| PREDICTED: uncharacterized protein LOC104718003 isoform X1 [Camelina 
sativa]
Length=1013

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMH  55



>ref|XP_002869795.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46054.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
Length=1015

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMH  55



>ref|XP_008799898.1| PREDICTED: uncharacterized protein LOC103714434 isoform X2 [Phoenix 
dactylifera]
Length=984

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG+DKQS+  LLDTL M++V TILTH YPYPHEHSRH+ +AV  GCLFFISSDN+H
Sbjct  1    MGTDKQSSSPLLDTLKMERVTTILTHTYPYPHEHSRHIMMAVVAGCLFFISSDNIH  56



>ref|XP_008799897.1| PREDICTED: uncharacterized protein LOC103714434 isoform X1 [Phoenix 
dactylifera]
Length=1018

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG+DKQS+  LLDTL M++V TILTH YPYPHEHSRH+ +AV  GCLFFISSDN+H
Sbjct  1    MGTDKQSSSPLLDTLKMERVTTILTHTYPYPHEHSRHIMMAVVAGCLFFISSDNIH  56



>ref|NP_194031.5| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
 gb|AEE84691.1| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
Length=1015

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV +GC+FFISS+NMH
Sbjct  1    MGSDKNSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVVLGCMFFISSENMH  55



>emb|CAB45564.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79255.1| hypothetical protein [Arabidopsis thaliana]
Length=932

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV +GC+FFISS+NMH
Sbjct  27   MGSDKNSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVVLGCMFFISSENMH  81



>ref|XP_008811243.1| PREDICTED: uncharacterized protein LOC103722455 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M ++KQS G   DTL M++VRTILTH YPYPHEHSRH   AV VGCLFFISSDNMH
Sbjct  1    MSTNKQSVGPFFDTLKMERVRTILTHTYPYPHEHSRHAMTAVIVGCLFFISSDNMH  56



>emb|CDX98782.1| BnaA03g45670D [Brassica napus]
Length=1007

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SDK SA  L+ L M++VRT+LTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MSSDKHSARFLNKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMH  55



>ref|XP_009137306.1| PREDICTED: uncharacterized protein LOC103861350 [Brassica rapa]
Length=1007

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SDK SA  L+ L M++VRT+LTH YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    MSSDKHSARFLNKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMH  55



>ref|XP_010932753.1| PREDICTED: uncharacterized protein LOC105053349 isoform X2 [Elaeis 
guineensis]
Length=904

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG+ KQS G   DTL M++VRTILTH YPYPH+HSRH   AV VGCLFFISSDNMH
Sbjct  1    MGTYKQSVGPFFDTLKMERVRTILTHTYPYPHQHSRHAMTAVIVGCLFFISSDNMH  56



>ref|XP_010044195.1| PREDICTED: uncharacterized protein LOC104433212 isoform X1 [Eucalyptus 
grandis]
Length=1012

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS++QS GLL TL M   RTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSERQSMGLLGTLRM---RTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNMH  52



>ref|NP_001058702.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAC81181.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31941.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20616.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAG93283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81383.1| hypothetical protein OsI_24595 [Oryza sativa Indica Group]
 gb|EEE66435.1| hypothetical protein OsJ_22800 [Oryza sativa Japonica Group]
Length=1016

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS   LL TL M+ VRTILTH YPYPHEHSRH+  AV + CLFFISSDNMH
Sbjct  1    MGSDKQSGSPLLGTLKMKSVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMH  56



>ref|XP_010044196.1| PREDICTED: uncharacterized protein LOC104433212 isoform X2 [Eucalyptus 
grandis]
Length=926

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS++QS GLL TL M   RTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSERQSMGLLGTLRM---RTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNMH  52



>gb|KJB63807.1| hypothetical protein B456_010G017500 [Gossypium raimondii]
Length=1017

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK+SAGLL    M++VRTILTH Y YPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGSDKRSAGLLP--RMERVRTILTHKYRYPHEHSRHAIIAVVVGCLFFISSDNMH  53



>ref|XP_010932752.1| PREDICTED: uncharacterized protein LOC105053349 isoform X1 [Elaeis 
guineensis]
Length=1015

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG+ KQS G   DTL M++VRTILTH YPYPH+HSRH   AV VGCLFFISSDNMH
Sbjct  1    MGTYKQSVGPFFDTLKMERVRTILTHTYPYPHQHSRHAMTAVIVGCLFFISSDNMH  56



>ref|XP_010448789.1| PREDICTED: uncharacterized protein LOC104731191 isoform X2 [Camelina 
sativa]
Length=901

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHE+SRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEYSRHAMIAVILGCLFFISSENMH  55



>ref|XP_010448786.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
 ref|XP_010448787.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
Length=1012

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK SA  L  L M++VRTILTH YPYPHE+SRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEYSRHAMIAVILGCLFFISSENMH  55



>ref|XP_010455595.1| PREDICTED: uncharacterized protein LOC104737182 [Camelina sativa]
Length=1013

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMH  55



>ref|XP_010422134.1| PREDICTED: uncharacterized protein LOC104707474 [Camelina sativa]
Length=1013

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMH  55



>ref|XP_010434128.1| PREDICTED: uncharacterized protein LOC104718144 [Camelina sativa]
Length=1013

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMH  55



>ref|XP_008651923.1| PREDICTED: uncharacterized protein LOC103631870 isoform X2 [Zea 
mays]
 ref|XP_008651924.1| PREDICTED: uncharacterized protein LOC103631870 isoform X3 [Zea 
mays]
Length=978

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = +1

Query  340  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ      LL+TL M +VRTILTH YPYPHEHSRH+  AV + CLFFISSDNMH
Sbjct  1    MGSDKQIGSPRQLLETLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMH  58



>ref|XP_006285736.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
 gb|EOA18634.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
Length=1015

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDK S   L  L M++VRT+LTH YPYPHEHSRH  IAV +GCLFFISS+NMH
Sbjct  1    MGSDKHSPRFLHNLKMERVRTMLTHTYPYPHEHSRHAMIAVILGCLFFISSENMH  55



>ref|XP_008651921.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 ref|XP_008651922.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 tpg|DAA59346.1| TPA: hypothetical protein ZEAMMB73_449975 [Zea mays]
Length=1018

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = +1

Query  340  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ      LL+TL M +VRTILTH YPYPHEHSRH+  AV + CLFFISSDNMH
Sbjct  1    MGSDKQIGSPRQLLETLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMH  58



>ref|XP_010684140.1| PREDICTED: uncharacterized protein LOC104898734 [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGS+K + GLLDT+ M+  RTIL H YPYPHEHSRH  IAV +GCLFFIS DNM+
Sbjct  1    MGSNKAAVGLLDTIKMESFRTILPHNYPYPHEHSRHAIIAVVLGCLFFISFDNMN  55



>ref|XP_006286984.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
 gb|EOA19882.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
Length=1013

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD+ S  L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMH
Sbjct  1    MVSDRHSTRLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMH  55



>ref|XP_002461307.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
 gb|EER97828.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
Length=1018

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +1

Query  340  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ      LL TL M +VRTILTH YPYPHEHSRH+  AV + CLFFISSDNMH
Sbjct  1    MGSDKQIGSPRPLLGTLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMH  58



>ref|XP_003557697.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
 ref|XP_010228472.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
Length=1016

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = +1

Query  340  MGSDKQSAG-LLDTLNMQ-KVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQS   LL TL +  +VRTILTH YPYPHEHSRH+  AV +GCLFFISSDNMH
Sbjct  1    MGSDKQSGSPLLGTLKVGGRVRTILTHTYPYPHEHSRHIMTAVIIGCLFFISSDNMH  57



>ref|XP_004987257.1| PREDICTED: uncharacterized protein LOC101786352 isoform X1 [Setaria 
italica]
Length=1018

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +1

Query  340  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MGSDKQ      LL  L M +VRTILTH YPYPHEHSRH+  AV + CLFFISSDNMH
Sbjct  1    MGSDKQGGSPRPLLGNLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMH  58



>ref|XP_006342611.1| PREDICTED: uncharacterized protein LOC102601564 [Solanum tuberosum]
Length=1020

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG DKQ +G+LDTL M+ VRTI    Y YPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGIDKQPSGILDTLKMETVRTIFPS-YRYPHEHSRHFVIAVVVGCLFFISSDNMH  54



>ref|XP_004252774.1| PREDICTED: uncharacterized protein LOC101266203 [Solanum lycopersicum]
Length=1020

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG DKQ +G+LDTL M+ VRTI    Y YPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MGIDKQPSGILDTLKMETVRTIFPS-YRYPHEHSRHFVIAVVVGCLFFISSDNMH  54



>ref|XP_009392959.1| PREDICTED: uncharacterized protein LOC103978755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQS-AGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG++KQS + LLDTL M++V TIL   YPYPHEHSRH  +AV VGCLFFISSDNMH
Sbjct  15   MGNNKQSMSPLLDTLKMERVSTILNPAYPYPHEHSRHTIMAVVVGCLFFISSDNMH  70



>ref|XP_009392951.1| PREDICTED: uncharacterized protein LOC103978755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1031

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  340  MGSDKQS-AGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG++KQS + LLDTL M++V TIL   YPYPHEHSRH  +AV VGCLFFISSDNMH
Sbjct  15   MGNNKQSMSPLLDTLKMERVSTILNPAYPYPHEHSRHTIMAVVVGCLFFISSDNMH  70



>ref|XP_002874725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1027

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M SD  SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNM 
Sbjct  1    MVSDGHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQ  55



>gb|EPS68439.1| hypothetical protein M569_06328, partial [Genlisea aurea]
Length=1008

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  346  SDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            SD +  G LD L M  VRTILT  YPYPHEHSRH  IAV +GCLFFISSDNMH
Sbjct  1    SDDRPNGFLDRLKMGTVRTILTPTYPYPHEHSRHAVIAVFIGCLFFISSDNMH  53



>ref|NP_192917.3| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83050.1| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
Length=1013

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M S++ SA L ++L M+  RTILTH YPYPHEHSRH  IAV  GCLFFISSDNM 
Sbjct  1    MVSERHSARLYNSLPMESFRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQ  55



>ref|XP_006856661.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
 gb|ERN18128.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
Length=1067

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +1

Query  331  AAKMGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
              KM + K S G LL+ L M++VRTILT+ YPYPHEHSRH   AV V CLFFISSDN+H
Sbjct  46   GGKMLTRKNSRGPLLENLGMERVRTILTYKYPYPHEHSRHAMTAVIVACLFFISSDNLH  104



>ref|XP_002510264.1| hydrolase, putative [Ricinus communis]
 gb|EEF52451.1| hydrolase, putative [Ricinus communis]
Length=1006

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMH  40



>ref|XP_010664588.1| PREDICTED: uncharacterized protein LOC100267859 isoform X1 [Vitis 
vinifera]
Length=1004

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRTILTHRYPYPHEHSRHAIIAVVVGCLFFISSDNMH  40



>emb|CBI19565.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRTILTHRYPYPHEHSRHAIIAVVVGCLFFISSDNMH  40



>ref|XP_006434822.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48062.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=1004

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH +PYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRTILTHTHPYPHEHSRHAIIAVIVGCLFFISSDNMH  40



>ref|XP_006434821.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48061.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=829

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH +PYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRTILTHTHPYPHEHSRHAIIAVIVGCLFFISSDNMH  40



>gb|KCW69186.1| hypothetical protein EUGRSUZ_F02708 [Eucalyptus grandis]
Length=996

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMH  40



>ref|XP_006657430.1| PREDICTED: uncharacterized protein LOC102702861 [Oryza brachyantha]
Length=1021

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 4/59 (7%)
 Frame = +1

Query  340  MGSDK----QSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            MG +K    +S  L+++L M++VRTILTH YPYPHEHSRHL IAV    LFF+SSDN+ 
Sbjct  1    MGREKLRKQRSGRLIESLKMERVRTILTHRYPYPHEHSRHLMIAVFAIWLFFVSSDNLQ  59



>ref|XP_011074457.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
 ref|XP_011074458.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
Length=1007

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M+ VRTI TH YPYPHEHSRH  IAV +GC+FFISSDNMH
Sbjct  1    METVRTIFTHTYPYPHEHSRHAVIAVILGCVFFISSDNMH  40



>ref|XP_010275607.1| PREDICTED: uncharacterized protein LOC104610601 [Nelumbo nucifera]
Length=1000

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VR ILT  YPYPHEHSRH  IAV VGCLFFISSDNMH
Sbjct  1    MERVRMILTPAYPYPHEHSRHAIIAVVVGCLFFISSDNMH  40



>emb|CAB44318.1| putative protein [Arabidopsis thaliana]
 emb|CAB78223.1| putative protein [Arabidopsis thaliana]
Length=1012

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M+  RTILTH YPYPHEHSRH  IAV  GCLFFISSDNM 
Sbjct  1    MESFRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQ  40



>gb|EMS47321.1| hypothetical protein TRIUR3_13192 [Triticum urartu]
Length=725

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH  PYPHEHSRH+  AV +GCLFFISSDNMH
Sbjct  1    MERVRTILTHT-PYPHEHSRHIMTAVIIGCLFFISSDNMH  39



>ref|XP_004956163.1| PREDICTED: uncharacterized protein LOC101776542 [Setaria italica]
Length=1021

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  352  KQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            KQ +G L+++L M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+ 
Sbjct  8    KQPSGRLIESLKMERMRNILTHRYPYPHEHSRHFMIAVFACWLFFISSDNLQ  59



>ref|XP_008670049.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 ref|XP_008670050.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 tpg|DAA39653.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=1041

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  352  KQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            KQ +G L+++L M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+ 
Sbjct  8    KQPSGRLIESLKMERMRNILTHRYPYPHEHSRHFIIAVFACWLFFISSDNLQ  59



>ref|XP_010238512.1| PREDICTED: uncharacterized protein LOC100842069 isoform X1 [Brachypodium 
distachyon]
Length=1003

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH YPYPHEHSRH  IAV  G LF ISSDN+ 
Sbjct  1    MERVRTILTHRYPYPHEHSRHFMIAVIAGWLFLISSDNLQ  40



>ref|XP_010238513.1| PREDICTED: uncharacterized protein LOC100842069 isoform X2 [Brachypodium 
distachyon]
Length=1003

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M++VRTILTH YPYPHEHSRH  IAV  G LF ISSDN+ 
Sbjct  1    MERVRTILTHRYPYPHEHSRHFMIAVIAGWLFLISSDNLQ  40



>ref|XP_002963358.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
 gb|EFJ35229.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
Length=999

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M +V+ ILTH Y YPHEHSRH  +AV  GCLFFIS+DN H
Sbjct  1    MDRVKEILTHQYSYPHEHSRHAMLAVLAGCLFFISTDNFH  40



>ref|XP_002974647.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
 gb|EFJ24167.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
Length=999

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M +V+ ILTH Y YPHEHSRH  +AV  GCLFFIS+DN H
Sbjct  1    MDRVKEILTHQYSYPHEHSRHAMLAVLAGCLFFISTDNFH  40



>ref|XP_002461963.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
 gb|EER98484.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
Length=936

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  385  MQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
            M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+ 
Sbjct  1    MERMRNILTHRYPYPHEHSRHFIIAVFACWLFFISSDNLQ  40



>ref|XP_001765009.1| predicted protein [Physcomitrella patens]
 gb|EDQ70225.1| predicted protein [Physcomitrella patens]
Length=1105

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  382  NMQKVRTILTHPYPYPHEHSRHLFIAVXVGCLFFISSDNMH  504
             +++VRT+L H YPYPHEHS+H  IAV    LFFI SDN+H
Sbjct  8    TVRRVRTMLQHEYPYPHEHSQHALIAVVAVALFFIFSDNLH  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905