BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF018N23

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          105   6e-25   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                105   1e-24   Ipomoea batatas [batate]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                    94.0    1e-20   Solanum tuberosum [potatoes]
ref|NP_001291326.1|  catalase isozyme 1                               90.5    3e-19   Sesamum indicum [beniseed]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2             90.1    4e-19   Cucurbita pepo
gb|ACL27272.1|  catalase                                              90.1    4e-19   Nicotiana benthamiana
gb|AGE15298.2|  catalase 1                                            90.1    4e-19   Eriobotrya japonica [loquat]
gb|AGC65520.1|  catalase                                              90.1    4e-19   Eriobotrya japonica [loquat]
ref|NP_001234186.1|  catalase isozyme 2                               90.1    4e-19   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like               89.7    5e-19   
gb|ADM96039.1|  catalase                                              89.7    5e-19   Cucumis sativus [cucumbers]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                    89.7    5e-19   Nicotiana sylvestris
gb|ACB11496.1|  catalase                                              89.7    5e-19   Pinus sylvestris [Scotch pine]
gb|AHF27433.1|  catalase                                              89.7    6e-19   Cucurbita maxima [Boston marrow]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g           89.7    6e-19   Populus trichocarpa [western balsam poplar]
emb|CCP37650.1|  catalase-1                                           89.7    6e-19   Nicotiana tabacum [American tobacco]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                        89.7    6e-19   Vigna radiata var. radiata [golden gram]
gb|ADZ45555.1|  catalase                                              89.7    6e-19   Vigna radiata [mung bean]
gb|AIX10947.1|  putative catalase                                     89.4    6e-19   Gardenia jasminoides
gb|AAB71764.1|  catalase 1                                            89.4    6e-19   Nicotiana tabacum [American tobacco]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2            89.4    7e-19   Populus euphratica
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg              89.4    7e-19   Erythranthe guttata [common monkey flower]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3             89.4    7e-19   Cucurbita pepo
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                    89.4    7e-19   Cucumis melo [Oriental melon]
gb|AHF27430.1|  catalase                                              89.4    8e-19   Cucurbita moschata [ayote]
gb|ADZ45556.1|  catalase                                              89.4    8e-19   Vigna radiata [mung bean]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...  89.4    8e-19   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                          89.4    9e-19   Pisum sativum [garden pea]
dbj|BAH37035.1|  catalase 1                                           89.4    9e-19   Pisum sativum [garden pea]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg              89.0    1e-18   Erythranthe guttata [common monkey flower]
gb|AFD29285.1|  catalase                                              89.0    1e-18   Vicia faba [broad bean]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g           88.6    1e-18   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                   88.6    1e-18   Eucalyptus grandis [rose gum]
emb|CAD42908.1|  catalase                                             88.6    1e-18   Prunus persica
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2            88.6    1e-18   Cicer arietinum [garbanzo]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like               88.6    1e-18   Cucumis melo [Oriental melon]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                    88.6    1e-18   Prunus mume [ume]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg           88.6    1e-18   Prunus persica
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g           88.6    1e-18   
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like               88.6    1e-18   Populus euphratica
gb|ACJ71245.1|  catalase 2                                            87.4    2e-18   Vigna unguiculata
gb|ACJ71244.1|  catalase 2                                            87.4    2e-18   Vigna unguiculata
ref|XP_010094556.1|  Catalase isozyme 1                               88.2    2e-18   Morus notabilis
gb|AII23739.1|  catalase                                              88.2    2e-18   Zostera marina
ref|XP_002301920.1|  catalase family protein                          88.2    2e-18   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                             88.2    2e-18   Populus deltoides
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g           87.4    2e-18   
ref|XP_007018034.1|  Catalase 2                                       88.2    2e-18   
gb|AFU48609.1|  catalase 1                                            87.8    2e-18   Nicotiana benthamiana
gb|EPS69543.1|  catalase                                              87.8    3e-18   Genlisea aurea
ref|XP_002521709.1|  catalase, putative                               87.8    3e-18   Ricinus communis
gb|ABM47415.1|  catalase                                              87.4    3e-18   Prunus avium [gean]
dbj|BAC79443.1|  catalase                                             87.4    3e-18   Acacia ampliceps
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1    87.4    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550        87.4    3e-18   Amborella trichopoda
ref|NP_001237571.1|  catalase-4                                       87.4    4e-18   Glycine max [soybeans]
gb|KEH36312.1|  catalase heme-binding enzyme                          87.4    4e-18   Medicago truncatula
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2         87.4    4e-18   
gb|ADC95629.1|  catalase                                              87.4    4e-18   Bruguiera gymnorhiza [Burma mangrove]
gb|ABK24453.1|  unknown                                               87.4    4e-18   Picea sitchensis
gb|AIA61608.1|  catalase                                              87.4    4e-18   Gynostemma pentaphyllum [jiaogulan]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like               87.4    4e-18   Phoenix dactylifera
gb|KEH36313.1|  catalase heme-binding enzyme                          86.7    4e-18   Medicago truncatula
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3         87.0    4e-18   Sesamum indicum [beniseed]
gb|AET97564.1|  catalase                                              87.0    5e-18   Ziziphus jujuba [Chinese jujube]
gb|ACL35349.1|  catalase                                              87.0    5e-18   Picea glauca
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                    87.0    5e-18   Vitis vinifera
ref|NP_001237556.1|  catalase-1/2                                     87.0    5e-18   Glycine max [soybeans]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                    87.0    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                       87.0    5e-18   Tarenaya hassleriana [spider flower]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                        87.0    5e-18   Soldanella alpina
gb|KJB17473.1|  hypothetical protein B456_003G002800                  87.0    5e-18   Gossypium raimondii
ref|NP_001235974.1|  catalase-3                                       87.0    6e-18   Glycine max [soybeans]
emb|CBI29557.3|  unnamed protein product                              83.2    6e-18   Vitis vinifera
ref|NP_001240021.1|  catalase                                         86.7    6e-18   Glycine max [soybeans]
ref|NP_001289779.1|  catalase isozyme 1                               86.7    6e-18   Nelumbo nucifera [Indian lotus]
gb|AAC39465.1|  catalase 3                                            82.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12976.1|  Catalase isozyme 2                                    86.7    7e-18   Gossypium arboreum [tree cotton]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like               86.7    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2             86.7    7e-18   Gossypium hirsutum [American cotton]
gb|AHF21552.1|  catalase                                              86.7    7e-18   Hylocereus undatus [dragon fruit]
gb|KJB14250.1|  hypothetical protein B456_002G115900                  86.7    8e-18   Gossypium raimondii
gb|AJE26131.1|  catalase                                              86.7    8e-18   Salix matsudana [tortured willow]
gb|ACJ11733.1|  catalase                                              86.7    8e-18   Gossypium hirsutum [American cotton]
gb|KHG25152.1|  Catalase isozyme 1                                    86.7    8e-18   Gossypium arboreum [tree cotton]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                    86.7    8e-18   Fragaria vesca subsp. vesca
emb|CDP07287.1|  unnamed protein product                              86.3    9e-18   Coffea canephora [robusta coffee]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                    86.3    9e-18   Nicotiana tomentosiformis
gb|KJB17474.1|  hypothetical protein B456_003G002800                  85.9    9e-18   Gossypium raimondii
ref|XP_001784759.1|  predicted protein                                86.3    1e-17   
gb|AAB70006.1|  catalase                                              86.3    1e-17   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                              86.3    1e-17   Chlamydomonas reinhardtii
gb|AFU90822.1|  catalase                                              86.3    1e-17   Populus tomentosa [Chinese white poplar]
gb|AFU90823.1|  catalase                                              85.9    1e-17   Populus x beijingensis
gb|KHG21219.1|  Catalase isozyme 1                                    85.5    1e-17   Gossypium arboreum [tree cotton]
gb|KJB57963.1|  hypothetical protein B456_009G187600                  85.9    1e-17   Gossypium raimondii
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g           85.9    1e-17   Phaseolus vulgaris [French bean]
gb|ACA50528.1|  putative catalase 2                                   85.9    1e-17   Brassica napus [oilseed rape]
gb|ACL81498.1|  catalase                                              85.9    1e-17   Ginkgo biloba [ginkgo]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2    85.5    1e-17   Nelumbo nucifera [Indian lotus]
ref|NP_195235.1|  catalase 2                                          85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                             85.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                    85.9    2e-17   Nicotiana tomentosiformis
tpg|DAA43177.1|  TPA: catalase2                                       85.5    2e-17   
ref|NP_001031791.1|  catalase 2                                       85.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                    85.5    2e-17   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                    85.5    2e-17   
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                    85.5    2e-17   
gb|AAK96854.1|  catalase                                              85.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19523.1|  AT4G35090                                            85.5    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30147.1|  catalase                                              85.5    2e-17   Arabis alpina [alpine rockcress]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg           85.5    2e-17   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                              85.5    2e-17   Eutrema halophilum
gb|ABK24543.1|  unknown                                               85.5    2e-17   Picea sitchensis
ref|XP_009138342.1|  PREDICTED: catalase-2                            85.5    2e-17   Brassica rapa
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                    85.5    2e-17   Nicotiana sylvestris
tpg|DAA43178.1|  TPA: catalase2                                       85.5    2e-17   
emb|CDX72514.1|  BnaC07g45360D                                        85.5    2e-17   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                     85.5    2e-17   Cucumis sativus [cucumbers]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144           85.5    2e-17   
emb|CDY40645.1|  BnaA03g53180D                                        85.5    2e-17   Brassica napus [oilseed rape]
gb|ACV92695.1|  catalase                                              85.5    2e-17   Brassica oleracea
gb|AAD17935.1|  catalase                                              85.5    2e-17   Brassica juncea [brown mustard]
gb|AAF71742.1|AF248491_1  catalase                                    85.5    2e-17   Raphanus sativus
gb|AAD17933.1|  catalase                                              85.5    2e-17   Brassica juncea [brown mustard]
ref|XP_010437527.1|  PREDICTED: catalase-2                            85.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                       85.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg           85.5    2e-17   Capsella rubella
gb|AFN81243.1|  catalase 1                                            85.5    2e-17   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg           85.5    2e-17   Eutrema salsugineum [saltwater cress]
emb|CDX69111.1|  BnaC01g03420D                                        85.1    2e-17   
emb|CAA73663.1|  catalase                                             85.5    2e-17   Chlamydomonas reinhardtii
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                    85.5    2e-17   Elaeis guineensis
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                    85.1    2e-17   Cucumis melo [Oriental melon]
ref|XP_001752315.1|  predicted protein                                85.1    2e-17   
gb|AIZ77475.1|  catalase                                              85.1    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009106100.1|  PREDICTED: catalase-2                            85.1    2e-17   Brassica rapa
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                     85.1    2e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AGV54297.1|  peroxisomal catalase                                  85.1    2e-17   Phaseolus vulgaris [French bean]
gb|AAC19397.1|  leaf catalase                                         85.1    2e-17   Mesembryanthemum crystallinum
ref|XP_009149539.1|  PREDICTED: catalase-3                            85.1    3e-17   Brassica rapa
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3             85.1    3e-17   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                       85.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007046520.1|  Catalase 2                                       85.1    3e-17   Theobroma cacao [chocolate]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g           84.7    3e-17   Phaseolus vulgaris [French bean]
gb|AAR84578.1|  catalase 1a                                           84.7    3e-17   Lotus japonicus
ref|XP_010530333.1|  PREDICTED: catalase-2                            84.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_002306976.2|  catalase family protein                          84.7    3e-17   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like               85.9    4e-17   
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1             84.7    4e-17   Cucurbita pepo
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                    84.7    4e-17   Populus euphratica
gb|AAR84577.1|  catalase 1b                                           84.3    4e-17   Lotus japonicus
gb|ABV55108.1|  catalase 2                                            84.3    4e-17   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                    84.3    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010692546.1|  PREDICTED: catalase                              84.3    5e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like               84.3    5e-17   Vitis vinifera
gb|AAD17936.1|  catalase                                              84.3    5e-17   Brassica juncea [brown mustard]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1             84.3    5e-17   Ricinus communis
ref|NP_001268098.1|  catalase                                         84.3    5e-17   Vitis vinifera
gb|AHB72694.1|  catalase                                              84.3    5e-17   Beta vulgaris subsp. maritima [sea beet]
emb|CDP07288.1|  unnamed protein product                              84.3    5e-17   Coffea canephora [robusta coffee]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                       84.0    6e-17   Jatropha curcas
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                    84.0    6e-17   Phoenix dactylifera
emb|CDP01803.1|  unnamed protein product                              84.0    6e-17   Coffea canephora [robusta coffee]
gb|ABF93811.1|  Catalase-1, putative, expressed                       83.2    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAO17721.1|  catalase                                              84.0    6e-17   Hypericum perforatum
ref|XP_002950455.1|  catalase                                         84.0    6e-17   Volvox carteri f. nagariensis
dbj|BAJ90861.1|  predicted protein                                    84.0    6e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX88799.1|  catalase                                              84.0    7e-17   Euphorbia characias
gb|AHA50082.1|  catalase                                              84.0    7e-17   Eleutherococcus senticosus
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg           83.6    8e-17   Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4    83.6    8e-17   Citrus sinensis [apfelsine]
gb|ABK24449.1|  unknown                                               83.6    8e-17   Picea sitchensis
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like               83.6    8e-17   Nicotiana sylvestris
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like               83.6    9e-17   Nicotiana tomentosiformis
emb|CAG23920.1|  catalase                                             83.6    1e-16   Festuca arundinacea [tall fescue]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg           83.6    1e-16   Capsella rubella
ref|XP_010536470.1|  PREDICTED: catalase-2-like                       83.6    1e-16   Tarenaya hassleriana [spider flower]
gb|AAC49807.1|  catalase 3                                            83.2    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29519.1|  BnaA06g14510D                                        83.2    1e-16   Brassica napus [oilseed rape]
emb|CDY01364.1|  BnaA07g11370D                                        83.6    1e-16   
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like               83.2    1e-16   Prunus mume [ume]
gb|AIS20825.1|  CAT                                                   83.2    1e-16   Pyrus x bretschneideri [bai li]
gb|AAF61734.1|AF243519_1  catalase 4                                  83.2    1e-16   Helianthus annuus
gb|AAF19965.1|AF207906_1  catalase 1                                  83.2    1e-16   Zantedeschia aethiopica [arum-lily]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171           83.2    1e-16   Selaginella moellendorffii
ref|XP_009362858.1|  PREDICTED: catalase-4-like                       79.3    1e-16   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                  83.2    1e-16   Arabis alpina [alpine rockcress]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg           83.2    1e-16   Prunus persica
emb|CAD42909.1|  catalase                                             83.2    1e-16   Prunus persica
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313           83.2    1e-16   
gb|AAD30291.2|AF139538_1  catalase 2                                  83.2    1e-16   Raphanus sativus
ref|XP_006649332.1|  PREDICTED: catalase-1-like                       82.8    1e-16   Oryza brachyantha
ref|NP_001048861.1|  Os03g0131200                                     82.8    1e-16   
gb|AAM65021.1|  unknown                                               82.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                          82.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                            82.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA34205.1|  catalase                                             82.8    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AAD30292.1|AF139539_1  catalase 3                                  82.8    2e-16   Raphanus sativus
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160        82.8    2e-16   Amborella trichopoda
emb|CDY31878.1|  BnaC07g15280D                                        82.8    2e-16   Brassica napus [oilseed rape]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                    82.8    2e-16   Elaeis guineensis
ref|NP_001031073.1|  catalase 3                                       82.8    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50974.1|AF170272_1  catalase CAT1                               82.8    2e-16   Manihot esculenta [manioc]
emb|CDY33636.1|  BnaC08g19360D                                        82.8    2e-16   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                       82.8    2e-16   Brassica rapa
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2            82.8    2e-16   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                    82.4    2e-16   Phoenix dactylifera
ref|XP_009110221.1|  PREDICTED: catalase-3                            82.8    2e-16   Brassica rapa
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2    82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1    82.8    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like               82.4    2e-16   Elaeis guineensis
prf||1803522A  catalase                                               82.4    2e-16
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3            82.4    2e-16   
gb|AAG61140.2|AF332973_1  catalase 2                                  82.4    2e-16   Zantedeschia aethiopica [arum-lily]
gb|AAZ29552.1|  catalase-C                                            82.4    2e-16   Oryza sativa Indica Group [Indian rice]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2             82.4    2e-16   Zea mays [maize]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                       82.4    2e-16   Tarenaya hassleriana [spider flower]
gb|AAC84138.1|  catalase                                              79.3    2e-16   Cichorium intybus [radicchio]
gb|ADU56199.1|  catalase                                              82.4    3e-16   Hevea brasiliensis [jebe]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like               82.0    3e-16   Solanum tuberosum [potatoes]
gb|ADQ28492.1|  catalase                                              82.0    3e-16   Aeluropus littoralis
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                        82.0    3e-16   Helianthus annuus
prf||2104177A  catalase                                               82.0    3e-16
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like               82.0    3e-16   Eucalyptus grandis [rose gum]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1             82.0    4e-16   Solanum tuberosum [potatoes]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                    82.0    4e-16   Solanum lycopersicum
ref|NP_001274863.1|  catalase isozyme 1                               82.0    4e-16   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2             81.6    4e-16   Solanum tuberosum [potatoes]
gb|AAR97905.1|  catalase                                              81.6    4e-16   Solanum tuberosum [potatoes]
gb|ABC01913.1|  catalase isozyme 1-like protein                       81.6    4e-16   Solanum tuberosum [potatoes]
ref|NP_001105310.1|  catalase isozyme 2                               81.6    4e-16   
prf||1906388A  catalase                                               81.6    4e-16
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                   82.0    4e-16   Eucalyptus grandis [rose gum]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2             81.6    4e-16   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAF61732.1|AF243517_1  catalase 2                                  81.6    4e-16   Helianthus annuus
emb|CAA45564.1|  catalase                                             81.6    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g           81.6    4e-16   
gb|ABB72796.1|  catalase isozyme 1-like protein                       81.6    5e-16   Solanum tuberosum [potatoes]
ref|NP_001234827.1|  catalase isozyme 1                               81.3    5e-16   Solanum lycopersicum
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like               81.3    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_001779509.1|  predicted protein                                81.3    5e-16   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                    81.3    5e-16   
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg           80.9    5e-16   
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2    81.3    6e-16   Eucalyptus grandis [rose gum]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like               80.9    6e-16   
gb|AFR53082.1|  CAT                                                   81.3    6e-16   Anthurium andraeanum [flamingo-lily]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1             81.3    6e-16   Gossypium hirsutum [American cotton]
gb|AIU99481.1|  catalase                                              80.9    7e-16   Saccharum spontaneum [fodder cane]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like               80.9    7e-16   
gb|AAF61733.1|AF243518_1  catalase 3                                  80.9    7e-16   Helianthus annuus
gb|ACH63223.1|  catalase                                              80.9    7e-16   Rheum australe [Himalayan rhubarb]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                   80.1    7e-16   Eucalyptus grandis [rose gum]
ref|XP_005645077.1|  catalase                                         80.9    8e-16   Coccomyxa subellipsoidea C-169
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                  80.9    8e-16   Arabis alpina [alpine rockcress]
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901           80.9    8e-16   
gb|AIU99480.1|  catalase                                              80.9    8e-16   Saccharum spontaneum [fodder cane]
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           78.2    8e-16   
ref|NP_973873.1|  catalase 3                                          80.5    8e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAE82295.1|  catalase                                             80.9    9e-16   Homogyne alpina
ref|XP_010692544.1|  PREDICTED: catalase-like                         80.9    9e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU99487.1|  catalase                                              80.9    9e-16   Saccharum hybrid cultivar ROC22
gb|AIU99488.1|  catalase                                              80.9    9e-16   Saccharum hybrid cultivar ROC22
gb|AIU99479.1|  catalase                                              80.9    9e-16   Saccharum arundinaceum
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like               80.9    9e-16   Oryza brachyantha
gb|AAY59707.1|  catalase                                              80.9    9e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840        80.5    9e-16   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1            80.5    1e-15   
gb|KGN55500.1|  hypothetical protein Csa_4G658600                     80.1    1e-15   Cucumis sativus [cucumbers]
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1            80.9    1e-15   Brassica rapa
ref|NP_001241808.1|  catalase isozyme B                               80.5    1e-15   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                           80.5    1e-15   Zea mays [maize]
ref|XP_003558892.1|  PREDICTED: catalase-1                            80.5    1e-15   Brachypodium distachyon [annual false brome]
dbj|BAA34204.1|  catalase                                             80.5    1e-15   Oryza sativa Japonica Group [Japonica rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...  80.5    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009149540.1|  PREDICTED: catalase-1                            80.5    1e-15   Brassica rapa
emb|CDY29518.1|  BnaA06g14520D                                        80.5    1e-15   Brassica napus [oilseed rape]
ref|NP_001058635.1|  Os06g0727200                                     80.5    1e-15   
gb|AAB62892.1|  catalase-1                                            80.5    1e-15   Nicotiana glutinosa
emb|CDY31490.1|  BnaC05g15990D                                        80.5    1e-15   
ref|XP_010061175.1|  PREDICTED: catalase-like                         80.5    1e-15   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1    80.5    1e-15   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1             80.5    1e-15   
ref|NP_001105415.1|  catalase isozyme 1                               80.5    1e-15   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                        80.1    1e-15
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                        80.1    2e-15   
gb|AIM43584.1|  catalase                                              80.1    2e-15   
gb|AAC17731.1|  catalase 1                                            80.1    2e-15   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                    80.1    2e-15   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg           80.1    2e-15   
ref|NP_564121.1|  catalase 1                                          80.1    2e-15   
gb|ADU56189.1|  catalase 1                                            76.6    2e-15   
gb|AIU99486.1|  catalase                                              79.7    2e-15   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1            80.1    2e-15   
gb|AAB07026.1|  catalase 1                                            79.7    2e-15   
gb|AIU99485.1|  catalase                                              79.7    2e-15   
ref|XP_010498496.1|  PREDICTED: catalase-3                            79.7    2e-15   
emb|CAA85470.1|  catalase                                             79.7    2e-15   
gb|AAK67359.2|AF390210_1  catalase                                    79.7    2e-15   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3             79.3    3e-15   
dbj|BAA34714.1|  catalase                                             79.3    3e-15   
gb|ACJ22771.1|  catalase 1                                            79.0    3e-15   
gb|ACJ76836.3|  catalase                                              79.0    3e-15   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                      79.0    3e-15   
gb|AIP93616.1|  CAT1                                                  79.0    4e-15   
gb|AAB86582.2|  catalase                                              79.0    4e-15   
ref|NP_001105416.1|  catalase isozyme 3                               79.0    4e-15   
gb|ABY21704.1|  catalase-1 precursor                                  79.0    4e-15   
emb|CAA43814.1|  catalase                                             79.0    4e-15   
gb|AAC19398.1|  root catalase                                         79.0    4e-15   
gb|ABN71233.2|  catalase                                              78.6    5e-15   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like               79.0    5e-15   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1  78.6    5e-15   
ref|NP_001045673.1|  Os02g0115700                                     78.6    5e-15   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...  78.6    5e-15   
gb|ADU56198.1|  catalase                                              78.6    5e-15   
dbj|BAF91369.1|  catalase                                             78.6    6e-15   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                    78.6    6e-15   
gb|AFW66787.1|  catalase3                                             78.6    6e-15   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                         78.2    6e-15
ref|XP_009103333.1|  PREDICTED: catalase-1                            78.2    6e-15   
emb|CDY01363.1|  BnaA07g11360D                                        78.2    6e-15   
emb|CDY31877.1|  BnaC07g15270D                                        78.2    7e-15   
gb|AHZ13843.1|  catalase                                              78.2    7e-15   
gb|AFW66788.1|  catalase3                                             78.2    7e-15   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                       78.2    7e-15   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                    78.2    7e-15   
gb|AAM97542.1|  catalase 3                                            78.2    7e-15   
gb|AGT16310.1|  catalase                                              78.2    8e-15   
gb|AIU99483.1|  catalase                                              78.2    8e-15   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                    77.8    9e-15   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1             77.8    9e-15   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                    77.8    9e-15   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...  77.8    9e-15   
gb|AFW66785.1|  catalase3 isoform 1                                   78.2    1e-14   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like               77.8    1e-14   
emb|CDX76313.1|  BnaA08g10870D                                        77.4    1e-14   
gb|AAM97541.1|  catalase 2                                            77.4    1e-14   
emb|CDY17510.1|  BnaC03g65530D                                        77.4    1e-14   
dbj|BAA05494.1|  catalase                                             77.4    1e-14   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg           77.4    2e-14   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1    77.4    2e-14   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2    77.0    2e-14   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                       77.0    2e-14   
gb|AIU99482.1|  catalase                                              77.0    2e-14   
ref|XP_002510677.1|  catalase, putative                               77.8    2e-14   
ref|XP_005708279.1|  catalase                                         76.3    3e-14   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                        76.3    3e-14   
dbj|BAJ92414.1|  predicted protein                                    76.3    3e-14   
emb|CAH61266.1|  catalase                                             76.3    3e-14   
gb|ADY02963.1|  catalase                                              76.3    3e-14   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2             76.3    3e-14   
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1             76.3    4e-14   
gb|ABK41476.1|  catalase                                              76.3    4e-14   
gb|EMS61345.1|  Catalase isozyme 1                                    76.3    4e-14   
dbj|BAJ88747.1|  predicted protein                                    75.9    6e-14   
gb|AIU99484.1|  catalase                                              75.5    6e-14   
emb|CDY52649.1|  BnaAnng11640D                                        75.5    6e-14   
ref|XP_011396830.1|  Catalase isozyme 2                               75.1    8e-14   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                   75.1    8e-14   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg           74.3    1e-13   
gb|ADN94253.1|  catalase                                              74.7    1e-13   
gb|AAF79625.1|AC027665_26  F5M15.5                                    75.5    1e-13   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                        74.3    2e-13   
gb|AAC48918.1|  salicylic acid binding catalase                       74.3    2e-13   
emb|CDY31488.1|  BnaC05g15970D                                        74.3    2e-13   
gb|ABB51561.1|  truncated catalase 2                                  73.6    2e-13   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                       73.9    2e-13   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                       73.6    3e-13   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1    73.6    3e-13   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2             73.6    3e-13   
ref|XP_010477308.1|  PREDICTED: catalase-1                            73.6    3e-13   
gb|AEQ30070.1|  catalase                                              73.2    4e-13   
gb|AGI65617.1|  catalase                                              72.8    5e-13   
gb|AAP80622.1|AF475100_1  catalase isozyme                            70.9    6e-13   
gb|AAG43363.1|AF151368_1  catalase                                    72.4    9e-13   
ref|XP_002890395.1|  F5M15.5                                          72.8    1e-12   
gb|AEB22071.1|  catalase 2                                            68.9    1e-12   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                        70.9    3e-12   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817            70.5    4e-12   
gb|EMS51034.1|  Catalase isozyme 2                                    70.5    4e-12   
gb|AJF34884.1|  catalase                                              68.9    1e-11   
gb|AGT16188.1|  catalase                                              68.9    1e-11   
gb|AGT16054.1|  catalase                                              68.9    1e-11   
gb|AGT15888.1|  catalase                                              68.9    1e-11   
gb|AGT16203.1|  catalase                                              68.2    2e-11   
gb|ABB88582.1|  catalase                                              68.2    3e-11   
gb|EMT06167.1|  Catalase isozyme 2                                    68.2    3e-11   
gb|KDD77132.1|  catalase                                              66.2    1e-10   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like               66.2    1e-10   
gb|EMT05040.1|  Catalase-1                                            65.5    2e-10   
ref|XP_005536240.1|  catalase                                         64.3    6e-10   
gb|KJB10391.1|  hypothetical protein B456_001G198700                  60.8    8e-09   
gb|AAR14052.2|  catalase                                              60.8    1e-08   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1              58.9    4e-08   
dbj|BAQ21275.1|  catalase                                             58.5    6e-08   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                 58.2    9e-08   
gb|KHG11966.1|  Catalase isozyme 2                                    55.8    3e-07   
ref|XP_005712277.1|  unnamed protein product                          56.6    3e-07   
emb|CAA71757.1|  hypothetical protein                                 50.4    2e-06   
gb|EMT29576.1|  hypothetical protein F775_25197                       50.8    2e-06   
ref|XP_005647994.1|  catalase-domain-containing protein               53.9    2e-06   
ref|XP_005644653.1|  catalase-domain-containing protein               53.9    2e-06   
ref|XP_005642928.1|  catalase                                         53.9    3e-06   
ref|WP_006679508.1|  catalase                                         51.6    1e-05   
gb|AIM05077.1|  catalase                                              48.9    2e-05   
gb|AHJ65563.1|  Catalase                                              50.1    5e-05   
dbj|GAK05364.1|  catalase                                             46.2    1e-04   
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g           48.1    1e-04   
ref|WP_026798903.1|  catalase                                         48.9    1e-04   
ref|WP_016090862.1|  catalase                                         46.6    2e-04   
ref|WP_037688679.1|  catalase                                         48.5    2e-04   
ref|WP_010296013.1|  catalase                                         45.1    2e-04   
ref|WP_035435964.1|  catalase                                         48.1    2e-04   
ref|WP_025967010.1|  catalase                                         48.1    2e-04   
ref|WP_038413367.1|  catalase                                         48.1    2e-04   
ref|WP_030023914.1|  catalase                                         48.1    2e-04   
ref|WP_016122096.1|  catalase                                         48.1    2e-04   
ref|WP_016109536.1|  catalase                                         48.1    2e-04   
ref|WP_002134937.1|  catalase                                         48.1    2e-04   
ref|WP_001069184.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_002149880.1|  catalase                                         48.1    2e-04   
ref|WP_001069185.1|  catalase                                         48.1    2e-04   
ref|WP_001069183.1|  catalase                                         48.1    2e-04   
ref|WP_001069180.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069168.1|  catalase                                         48.1    2e-04   
ref|WP_001069181.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_017674668.1|  catalase                                         48.1    2e-04   
ref|WP_028402967.1|  catalase                                         48.1    2e-04   
ref|WP_002201400.1|  catalase                                         48.1    2e-04   
ref|WP_033673856.1|  catalase                                         48.1    2e-04   
ref|WP_001069189.1|  catalase                                         48.1    2e-04   
ref|WP_043936623.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_023521416.1|  catalase                                         48.1    2e-04   
ref|WP_017152869.1|  catalase                                         48.1    2e-04   
ref|WP_001069186.1|  catalase                                         48.1    2e-04   
ref|WP_001069193.1|  catalase                                         48.1    2e-04   
ref|WP_001069192.1|  catalase                                         48.1    2e-04   
ref|WP_001069161.1|  catalase                                         48.1    2e-04   
ref|WP_001069175.1|  catalase                                         48.1    2e-04   
ref|WP_001069151.1|  catalase                                         48.1    2e-04   
ref|WP_002011249.1|  catalase                                         48.1    2e-04   
ref|WP_016093086.1|  catalase                                         48.1    2e-04   
ref|WP_044792704.1|  catalase                                         48.1    2e-04   
ref|WP_044306649.1|  catalase                                         48.1    2e-04   
ref|WP_001069177.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_017673056.1|  catalase                                         48.1    2e-04   
ref|WP_016113754.1|  catalase                                         48.1    2e-04   
ref|WP_001069163.1|  catalase                                         48.1    2e-04   
ref|WP_001069159.1|  catalase                                         48.1    2e-04   
ref|WP_001069164.1|  catalase                                         48.1    2e-04   
ref|WP_001069176.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_002030287.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069179.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069158.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069162.1|  catalase                                         48.1    2e-04   
gb|AAS40190.1|  catalase                                              48.1    2e-04   
ref|WP_001069155.1|  catalase                                         48.1    2e-04   
ref|WP_001069190.1|  catalase                                         48.1    2e-04   
ref|WP_001069173.1|  catalase                                         48.1    2e-04   
ref|WP_001069172.1|  catalase                                         48.1    2e-04   
ref|WP_044437756.1|  catalase                                         48.1    2e-04   
ref|WP_029437825.1|  catalase                                         48.1    2e-04   
ref|WP_001069157.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_002194469.1|  catalase                                         48.1    2e-04   
ref|WP_016101561.1|  catalase                                         48.1    2e-04   
ref|WP_002202803.1|  catalase                                         48.1    2e-04   
ref|WP_001069174.1|  catalase                                         48.1    2e-04   
ref|WP_002188737.1|  catalase                                         48.1    2e-04   
ref|WP_001069152.1|  catalase                                         48.1    2e-04   
ref|WP_002158904.1|  catalase                                         48.1    2e-04   
ref|WP_002087018.1|  catalase                                         48.1    2e-04   
ref|WP_001069182.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_002064215.1|  catalase                                         48.1    2e-04   
ref|WP_001069154.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069156.1|  catalase                                         48.1    2e-04   
ref|WP_001069166.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069153.1|  catalase                                         48.1    2e-04   
ref|WP_002140813.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_016104158.1|  catalase                                         48.1    2e-04   
ref|WP_016119811.1|  catalase                                         48.1    2e-04   
ref|WP_001069171.1|  catalase                                         48.1    2e-04   
ref|WP_001069167.1|  catalase                                         48.1    2e-04   
ref|WP_002170801.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069170.1|  catalase                                         48.1    2e-04   
ref|WP_002125906.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_001069169.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_033798420.1|  catalase                                         48.1    2e-04   
ref|WP_018763991.1|  catalase                                         48.1    2e-04   
ref|WP_016088914.1|  catalase                                         48.1    2e-04   
ref|WP_016082491.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_002168907.1|  catalase                                         48.1    2e-04   
ref|WP_001069187.1|  catalase                                         48.1    2e-04   
ref|WP_001069165.1|  catalase                                         48.1    2e-04   
ref|WP_006093931.1|  MULTISPECIES: catalase                           48.1    2e-04   
ref|WP_003195883.1|  catalase                                         48.1    2e-04   
ref|WP_001069191.1|  catalase                                         48.1    2e-04   
ref|WP_001069178.1|  catalase                                         48.1    2e-04   
ref|WP_001069160.1|  catalase                                         48.1    2e-04   
ref|WP_000184218.1|  catalase                                         48.1    2e-04   



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   105 bits (263),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/48 (96%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS FNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLV
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLV  48



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   105 bits (262),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS FNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLI  48



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLV  48



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLI  48



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLV  48



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLI  48



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLI  48



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLV  48



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLI  48



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLI  48



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLV  48



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLV  48



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLI  48



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLV  48



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLV  48



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLV  48



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLV  48



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLV  48



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLV  48



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLI  48



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLI  48



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLI  48



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLV  48



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLV  48



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS +NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLV
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLV  48



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLV  48



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLV  48



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLV  48



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP+K+RPSS FN+P+ TTN GAPVWNN  +LTVGSRGPILLEDYHL+
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLI  48



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  85   DPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            DP KYRPSS FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLV
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLV  47



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLV  48



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLV  48



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLV  48



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLV  48



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLI  48



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLV  48



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPS  FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLV  48



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLV  48



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVI  48



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPS  FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLV  48



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLV  48



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLV  48



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLV  48



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYR SS FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLV  48



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLV  48



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLV  48



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLV  48



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLV  48



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPS+ F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLV  48



>gb|AAC39465.1| catalase 3 [Arabidopsis thaliana]
Length=115

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLV  48



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLV  48



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLV  48



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLI  48



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLV  48



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLV  48



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLV  48



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLV  48



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLV  48



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP+K RPSS +NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLV  48



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP+K RPSS +NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLV  48



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  85   DPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            DP KYRPSS F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  47



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  85   DPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            DP KYRPSS F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  47



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLV  48



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPS+ FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLV  48



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLI  48



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLV  48



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLV  48



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLV  48



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|ABK24543.1| unknown [Picea sitchensis]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+P+ TTN GAPVWNNT +LTVG+RGP+LLEDYHL+
Sbjct  1    MDPYKHRPSSAYNSPYLTTNQGAPVWNNTSSLTVGARGPVLLEDYHLI  48



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLV  48



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLV  48



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>emb|CAA73663.1| catalase [Chlamydomonas reinhardtii]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP+K RPSS +NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLV  48



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVI  48



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLV  48



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLV  48



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLV  48



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLV  48



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLV  48



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  73   LISMDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
             I+MDP KYRPSS +N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  99



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLV  48



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLV  48



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLV  48



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLV  48



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLV  48



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLV  48


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  100  RPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            RPSS F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLV
Sbjct  488  RPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLV  529



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS FN PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLV  48



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLV  48



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLV  48



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLV  48



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLV  48



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLV  48



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLV  48



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLI  48



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLV  48



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLV
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLV  48



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TT+ GAPVW+N  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLV  48



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVI  48



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLV  48



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLV  48



>ref|XP_002950455.1| catalase [Volvox carteri f. nagariensis]
 gb|EFJ48656.1| catalase [Volvox carteri f. nagariensis]
Length=498

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSK RPSS +N+P+ TTN GAPVWNN  ++TVG RGPILLEDYHL+
Sbjct  1    MDPSKVRPSSAYNSPYWTTNSGAPVWNNNNSMTVGPRGPILLEDYHLI  48



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLV  48



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS +N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+P+ TTN GAP WNN  +LTVG+RGPILLEDY LV
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLV  48



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RP+S FN PF TTN GAPVWNN  ++T+G RGPILLEDYHLV
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLV  48



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RP+S FN PF TTN GAPVWNN  ++T+G RGPILLEDYHLV
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLV  48



>gb|ABK24449.1| unknown [Picea sitchensis]
Length=492

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N+P+ TTN GAPVWNNT +LTVG+RGP+LLEDYHL+
Sbjct  1    MDPYKHRPSSAHNSPYLTTNQGAPVWNNTSSLTVGARGPVLLEDYHLI  48



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLV  48



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLV
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLV  48



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLV  48



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLI  48



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLL  48



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  79   SMDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            +MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  64   TMDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  112



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLV  48



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLV  48



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS ++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLI  48



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP + RPSS FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLL  48



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLV  48



>ref|XP_009362858.1| PREDICTED: catalase-4-like [Pyrus x bretschneideri]
Length=130

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS FN+PF TTN GAP WNN+ +LTVGSRGP+LLEDYHLV
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPAWNNS-SLTVGSRGPLLLEDYHLV  47



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLV  48



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLV  48



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLV  48



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  48



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP ++RPSS  N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVI  48



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMI  48



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF T N GAPVWNN   +TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLV  48



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLI  48



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLI  48



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLI  48



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVI  48



>prf||1803522A catalase
Length=491

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYH  219
            MDP K+RPSS FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH  46



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF T N GAPVWNN   +TVG RGPILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLV  48



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS ++  F TTN G PVWN+  ALTVGSRGPILLEDYHL+
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLI  48



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYH  219
            MDP K+RPSS FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH  46



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLI  48



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K RPSS +N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLI  48



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLV  48



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLL  48



>gb|ADQ28492.1| catalase [Aeluropus littoralis]
Length=494

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T   TTN GAPVWNN  ALTVG RGPILLEDYHL+
Sbjct  1    MDPCKFRPSSSFDTNVWTTNAGAPVWNNNSALTVGQRGPILLEDYHLI  48



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYR SS +N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLV  48



>prf||2104177A catalase
Length=492

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYR SS +N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLV
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLV  48



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLI  48



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS  N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLL  48



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYH  219
            MDP K+RPSS FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH
Sbjct  1    MDPYKHRPSSAFNPPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH  46



>prf||1906388A catalase
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLV  48



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  70   PLISMDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            P  +MDP KYRPSS  ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLL  140



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSK+RPSS +++PF TTN G PV+NN  +LTVG RGP+LLEDYHL+
Sbjct  1    MDPSKFRPSSAYDSPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYHLI  48



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTN GAPV+NN  +LTVG+RGPILLEDYH V
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFV  48



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRP+S +N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLV
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLV  48



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  94   KYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            +YRPSS +N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLV  46



>gb|ABB72796.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=493

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDPSKYRPSS ++TPF TTN G PV+NN  +LTVG RGP+LLEDY+L+
Sbjct  1    MDPSKYRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPRGPVLLEDYYLI  48



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLI  48



>ref|XP_001779509.1| predicted protein [Physcomitrella patens]
 gb|EDQ55685.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP +YRPSS +NTP+ T N G PV+NNT ++T+GSRGP+LLEDYHLV
Sbjct  1    MDPYRYRPSSAYNTPYMTNNQGGPVFNNTSSMTIGSRGPVLLEDYHLV  48



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLI  48



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLI  48



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLL  48



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLV  48



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS +++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLI  48



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLV
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLV  48



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLI  48



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  82   MDPSKYRPSSXFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLV  225
            MDP KYRPSS FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLV
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLV  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570526909590